Desulfarculus baarsii DSM 2075 uid51371

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|302341511|ref|YP_003806040.1| Redoxin domain protein [Desulfarculus baarsii DSM 2075]
    MRKTLCLILAALTLLAPALPAAALSPVGGPLPAMTLPDADGRQHDLRAELQGKVGLIIYWSVSCPHCRKFMPQLLELARR
    YDGNPFVLIHVNGDGQAMAPAAVAYAKEHGLPQPVLLDVGPDDSEPFAESLDLIATPGVAVVDARGNLRLLQELEPDMAA
    VEKAVQEGF

    >gi|302341527|ref|YP_003806056.1| thioredoxin [Desulfarculus baarsii DSM 2075]
    MESNVQLLCPHCGAKNRAPAARLAENPACGRCKGRLLEAKPVELDGPGLERMLAGDDLPLLVDFWAPWCGPCRSMAPAFA
    EAAGLLWPAARLAKLDTQANQAMAARFGVSSIPTMILFKGGREAARVSGAMPAAQIAAWARGRL

    >gi|302341539|ref|YP_003806068.1| glutaredoxin [Desulfarculus baarsii DSM 2075]
    MANVAIKMYTLSTCSHCKSAKKLLNDNDIKYDMFEVDTCSPDERNKLIDEVRMYNPGCSFPTIVIGDKVIVGYREQEIKE
    ALGL

    >gi|302341583|ref|YP_003806112.1| FAD-dependent pyridine nucleotide-disulfide oxidoreductase [Desulfarculus baarsii DSM 2075]
    MKLVIIGGVAGGATAAARARRLDEKAQIVIFERGEYVSFANCGLPYYVGQVIKERAELLVSTPETFKGKYNIDVRVQTDV
    LAIDRQAKRVRVRDLQTGQSFDEPYDKLILSPGAEPLRPPLPGVDLPGVFSLRSIPDSDRIKAVVDAGQAKTAVVIGGGF
    IGLEMADNLVERGLKVTLVEALDQLMPPLDREMAALAHQNARAKGVDLRLSTKITGFAQAQGGGLTVDTEGGGQITCDMA
    ILSVGVRPENALAKAAGLELGPRGHILVNNALQTNDPDIYAVGDAVQIWDYVTGLPVAIALAGPANRQGRIAADNAMGRL
    SVYRGSLGTAVVKLFGQTIASTGPSQKFLAQNNVAHLVSYSHSANHATYYPGAETMLVKLIFAPSSGRVLGGQIVGGEGV
    DKRIDVLATAIRAGMSVFDLEELDLAYAPPFGSARDPINVAGMVAANIMRGDVKAVLPPAVAAMDPERDVLIDLRFKEEL
    DEAATIPGSLHIPLPMLRAALPGLDKSKRYILY
    CAIGLRGYLGYRIMSQSGFEAVNLGGGYGLYTPWMS

    >gi|302341691|ref|YP_003806220.1| hypothetical protein Deba_0249 [Desulfarculus baarsii DSM 2075]
    MNSPEWNVNWRAAFEWAQQAGRPVLIDFHLPECVGCRMMEAETFPDRDVRATIDGHMTPLRVHADALPHSEDYGVRWTPW
    LVVAAADGRQLQAAAGFQPAAELTPWLLLGLAKFEMLERRWLGALNHLERVISLHPKSAAAAEAVFLRGVAGYRQSAQAL
    HLKSAYRKLTEEYPTSVWAGRARPYKNF

    >gi|302341801|ref|YP_003806330.1| protein of unknown function DUF1573 [Desulfarculus baarsii DSM 2075]
    MSTPSRVILLLLAILSLTVMPALAKPQIAFEKTEVEFSDIEEGSQQVAKFNFQNTGDMNLVIDEVNPSCGCTVAQFDKAV
    KPGEYGVVTLNLDTEGIVGYFRKTATVVTNDPDQPFVTLIMVGETLSAVKVEGGRRIELNGCLGQEVTAQARLTNPKGGV
    ALVAGVENPMKDYCHAWVERDADGKSYLLKVKAISDRPARFAGQLFLRVPGAPKVSVWVVGDIKGAFGIRPEILFFGAVT
    EAKLKGAARSIELTRACVDKLEEPILTYDKEKFNLVKYWEKPGEKLLLVITPNPGKLPKGAFQDTITISSGKFVFKVPMR
    GTIY

    >gi|302341844|ref|YP_003806373.1| hypothetical protein Deba_0404 [Desulfarculus baarsii DSM 2075]
    MPLLKIVPVDQAQGEVKANYEMFTKTIGTVPQPFQMWSASPALQSINKQIIGYYMKHPTLKPALMALIRMLVSEELGFDY
    CISFNAQILKTVGVISDDQLGAILADPTTAPLDEKDKAMLLFVLKACKSPEAVEQADVDGLRALGWADSDILDAAAQGAS
    MIQGGVLFRAFKMAEGQSC

