Denitrovibrio acetiphilus DSM 12809 uid46657

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|291286755|ref|YP_003503571.1| FAD-dependent pyridine nucleotide-disulfide oxidoreductase [Denitrovibrio acetiphilus DSM 12809]
    MPEKILVIGGVAAGATGAAKARRTSEDVDITVVEKGKYISFANCGLPYYTGGVIKERSSVLLHTRQSFGKRFNTDVLTRT
    EAVDIDPKSKTVLLKTSKGEIERPYDKLLLAVGAKTFIPPIDGVEDVPYFTMRTVEDADGVKDFIQKHNPESALVIGAGF
    IGIEVAEAMLHCGIKPTVVEALDEVMPNFPHVVAMNLREKMLEDGCEVIVKTFVTKLEKNEDIIKAHLSDGRVLETDMVI
    MCTGVKPAVDLALNAGVELGERGGVAVNERMETNVTDIYAAGDLVEKVNLITGKKVLLPLAGPANREGRTAGTNMAGGDM
    TFKGVLGSAVVGFEGFVMAQTGLTYEQALQAGFDADYVYTEDVNRASYFPVHGHIFMMTVFDKKTGKLLGVSACGPDTTE
    KKIDHAAVALYAGLTVYDLEHLELCYAPPFASAKDNLNIAGFVASNELRGSGYLVKPEWILEQVRKNTGLQILDVRTAEE
    VDEYKIEGAKHIFVNDLREKMDMIDKSRPVYVY
    CAVGFRGYLAVRNLRNRGYEAYNITGGIEAYKRLVRL

    >gi|291286948|ref|YP_003503764.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Denitrovibrio acetiphilus DSM 12809]
    MRLIALVFITLFAFSAFADDMPAVDLDGLLKEVRAHDAKTMVVFWAPWCPFCIRELKILRNNPQFATNNNLQIIGLTKRN
    DRRAAVNFVKKQKMPFRFFIAEQDVYDKLQRIDAVPLTVVFSKEGKVLDYEYGKQDIEDLALMLED

    >gi|291287063|ref|YP_003503879.1| Redoxin domain protein [Denitrovibrio acetiphilus DSM 12809]
    MERKGAVTMKGNPLTLVGSELKVGDKAPDFTVVDQGLKPVKLSDYAGKTVVISVTPSIDTPVCDFQLRKMNADVAGKEGM
    AVMNISMDLPFAIKKFCAVAEIENALALSDHKDASFGEAYGVLIKELRLLARAIFVVDAGGKISYVEVVPEATDNPDYTK
    LMSFLG

    >gi|291287183|ref|YP_003503999.1| thioredoxin [Denitrovibrio acetiphilus DSM 12809]
    MATELNEASFQTEVLDAETPVLIDFWAVWCGPCRMLTPTIESLASEYQGKVKVGKVNVDENQQLAAKYGIMSIPTVMIFN
    GGKVVEQFIGVQPKGVYEDALKKYI

    >gi|291287308|ref|YP_003504124.1| pyridine nucleotide-disulfide oxidoreductase dimerization region [Denitrovibrio acetiphilus DSM 12809]
    MKYDFIVIGGGSAGLVAAKFANGLGKKTAIVEKYKLGGDCTHFGCIPSKALLHYSVINPSSGIRAFEHVREMVERIYQTE
    TPDVFRKEGIDVIEGAARFIDSQTIEVNNVSYTARRFLLAMGSSPVVPPISGLDSINYLTNESIFSIKELPLSVVVLGGG
    PIGIELASALNNLGVDVAVVEMSDNILPREDRELSRILQKKLESDGIKILTGTKVISAEQRDGFVALKTEGTVDTVKAVK
    ILVAVGRRPNIDGMNLNSAGVGTDRNGVVVDKYLRTTAKNIYAAGDVVPPYQFTHVADYEAVTATRNALLPLKKAVNYAD
    IGWCTYTSPELAGCGLTEEQAINKYGDNIHVYKFENTHLDRAITDCSTTGLAKYITDRKGKILGAHILGSRAGEVVHEVM
    VAKKFNIPFHKLANMVHIYPTYSYSVRQPAKYAAIDMLMNNVFVKFIRGLRK