    >gi|302341951|ref|YP_003806480.1| Rhodanese domain protein [Desulfarculus baarsii DSM 2075]
    MKKFVSIMMAVMFMASVATVAMAADNPLVDKEKAFWKEFTSVIPKDKIVNVDALYAEWQKVLAGQSDAILLDVRTHPEFD
    AFHIEGTSHIHAGHMYTIPKAVPDPNAKIFVF
    CRTAHRAAYVAAFLYKYGYTNVYYVGPIKDGDKKVNEGGVVGWAQKGY
    PFVNAFAGQIVIQQYMQPTWTERNCGKYIREFSGQRGENCSKKTLQ

    >gi|302342032|ref|YP_003806561.1| Protein-disulfide reductase [Desulfarculus baarsii DSM 2075]
    MPSARVSKFAATTSATMSFILVGAAFFVAGPAWAADEAASFSGRSLPVVMALSFLMGLLLNATPCVYPVIPITISYFGAR
    DSGGKGGAMLAALLYWAGITVMYSALGTAAALTGGILGQALSYTPVIIILSAILVALALSMFGLWEVRMPTGLTRVAAKN
    RAGLSGSFFMGLFSGVLAAPCAGPVVAGLMGHVAEVGSPLYGLAVFVALSLGLGLPLALVALFSERIAALLPRAGDWMIW
    VRKLFGFLLLAAAAYVAMPLLGQDAGRWLLAMIIAAGAVYLGFVHKGGARFFVFFKKAFGVAALVAAALVVWLLQAPDTH
    VAWEKFTMHAVRQAVNEHRPMAVKFTAEW
    CAYCKDLQRTTFSDPRVIKALGPFKTLVVDLTAGTPKERRIARQMEVPGLP
    TLVFLDGSGGMMREVTLVGYENADEFLLRMKMVDVALRQDGADRAKPAIIGQSDEE

    >gi|302342130|ref|YP_003806659.1| FAD-dependent pyridine nucleotide-disulfide oxidoreductase [Desulfarculus baarsii DSM 2075]
    MSAYDFDVLVIGGGGSAGFTAATTAMKNGARVAMVESGRLGGLCILAGCMPSKALIHSADNLRRQNADRLAAYPGVQEFR
    RGVVDFLAQRRAQAVAAKQQQGLELLRGRARFLDAHAVAVDGKPVSAASIVIATGSVEVVPDVPGLAQSGYLTSETFLAL
    ERPPRSLLVLGGGTMALELAQYARRMGVSVSIVQRGQALLSKEDPAIGQILAQCLAEEGVELFLGTKLLDVTKTADGARA
    RFIHQGGERAIEAEALLLSLGRRPNSDGLDLAAAGVATGPGGAVTVDQFMRASAPHIFAAGDVTARLMVVNQAIVEGQCA
    GHNASSDKPKAIDDRVVPRAVFTDPQVARVGLSAAQAQAAGVDFRQASYDLAELGAAQTYPGGVRGLMNLRAEAKSGRII
    GADLVAPEASLMIHDVAVAMKLGGAAADLADIPYVHPCLAEISELTAGRLARMVGR

    >gi|302342409|ref|YP_003806938.1| protein of unknown function DUF255 [Desulfarculus baarsii DSM 2075]
    MPNALAAEQSPYLRQHADNPVDWLPWGPAALAKARDQQKPIFLSIGYATCHWCHVMAHESFEDQAVADLLNQHYVAVKVD
    REERPDLDAIYMTACQALSGAGGWPLTALLTPDGLPFIAGTYFPKTARLGRPGLLEILAEVARRWNGPERARMIQAGQEV
    ARAIQPQAGPKTDLDPRALGMAYSQLRQSFDDQFGGFGQAPKFPTPHNLLFLLRWQARNPGSDALAMVEKTLTAMADGGL
    FDQVGFGFHRYSVDRPWLTPHFEKMLYDQALLAMAYLEAHQLTGREDFAATARQVFTYVLTRMTGPEGGFYAAEDADSEG
    VEGKYYVWTPQEVLAAAGQADGRLFNDFHGITADGNFEHGTSIPHRRQSLADFATQHGLDADQAAQALERARLALLAARQ
    QRIPPLKDDKIITAWNGLMIAALAKAGQALADEALTAAAARAATFILQTARATGGRLARSQRDGQASGPGFLEDYAFMIW
    GLIELFEATFELDHLEAALELTDKCCELFWDEADGGYFFSPADGEKLIMRDKDDYDGATPAGNSTMTLNLLRLARLTGRR
    QLEDMAQQLMQTMAAQTMRLPMAHTMLLMALDFAQGPTKEIVICGAKNDPAAQAMIAKAQQKFIPARALLWRPPEGPEAA
    RLAALAPFTAGMTTVGGRATAYVCQDHVCARPVTDPDELRF