    >gi|291287350|ref|YP_003504166.1| pyridine nucleotide-disulfide oxidoreductase dimerization region [Denitrovibrio acetiphilus DSM 12809]
    MSENISYEVVVIGAGPAGIEAAKKLADNGKKVLLIDKHIGGNYCTGGSVVSNTLLHVSHLYERFVNKTSNFVDSECGHQH
    NFDFKKARKHVEGVASKVVKGFLDNLSSSGVEILTGFAVFKDKNTLTVMKEDGEEYISFEKAIIATGSNNMSANVPSTKK
    LLDTTNIFDLESTPKSVVVVGGGFIGTEYATFFKRIGCKVTLVEKSDSLLGSIDSQIVKEFEDQFRKSGVEIVKGVSVDR
    IEKVGNKTIIFLNNESKLEGEEVFVSIGRAPNIEKLKPENAGIKFDEKGYPKLTKKLKTSNSDIYMVGDSTGVNMFVNWA
    YMSADIAANDIMDRKRNISADLCPRILKLDPEIASVGMSEDEAKESGIEFKVIRHSFKNFEKSVIHGTIKGLVKILYSPD
    NKKILGCHAVGNGATDIVSTFAMMVQSKMPLTRLEDFVFNHPTYSSVLGDIAGKIK

    >gi|291287443|ref|YP_003504259.1| hypothetical protein Dacet_1534 [Denitrovibrio acetiphilus DSM 12809]
    MQNKLINEKSLYLRQHAENPVAWQPYNNETLAMAKRENKPLFISIGYSSCHWCHVMAHETFEDTKAAEVINKNFIPIKID
    REEHPEIDKKYQFYLQATGKRGGWPLSVFTLPDGRAFFGGTYFPPEPRHNLPSFTDITNQLGKLYREKPQEALKYAENYQ
    KFHQKFIQAEHTVESLHELSADDILSIFKNMTDKEFGGIGTDAKFPNIPVLTSLMTYYEDTEVSDFLKMTADKMCTSGLY
    DHVNGGFYRYTVDREWHVPHFEKMLYDNAQNASFLLDMFEKTDNLLYLKVAEKTIDFILSEFNTEFGLISSMDADSPSDD
    GKNVEGFYYLVSEAHANPIKEHIDLYEGVVNVRTADYETYLILESHFEKLRTSNERQKPAKDTKVILSQNMLFCSALLRM
    FEMSGKEFYMEQATALIGKMKHLHMDEENLYRINYGGDIFNSITLEDYAFTVKTYLDFFEITNERPFLAEAASIAEAAIE
    RFYAGGIFYLDSNKTIVDTFDDSTPNPSSLLAGLIDKYADFINIPKDKDMLDFASDRLTKYAGGHPTLFTYMKGYLAR

    >gi|291287454|ref|YP_003504270.1| heavy metal translocating P-type ATPase [Denitrovibrio acetiphilus DSM 12809]
    MSNNKTVTCSHCMLEINKNQAIEERVNGEECYFCCPGCSSVYSILQEEGFSKFYSKRDDNWEPGAVVRSNVSEELFVDSV
    LETENSYEVNIALSGIR
    CAACIWLIETYLSKAHGIESVMVNYATHKAKIRWTKGIITLKEIIDRISSIGYCPLPISESGT
    ATIYEKEKKDYFFRFSIGAFFSMQLMIYTIALYAGYFQGIDEGLRIMFQYAAWLLSTPVMFYSGMPFIKSSIAAIRHGHT
    TMDTLIFMGSFTAYVYSIFALFMGKEVYFDTTSMIITLILLGRYIESGAKARTSNAVSKLLTYQPVQVRFLSSFDINDYI
    TGSLRSETVPVKQVRAGDYLEVLPGDSIPADGIVIYGNSEVNESMLTGEPLPQVKNEGTKVFAGTGNVNGKIIIQVEHTG
    ATTTLSRIVQAVEDAQAAKAPIQNIADKVVGWFVPAILTVGACTFIGWYYYSGDMLVSTMNAVSVLVIACPCALGLATPL
    AILIATSKITKLGAVAKAGDIIEILSKADTIIFDKTGTITKGELKVENVAVYDTDKKTLVSYTASLEKHSSHLIGKAIIN
    TYLDDFLAVENFKEHPGKGLSGVIKGSVVLAGTSSYLNENGVETPDNEIREQIKLGYTVACIAIDGKFAGFMTLSDSIRD
    DAQDMLRQLAKRHVNIVILTGDNELAAAKLVEKLDVPSLTYIADVTPFEKADVVKSFQKNGKVCAMVGDGINDAPALTTA
    DIGIAIGQGTDIAIESSDIVLMRDELKLVSIVYDTSVVTLRVIKQNLFWAFSYNIIMVPLAVTGTIHPVFSAGLMSISSL
    AVVFNSLRISR