    >gi|302342418|ref|YP_003806947.1| FAD dependent oxidoreductase [Desulfarculus baarsii DSM 2075]
    MGQAIMVVGAGMTGLSAALEAAEAGCKVVLVEKNPYLGGRVAQLHQYFPKLCPPYCGLEINFRRVRSNSNIDILTMAEVT
    AISGEPGNYKVSVKQSPRFVNDKCTACGKCAEAVETQIDSAFNYGLCKTKAAYLPHDLAFPYRYVIDPSIIGTPEAQKAK
    DACPYDAVVLDDAEKELTFEVASVIWAAGWTPYDPRKVQYYNFDKSPNIVTNVQMERLAAFSGPTGGQILRPGDGQAPKS
    VAFIQCAGSRDINNMPQCSTICCLASLKQATYVREKLPEAKVTIYFIDIRAMDRNEDFYTKVKADEGVSFVKSKIAMIEP
    QDDGSLILEGENTTTGERFKAQHDLVVLATGMQPNTALSKVPAEVEYDEYGFMRQGEGIFGAGTVRRPSEVVTCVQDGTG
    AALRAIQLVAGR

    >gi|302342481|ref|YP_003807010.1| Methyltransferase type 11 [Desulfarculus baarsii DSM 2075]
    MNTVDFSLVKPAPDDKVLDVGCGSGRHTCAAAMHENVCSVGLDLCFDDVRQADQRLEQNRAWIKGRCGTLVADITNLPFP
    DNHFDLVICSEVLEHVPAHEHALKELVRVLKPGKNLVVSVPSWFPERICWALSKDYHQ
    CAGGHVRIYRKDQLLAMIAAAG
    ASKWRVGRAHGLHAPYWWLKCLVGPDNDSSRLVKLYHRLLVWDMMKKPALTRFLERALNPIIGKSTVIYSVKNK

    >gi|302342569|ref|YP_003807098.1| thioredoxin [Desulfarculus baarsii DSM 2075]
    MAGNVVQVTDDSFEQEILKSELPTLVDFWASWCGPCRAIAPVVEELSEDYAGKVKVAKLNVDESPKTPGQYGIRAIPTLI
    MFKDGKQVDQITGAVSKAHIEEALKKLL

    >gi|302342570|ref|YP_003807099.1| thioredoxin reductase [Desulfarculus baarsii DSM 2075]
    METRDLVIVGGGPAGLTAGLYAARARLDVVLYERLSPGGQVLSTDWVENWPGAVEGVSGFDLADKMRDHALKFGLEIVSR
    EISGLSAEGGRLLLHHHGGQVTAKAVILAMGASPANLGIPGEARLTGKGVSY
    CGTCDGPFYRDQTVVCFGGGDTAAEEAI
    FLTRFARKVYLAHRRDQLRAAAVLQERVLANEKIEVLWSHAPVSINGENGVQSVTMRNLKTGEQFDLPCDGAFVFVGTRP
    STGFCAGAVELDQQGFIKTFGDQKTSMPGVFAAGDCCGKLLRQIVVAAGEGATAAYAAQRYLEEHE

    >gi|302342684|ref|YP_003807213.1| Redoxin domain protein [Desulfarculus baarsii DSM 2075]
    MSERKGAITMGGMPLTLIGDEVKVGQKAPDVELLTNDLAPARLSSYLGKVVIISVVPSLDTGVCDIQTRRFNAEAAGLGP
    DVVILTVSMDLPFAQKRWCGQAGVDQVVTLSDHREAAFGLAYGLLIKELRLLARAVLVVDRQGLLRYSQLVPEVGSEPDY
    EPALAAARQLV

    >gi|302342757|ref|YP_003807286.1| hypothetical protein Deba_1324 [Desulfarculus baarsii DSM 2075]
    MQILIVLSNPDPEVKWNAVRLGNFMLNEGEEVTIFLNGPAVDLLDGDSAQFPIAEQAKLFTLSEGVLAACGKCMGIHGVD
    ASALVSLSTMKFLYEQIKLADKVIGY

    >gi|302342802|ref|YP_003807331.1| thioredoxin domain-containing protein [Desulfarculus baarsii DSM 2075]
    MIFARLVVIALLALLTSNAAEATPKVQYGAEPVPGMVTLIQAGYERCGFCTVMEGSIEYVAEAFKKNLAVRYVDVLHDVA
    FRKKYEVDAAPAQLIFGADGKLLTRHIGFCTKSELLEMLGKVGVR

    >gi|302342866|ref|YP_003807395.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Desulfarculus baarsii DSM 2075]
    MKTPRIWLAAALIALCALGAQPSWSMDFNRPTLEGQALSLSQFRGRVVLLDFFATWCGPCTQAMPKLRQLQSAYGHAGLS
    IVGYSVDSGGLEAVGPYAARNRLNFPVVLGNAAEAKRIAGVTALPTTVIIDPEGRVAARFEGPVSKERLIGVIKPYLREG
    AAPAPPAAKVELRANGANRFNRVWVTPNMLFQGQLGLFVHTVVDVSDLYTKQGLWLGITMTPETIAPDGSTRPQGPPVTK
    YQRVDEAWRKHFILFLTCGQMPPMTGRGAYRSQIFLLGPGQKVIERSEDFWISDECQTGAAGSPSQFEEAKMDFGGGGPR
    KTGMVGKWRWAGQDRLRGAWLTGPTVHQGRSGLFVHVEADFSQDDLKRGLALGLDFAGAAQGRSATPRAESRLVQLVEAD
    NPGYYIMFIGCDQLPAQVAGGDGAMWVSLLAGPERQELERSGVFIIDEAICDGRAASQTSGGRQRRSGMAPGDDSPWGGF


    >gi|302343176|ref|YP_003807705.1| electron transport complex, RnfABCDGE type, A subunit [Desulfarculus baarsii DSM 2075]
    MSFGDYLLFIVGAILVNNILLAKFLGNCPFLGVSKRMDTATGMSMAVIFVTTLAGMITWVVQYYMLVPLEIEYLQTIAFI
    LVIAALVQLVEIIMQKTMPALYRALGIFLPLITTN
    CAVLGVAIINIGEEYDFVDTLVFSFSSAVGYSLALILFAGIRERF
    AMAPIPKVFEGTAIGLVTAGFLALAFSGFGGLVGH

    >gi|302343177|ref|YP_003807706.1| electron transport complex, RnfABCDGE type, E subunit [Desulfarculus baarsii DSM 2075]
    MALMKEFTKGFWEVLPPFRLVLGLCPTLAVTTSAENGYGMGLATTFVLFGSNLIVSLLRKIIPSKVRIAAFIVVIASFVV
    IVELLMQAYVFGLYQQLGIFIPLIVVN
    CIILGRAEAFAAKNGPVASMLDGLGIGLGYTISLFALGAFREILGSGTLTLVA
    KAGLVFNIMGEGYEPFTFMVRAPGAFVGLGLMLGLINYISVKNEARKRRALS

    >gi|302343193|ref|YP_003807722.1| protein of unknown function DUF395 YeeE/YedE [Desulfarculus baarsii DSM 2075]
    MSESVMVEKFKEGYAALFEKNWPLWVGGILLALLGTLCMVATRPWGVVGGLRVWADWLFYGVGLYDQAPRHALFLSDSAI
    LTWGLLFGAFGSALLSRQFALRMAPGLELGKGVVGGVLMGVGSVMAGG
    CNVGGFYTALAAGSVSGFAMMIGLIVGAMIGL
    KYLLWEIEHITTKPPKQKQASSGQGGVDWDKVQPWLGGAFFLFLIGYAYCLSLRAYTDQAILMMLAMGIGLVIQRCRFCF
    VRAFRDPFMTGEAEATRAVALSVIISVIGFMLVKWYNSDLEMIYTYHHWIGGLVGGVIFGMGMLLSGGCGSGSLWRAGEG
    HVKLIIVVICFALSNSLFKQYVFTNEVAEAWGKGFLFLPNLVGGYFWAIIISAAVMLAWWAIMAWNEETDKLTLT

    >gi|302343197|ref|YP_003807726.1| OsmC family protein [Desulfarculus baarsii DSM 2075]
    MEIALTGGKKIEVRWDDFVVEADQSKAAGGEGDAPEPFMLFLASLGACSGMYALSFCQARDIPTAGLKLRQKLVSDAEGK
    RLKQVRIEIVLPPEFPAKYEKAIVRVADQCAVKKAIQNPPLIETVAVRA

    >gi|302343435|ref|YP_003807964.1| copper-translocating P-type ATPase [Desulfarculus baarsii DSM 2075]
    MAEKSIDMPVVGMTCARCAANVERVLAKKLPGVSLAEVNFAAETVHVVYDPEQVGPEQMAKAVEDAGYKLILPAPTRRVE
    LPVVGMS
    CARCAANVERVLAKKTPGVSLAQVNFAAETVAVEYDPAQTSLERMAGAVREAGFELILPVDGEDQTDAEQQAR
    AQELAAQKRFFWVGVAFTLPLFILHMGHAFHVFGAWAVSPWAGWLSLALATPVQFYTGGGFYVGGWKSLRAGAANMDVLV
    ALGASAAYFYSVAALIFPGLGHQLYFETSAMIITLIKLGKLLEAKAKGQAGAAIRKLMDLAPKMATLLGDDGAEKTVPAQ
    SVRPGQVVLVRPGEAIPVDGVVVGGESAVNEALMTGESMPVDKKQGDQVYGATVNQQGMLKVRATGVGADTALAQIIRLV
    RQAQGSKAPIQRLADKVAAVFVPAIICIALATLAAWWLIDGLFVPAMVRMTAVLVIACPCALGLATPTAIMVGSGKGATM
    GVLFKNSEALETAHRVSVVMFDKTGTITKGQPRLTDWIALGDHGGEALTMAAAAENASEHPVAKAVASGARERGVAPPEA
    ERFEALAGFGVRAVVQGREVLVGKPSWIASQGLADAAVMAKVDELADQGKTVMIVVIEGKAAGLLAVADEEKPDAAKAIA
    KLKNMGLETIMLTGDNQRAAAAIAAKVGIQRVVAEVLPDKKEEAVRKAQADGRLVAMVGDGVNDAPALARADLGMAIGTG
    ADVAMEASDVTLVGGDLAGVPRSIALSRATMRTIRQNLFWAFFYNVLLVPIAAGAAQPLTWLPDFIRNLHPAMAAGAMAF
    SSVTVVFNSLRLGRRRL