    >gi|291287579|ref|YP_003504395.1| Rhodanese domain protein [Denitrovibrio acetiphilus DSM 12809]
    MRLMSRMLTVIALLVALIVLGCGQAAKKPVAEAKASVADQAKAADFELVKIDEIKMIIGNGVWDKSRGTLVDARPERKYD
    GAHIPTSKLIPDTKFDEFFPAFAKEVSPEDYVVTF
    CGGVKCEKSLIVAEKLKEKGYTNVKIYLDGQPDWDKNGTYNEVSL
    EGAKKLHAKGATFIDARPERKFKKSTIAGSIVVPDTKFDEFKGNLPADKNTLSVPF
    CGGYKCEKSHIVAEKMLEMGYTNI
    LVYAGGAPEWKAAGQPMAPGGDAPVAKKPVAVDSASGFPVEEPGILITSFFVEKLLDPATRPADVTIVDVRNDNEVAAGK
    IPGSIQVSSKEVSEGCDAFISKMPQEGRVVFHCASGGRAGEVYFFLADDCQPADIDRYYFLDAGVNCDTQPCKIGM

    >gi|291287585|ref|YP_003504401.1| Flavocytochrome c sulphide dehydrogenase flavin- binding protein [Denitrovibrio acetiphilus DSM 12809]
    MSISRRNFVKYTTAAAAGTAIFGCSHNDSVSKGSGVIMPKSGKRIVILGGGWGGATAAKYIKLEDPSVEVVMVERQEKFI
    S
    CPVSNWVIGGFRTMKDITKSYDGLVKNYGVKVVHAEAKDLDAVNKKLMTTKGVLEYDLLLVSPGISYKYETIEGLNNPA
    AIEMFPAAMKAGHETVLLAERLKAMEPGGVVLLSVPPTPYRCPPGPYERISLIANFIKKYKPGSKIIVFDSNDGIVSKGP
    LFKAAWEDYYQGIIEYVPDNFIKSVDASTGRVVSEQGDIVPEVANIIPAMKANQTAFNLGLMSNEGDDWVRAYPKTFESY
    KYDSVHVIGDATHNGAVGGVPKSGYVANSMAKVAAVQMVRKLKGLDPVEPTYVNTCYSLINETEGIFVSAVYRYDEKIDR
    IMSVSGGVSPTRNALFGKHARDWATSIWSDMLL

    >gi|291287636|ref|YP_003504452.1| Thioredoxin domain protein [Denitrovibrio acetiphilus DSM 12809]
    MKKSLAPIVIILIVISVVFFAIMPSTPQATKKLQEEISEAVADGKTVFLQLSSTGCVTCRKMKPEVEKALAEFENSNRYK
    IINIDVNSHKAIASHFAITGVPTQVILSGEGKEVFRNMGYMSFDNIKYAMTTATK

    >gi|291287649|ref|YP_003504465.1| thioredoxin reductase [Denitrovibrio acetiphilus DSM 12809]
    MQDFFNVQDIKDEYDIVVLGAGPAGLTAAMYAARDKQTVLVLEKQFPGGFVAITEWVENYPGFFDGIMGADLSEKFYQHA
    VKYGALVRSGNCTNIEKDGKYKLVHVENRETPVKCKAVIITFGCEPKRLDVPGENKFYGRGVSF
    CATCDGSFYKDKEVAV
    VGGGESALEEGMYLTKFANKVTVIHRRDQFRASKLATERAQNNEKMEFIYDSVVESINGDTKVECLTVKNLKTGNVTELA
    VDGLFIFIGQSAKTELVKDLVDTDEWGFIIATESTQTSEPGIYVAGDVRTKEYRQITTAVSDGTVAAKSCEKYITDNFS

    >gi|291287673|ref|YP_003504489.1| DSBA oxidoreductase [Denitrovibrio acetiphilus DSM 12809]
    MKKLILTLMAFAMLFTGQAFAEDIGAKVESGMKKYFKENEIPLDIKIQVISKVKEPKGLYFIQMTLSDPASGRSQEQFVF
    SDGKYIMPDILTIDGNTSLKDILTFNASEKVEMDLSKLTLMEGNKDAKHVIVKVSDFQ
    CPYCRKAYEYLHSEIERRNLDV
    AVYMMHLPLSFHPKAQIYAQIFEAGKEVGADFGDDLYRTNKEFDAKPDEEIIEHFAKMTKDAAKFKALVKSPSVAGKIKM
    QADMAADLGITGTPELFFDGKPVGGFKQSMYNLALDSFK

    >gi|291287691|ref|YP_003504507.1| Rhodanese domain protein [Denitrovibrio acetiphilus DSM 12809]
    MKLSWLRKAKVFSVYVVVISFITIAVGCGGGGSYDAPDSQSATPIWWDTYDQPASAVVSASDVAGWIANGNVTASGDPVV
    ILDVQTDFSDTAANRIIGSTSIEDIEAFTIFDYRAEGPIDTVAINDTSAKMVPKGTTIDAMLQDLGVTHDTVIVLTSAAS
    GNGVWNLTRGWWMLYYWGLAETKIKILDGGVAALAAADPTLVNTTAESVDPADSVFSVKDLPGLHTSSRVSTTQVINYAR
    SGSAKIIDARGSSGTSGVAFGGRIDGAIVAGDAGIGGGDLVNADGTFKTKAEMQAAFDNAGISANDRIIVH
    CFSGYSATP
    IYFFIKEVMEYENVALYDGSWSAWSAHSAFTPVAATYIDGATTIHWDGSQFVQTVADTVVPTTDITQGGVLEADTNAGML
    AYDTVRLSKDILFKAVSAWQDAYGNTTFTVNTEYTGSGTELATEDVEYVTSDDVTGDDSSGDGEDVVVSPDTGGC