    >gi|302343559|ref|YP_003808088.1| HesB/YadR/YfhF-family protein [Desulfarculus baarsii DSM 2075]
    MVELTPRAAAALRQILGQRGWSQAVRVVIASSGCCDAALGLRLEPATPDDVLCQSHGLNLALARRAADLAGLVRVDLADD
    GEGFVITSAKPLGEWDGFGVCQVLG

    >gi|302343562|ref|YP_003808091.1| FAD dependent oxidoreductase [Desulfarculus baarsii DSM 2075]
    MADKTKKPVGAVMVVGGGIASIQASLDLADSGYYVYMVEKTSAIGGVMAMLDKTFPTNDCSMCILSPKLVEAGRHPNIEV
    ITLAEVQDISGEAGNFEVKVLQKARYIDMSKCIACGACAAKCPKRVPDEFNQRLNNRHAAHVRYPQAVPLKYAIDKENCL
    YFQKGKCRACEKFCPADAVDFGQQDVMHTLNVGSVILAAGYRPVDPGQCGIHTSAFQNFPNVVTALQFERILSASGPWMG
    HLVRPGDNKEPKKIAWLQCVGSRDINTCQNGYCSAVCCMYAIKEAIIAKEHSHHGLDTSIFFMDMRTFGKDFERTYEGAK
    QKGIRFIRSRNPSMIELPDGSLELSWVDEKGKLSTEVYDLVVLSQGLEMDPETAALCRKIGVETGQSRFVETGSFTPVES
    SRPGIYVCGALAGPKDIPLSVMEASAAACAAAANIHSARGTMITEQVKRPQKNVGGDPPRVGVFVCSCGINIAGVVDVDA
    VKQYAATLPNVEYVENNLFTCSQDTQDKMAKVIEEKGLNRMVVAACSPRTHEPLFQETLQAAGVNKYLFELANIRNQDSW
    VHANDPVAATEKAKDQVRMAVAKASLLEPLTEARLSILPKAMVIGGGIAGMNAALELAKQGFETHLVERDIKLGGNARML
    RVTAKGDLVQPYLEQLAAKVQAEPLIHLHLGSTLKDVDGFVGNFKTTLVSDKGEEVVEHGATLLCIGAGEYKPTEYLYGQ
    HPGVMTHLELDSALINGQIDPKKTNSVVFIQCVGSREPERPYCSKVCCTHSVESALHFKESNPDCQVTVMYRDMRTFGER
    EYLYQKARALGVMFVRFDLDRKPVVELDGDQLQVRAYDPILDMDVAFPADVVGLATAIVSHRQEELAQMFKLPMDSDGWL
    LEAHVKLRPVDFATDGVFMAGIAHYPKPIEEAISQAQAAVSRAITVLSRKEMFLPGTVAVIDKKKCVGCGVCWEICPYSA
    ITQDSADGLAVVNEALCKGCGTCVASCRSGAPNLKGFSNQDVMSQITTMLQG

    >gi|302343580|ref|YP_003808109.1| FAD dependent oxidoreductase [Desulfarculus baarsii DSM 2075]
    MSDATQKGRLETVLVIGGGIAGLKSALDLAESGRQVVVTDKAPNLGGYLPLLDRQFPTNDCQICYLSPDMAPAGFDIGIG
    VMPLTEVVGVSGQAGDFTVELTTKPRYIDTELCTACGECLKAAPEGAVSFTPGLDHRSTTCLRYPQAVPQAFAINIDKVG
    QDTSWIKCCEPGAIKLDQKPESVKLNVGSIIVATGAELFDPTPLSDYFGYGQFPDVVTSLEFERILSPAGPTCGAFARPS
    DGRRPTRIGWVQCVGSRTTKAPGNPYCSSICCMFAMKEAAWAKEHFASDLDATIFYMDIRPMGKDYEQYYQRMKNDVGVN
    FVRCRPHTVRRDEATNDLLLSYATEDGQQLEAALDMLVLATGFCASKEAVSTAQALGIELDKYNFVKVSDKAPVSTSREG
    VYACGMSTGPKDIPDSLMQASAAACLASAHLTPPEPVRYEKDLPPERDTASETPKIGVFVADFGGNMAKYVDLAKVMAAA
    KTMPNVCCVEEIKVSYAGGQGLTQMIDSIKASGVNRVVVVGNSPRTHGKIYAEAVRRAGLNRAMVEIANVRDQDALVHRD
    APEAATHKAIMLVRMAVGRVKLAKPIYVHAQSLDKTALVVGGGVAGLTAALQLAKQGISVKLVERDKQLGGMALNLAHTL
    GGEPVRPIVEELVAQVQASDKIEVILDALVVDHKGCVGDFTTGVQSGPAMYYQQIKHGVTIIATGGKAYKPEGYFYGKNP
    AVMTQVELGVKLAAGQTDGLDTVVMIQCVGSRNDANPACGRICCRSAVLNALEIKRKKPEATVVVLYRDMRTPYDSEDNY
    RLARELGVLFARYEAGQPPKVADNGATMLVEFDDPILGRTVDVEATALVLSTPQVADEEGLEDLCDIFKLQQTETGFLLE
    EHVKVRPVDTPEPGVFAAGSVLAPKSIDEAITQGAAAAGRAITVLAQESVQVSGGVAKVVGEMCAACLVCVRACPIGVPF
    INADGYSQIDPEKCLGCGICAAECPAKAIQLQGYDDDQIMGQTDALLEGVL

    >gi|302343627|ref|YP_003808156.1| dihydrolipoamide dehydrogenase [Desulfarculus baarsii DSM 2075]
    MKSRVAVIGAGPGGYMAAIRAAQLGAAVTVIEAEAVGGVCLNWGCIPTKALRATAQALETARRLAEFGVTGGGDCAVDLP
    AAMARKDRIVADLVQAVERLLQSHGVDLLRGRARLTGPGRLAVEAEGGAGVVDYDRLIIASGSRPLDLPGLARDGQSVLD
    ANDALALGQVPASLAVVGGGVVGCEFAFIYSALGAKVTIIEASDRLLPLPSIDGDGAKVLLRECKKRGVAVKLGAMVQGA
    EAGPEGLVLRLTPSTLAERPIRGPETLVAEKAIVAVGRRPCAADLGLERVGVELDQRGAVAVGPTLATSAPNIWAIGDCL
    GTGRPMLAHMAGAEGRAAAANALGAALRPDYDVVPAVVFTSPELASVGLSAEQAMQQGLEVNAQTFQMRQLGKSQAMGQI
    AGHVKLLCAKKDGRLLGAHIVGPHAGDLIHECALALRLGATAADLAHAIHAHPTLAEGVQEAAEMVLGQCLHAPPVRG

    >gi|302343629|ref|YP_003808158.1| FAD-dependent pyridine nucleotide-disulfide oxidoreductase [Desulfarculus baarsii DSM 2075]
    MSLNVLIIGAVAAGPKAGCRIKRLEPDANVTMLDRDNYISYGGCGIPYYVSGDVADLKGLLSTSFHMVRDPQFFKGAKGV
    DVQTGVEALAIDRAAKKVRVKDLASGHENDLAYDKLVLATGARPFTPPIAGANLQGVWPVGDLHHAQAIKHAVAQGGVGA
    AAIIGAGATGLEMAEALADLWGVEVHIIERQDQFLLGVLDPDIARMLQTHMAAQDGVSLHLGADVGGILADDEGKARAVV
    VDGQEIAVDMVIMATGVRPNDELARAAGLELAQRGGIKVNERMQTSDPDIYAAGDCVSVKNILSGKDAYVPAGSLANRMG
    RVVGTNVCGGQATFPGVLGSFCIKLFGLSAARTGLNEVEARAMGLDVVAPLVVQADRAHFHPDMAMMYVKLVVEKNSRRL
    LGLSALGDNGDAVVGRVNAMAGLLAKGGELADLSNLELAYSPPLGAAMDILNTAANVAENMIEGRLRSIAIDEFAKRLAS
    DDSCVIVDVRAIDNAGPYLEQLAPKWRHLPQETIAGREGEVPQDRDVLLICNSGARSYEAMRQLAGAGVTNTYNVGGGVA
    AVKKWGEPILAPKDEN

    >gi|302343655|ref|YP_003808184.1| FAD-dependent pyridine nucleotide-disulfide oxidoreductase [Desulfarculus baarsii DSM 2075]
    MASGENKKVGAVMVVGAGIAGVQASLDLANSGYYVYLVEKSPAIGGRMAQLDKTFPTNDCAMCIVSPKLVECGRHLNIEI
    ITCAQVLGLSGKPGDFVARVEQNPRFVASESCTACGDCVKVCPVSVPNEFDQELGQRKAIYKRYAQAYPNAYSITKLDAA
    PCKVSCPANLNVQGYVQMAKQGKFAEALAIIMKDLPLPGAIGRVCPHPCESVCRRLEVDEAIAIRDLKRLAADVVGVENV
    AQPEAAWREEKVAIVGAGPAGLACAYHLARAGVRSVIFEALPVAGGALAVGVPEYRLPQAVLQREIDNIADMGVEIRLNA
    PLGPELGIDDLLGREGFRAVFLGVGATASFALRAPGEDGPQVISALDYLRLAALGQNPPDGADVVVIGGGDVAVDCARTA
    LRRGAKRVRMIMLESAEEQPASPWERHEALEEGVEFIHRQGVAAVRRGPQGELLGLTLRKVTRVFDENRRFAPQYDESQT
    SDIDADLVVTAIGQRPNLEFLGQNSGVELTPRGTIKADPITMATSRPGVFAGGDAVSGPWIAIGAVAAGREAAISITRLL
    DGQDLAHGRSKLELGDKPRHNPIPDDLAKAARPVMPLRPAAERKGDFVEFELGLSPEQGQAEGERCLNCAVCCDCYQCVE
    ACQAKAPAHDQLPHELNLNVGSVILAPGFDAYDPRQFDIYSYSRHPNVVTAMEFERVLSASGPYQGHLQRPSDGVEPKKI
    AWLQCVGSRDINHCDNGYCSAVCCMYAIKEAVIAKEHSPGELDTAIFYMDMRTHGKDFEKYYDRARQEHGVRFIRCRAHS
    VDPAEEGMLSIEYVDEDGNPKRELFDIVVLSVGLQTGAEAVELAQRLGVELTHYNFSDTSSFLPVGTSQPGVYACGCFAG
    PKDIPQAVMEASAAARASVKGLAEARGTLTKELQYPAELDIDDQEPRIGVFVCNCGINIGGVVDVPGVRQYAATLPHVAF
    VDDNLFTCSQDTQNKIKQIIKEHNLNRVVVASCSPRTHEALFQETIREVGLNKYLFEMANIRDQDSWVHQQEPQKATDKA
    KDLVRMAVAKAALTRPLHQVELPLTKAALVVGGGVTGMTAALSLAEAGYPVHLVEKTSQLGGNAHHLLVTWKGEPIKPYL
    EDLIAKVHNSPNITLHLESQVSACKGFVGNFKGAIGDSAGRQTPIDFGVAIMATGGRETRPEEYLYGQSDQVLTSLEWDA
    SLKGEPKLASKLAAVAFIQCVGSREPARPYCSRLCCTHSMESAVAIKEQNPTAQVYVFYRDIRTYGVREDLYRRARELGV
    LFIRYDLEHKPLVEQRGDKLAISARDHVLGRPVELEVDRLVLASAIAPNAVGPLAEVFKAPLQGEGFFLEAHMKLRPVDL
    ASEGLYIAGLAHYPKPIDEAIAQAEAAVGRALTVLARKAIRVGGVVATVDPAKCAVCLTCVRTCPYGVPKIKDGAAYIEV
    ASCYGCGACAAECPGKAITLQHYTDAQILAKEMAAMG

    >gi|302343694|ref|YP_003808223.1| redox-active disulfide protein 2 [Desulfarculus baarsii DSM 2075]
    MEIKVLGPGCPKCKQTYEVVNKAVAAVGVDATVQKVTGMMDIAAHGVMGTPAVVIDGQVKCVGKVPGQAEVEAWLRG

    >gi|302343695|ref|YP_003808224.1| hypothetical protein Deba_2267 [Desulfarculus baarsii DSM 2075]
    MEDVRLIGIDGRQVGLRGLDQAVSEMADDWAARSDAEVGAELLRRLSPINYIPARARQAHERALAAHFRRALGGQVGQSG
    APGLEVRILGLG
    CAQCHRLTQLAMRAAAELGLAADVEHVDDLRRIGQFGVIGAPALVINGRAVWVGSVPPYEKIKQWLAQ
    GCERSGQPME

    >gi|302344050|ref|YP_003808579.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Desulfarculus baarsii DSM 2075]
    MKRKNLIALAAAFVLTALLAAAGFAAERDGLITAGEQAPELKFQAALDAQGKKYLGLGGDAATFGLADVKADVLVLEMFG
    LY
    CLHCRAEAPKVKTAFDLLTKDGLADKVKFLGVGVKNSAFEVQAFRTQLKVPFPGAPDPDMAVTKNLGVMATPTFVVLK
    LENGGGKVLFTQVGDIGDPAAFVQKIKAAAAL

    >gi|302344053|ref|YP_003808582.1| 4Fe-4S ferredoxin iron-sulfur binding domain protein [Desulfarculus baarsii DSM 2075]
    MPSTVYFADLRASLKRPFNQKLDELMERVGLESRIRPGAQTAIKIHFGERGNTAFIRPVLARRFAEAVKRAGGKPFFTDC
    NTLYVGSRAEAVGHLHTAVENGFAYSVIGAPLIIADGLRGASEAAVRVDLPQCELAYIGAEIASAEALISLAHFKGHEVA
    GFGGTIKNLGMGCASRRGKLFQHSNISPTIRAER
    CIACGQCVRRCPGLAIRLVKRGPDMPPAPAGSEKPELCAVKDAEKC
    IGCGDCILTCPQSAIEIAWDAQIPQFMRRMAAYTKGVLAGKERTSVFFNFITNVSPTCDCYPFQDAPIVQDIGVVASDDP
    VAIDQASVDLVNRALGLSHSCLKNSHHSGGDKFRDIHPKIDWELQLESCEEIGLGLREYELVTI

    >gi|302344068|ref|YP_003808597.1| Thioredoxin domain protein [Desulfarculus baarsii DSM 2075]
    MKRISLAGLIIAASFVLISCQAGNAQDTKKYLSPGMVTLVDLGADKCIPCKMMKPILEALKVQYQGKAAVVFIDVWENQA
    AAKDFGVRVIPTQIFFDAAGQEVHRHEGFLDKKSIEDQLAKMGVKAR

    >gi|302344151|ref|YP_003808680.1| glutaredoxin [Desulfarculus baarsii DSM 2075]
    MTPKREVVIFHMPGCASCRAAGHFFSTRGFEVRWHDVSQSMAAKREMLAKAPGNRSVPVICFGELIKIGWQPEFWRGLLE
    ENR

    >gi|302344229|ref|YP_003808758.1| HesB/YadR/YfhF-family protein [Desulfarculus baarsii DSM 2075]
    MVQVTPSASKAVRDFMQEKNLVSPLRVFLNQSSCCGPSLGLRVDEETLETDDQVVVDGQTYLIDKGLGVMTGGVTLDFID
    DNGQQGFTLTTARPMGGGSCDCSSGSCGSGGCC

    >gi|302344230|ref|YP_003808759.1| HesB/YadR/YfhF-family protein [Desulfarculus baarsii DSM 2075]
    MVEVTESASKAIKAFMSERSLASPLRVYLQSGGCGGPSLRLVLDEPKDTDDSYDIDGLTYLIDKDLAQKSGDVKVDFVDN
    GWQQGFMVSSAMPLDGGGGCSGGCDSGGSCSC

    >gi|302344399|ref|YP_003808928.1| dihydrolipoamide dehydrogenase [Desulfarculus baarsii DSM 2075]
    MFDVLVIGGGPGGYAAAIRAAQLGAKAALCEAAELGGVCVHRGCIPSKTWAQAGHLLGQFKKAALFGITASVDGLDPAVV
    VARKNGVAADIGMGMQALLANNGVQLLKGRAVLKAPGLASVEGKDVQAKAIILATGASHAKCDLPGMAELAIGPDQALNL
    QKLPASAFIWGGGAIECEMAGWLGAMGVQVTLACQGPRLLPGEDADLGQRLAGALKDQGVKVLTRAALASAQKQGAALRA
    VLGGKAEQFIDAEIIVSAERRPNTAGLGLEALGVALNADGGIKVDERMQTSAPGVFAIGDCTGGRMLSHGASYMAVIAAE
    NAMGRQSAYDPRLVCRGLWTTPQVAAVGLSEAEAEDQGYEVETGDFPYSINGLAMLSAQGEGNVKVVMEAKYGEILGLHI
    VGAAATELIGEASLAIQLECTAEELARGARLHPTFSETIVDAARDAMGWALYLPKR

    >gi|302344415|ref|YP_003808944.1| DSBA oxidoreductase [Desulfarculus baarsii DSM 2075]
    MRLRVTTALTLAWALLPGLALAGQDQELTERIKAALRDNPEIVLEALRQRPIQVYDIAVAGGEQKREQAWREQIAAAIKK
    PIAPEVGGPRAVLGRADAPVTIFEYTDFS
    CQACARNAAMVLDLLEAQPQRVRVFLKHSPSDEYARTAALHFEAIARQSPV
    KAWRFQELVFQRQAALRKAGPAALQGLLDELAVEPNALAKDLADPDLAKRIDDDMAEAERFHIKNTPSYVINGVLIEGAA
    PKEAVLKVMEMIEAAERKQP

    >gi|302344440|ref|YP_003808969.1| methylated-DNA/protein-cysteinemethyltransferase [Desulfarculus baarsii DSM 2075]
    MPETTLVCVIESKLGPLCCASGPDGVIAVDLPPNADVDAMLAWLAQRPEAQAPVVVAPEQSPAGQQLLAYLAGQRDALTM
    PADLRGVGPFSRRVLEAIRHIPPGQTKTYGQVAAELGSPKAARAVGQSLHRNPAALFCP
    CHRVVGAGGGLVGFASGLAIK
    RALLAFEAGGAPLI

    >gi|302344591|ref|YP_003809120.1| selenide, water dikinase [Desulfarculus baarsii DSM 2075]
    MAEEPRLAEKARAAGCAAKIGPGDLAQILEGLPPETDPRLLVGAGTADDAGVYKLSDDLALIQTLDFFTPIVNDPYLFGQ
    IAAANALSDVYAMGGRPLTAMNICCFPVKTLPFETLREILRGGADKVHEAGAALAGGHSVEDEDLKYGLSVTGVVHPDRV
    VTNAGLRPGQILVLTKPLGTGVIATALKAGLASPQAVERAVAQMRRLNALAGRVMNECGVGGGTDVTGFGLLGHGLELAR
    ASGVGLEIIANDVPVLAEAREMATMGLVPLGSHRNRQYCDRWLASRGAVDPIVRDLLADAQTSGGLLMGLEPDQLDRAVA
    MLLAGGDGAAIIGRVTAEPAGVVTVVY