    >gi|291287704|ref|YP_003504520.1| transcriptional regulator, AraC family [Denitrovibrio acetiphilus DSM 12809]
    MRMSDYDRIAEAIRYIQTNSKVQPSLEEIAAHMGLSPYHFQRLFTQWAGISPKRFLQFITLESAKLLLKKTSIMETSYEL
    GMSGPSRLHDLFITTDGVTPGEYKSSGEGLTINYGCHETPFGECLLAQTERGVCHLAFIDDNLAEELDNLKNRWNKSDVV
    RNDDITAETSEMIFKNKSVPLHLKGTNFQIRVWRALLEIPEGHLTTYRRIAEKIGSSSSSRAVGSAAGKNSIGYLIP
    CHR
    VLRTTGELGGYRWGLERKRIIIAYEAAQQDQD

    >gi|291287719|ref|YP_003504535.1| FAD-dependent pyridine nucleotide-disulfide oxidoreductase [Denitrovibrio acetiphilus DSM 12809]
    MSKHYDVICIGTGGAGNTAAFKLAAAGKKVLICDYKQFGGTCAISGCDPKKVMITAAEFADFHRRMASKGVVECDIRLSW
    KAMMAHKREFTGNHSEKLKYKYDKKGIDYISGFATFTGEKSLKISGEEFTFDMAFIGTGSKPLVLPFNGFENVCDNECFL
    NLDELPKRLLFIGGGYISVEFANIANAFGAETTIVQVDDRLVPSFEADIVDVMVESLRQKGINILTNGRVSSIEKLDGSY
    RVIVDTPDGPVVRDVDLVIHGAGRVANVDGLDAGKAGVELSRGGVVVNSFMQTTNPAIYAGGDCTDTEGYLLSPIAFMEG
    YIAAHNMVNGNSKEPDYLNTGTVMFNVPGISAVGYTEKQAADAGLDFEVKFERTDHWFTSFRTIEHFSAYKVLIEKGTGR
    ILGAHIIGQHAEDIINLFVIAIKQDLKISDLKKILYAYPTASSDILHMVD

    >gi|291287740|ref|YP_003504556.1| heavy metal translocating P-type ATPase [Denitrovibrio acetiphilus DSM 12809]
    MYAIMKIILICCTGYSIKLFCYYGEWLVSDKKNVDSSINIGGMTCAACVRRVEKKLAKVDGVDSVVVNLATNSAAVSYDP
    DVINVNAIGTELERIGYEFKGVDQDMIEDETVSFYTDKFKIAAPISLVVFTLSMINVPVIESFKFWIMMILTLCVMIFGG
    GIFYKIAWKNFKNRTSDMNTLLAVGTLSAFIYSAFVTVFADYFIARDNYHVYYDAACVIITFILLGRMMESRAKKRAKGA
    IEALLNLAPKTAYVIKDGVEQEVPASHIFVGDVIRVKPGGSIAVDGEVESGQGRADESMLTGESVPVAKREGDTLYAGTV
    LTSGTLLYKATTVGNETVLAGIIKTVKSATASKPAVQRMADKVSSVFVPTVLVISVVTFLTWFFVGPEPLLANSLLAFVS
    VLIVACPCAMGLATPTAVMVSTGRGASNGILVKNGETLEKACKVNRIIFDKTGTLTTGNLKVEKFAVAPEYMGEVASVEA
    LSEHPLAVAVVEYAKAAGAELSPVEDFENYDGEGVSGIVDGKKVLVGKYEFLQRNGVEAEASAFSGSRIYASVDGVYAGM
    LGVTDSVKSDAAETISLLKRRGITPVIVSGDNEKSVKIVADKIGIKEYHSGISPQGKLDILQGYRAKGETVAMVGDGIND
    AAALAASDVGFAMSSGTDVAMQSGDITILGDSTLRIVRALNLSCATLNIIKENLFWAFFYNIALIPLAAGVFYPAFGWKL
    SPMFAGAAMAFSSVSVVTNSLRLKIKKI

    >gi|291287751|ref|YP_003504567.1| Rhodanese domain protein [Denitrovibrio acetiphilus DSM 12809]
    MNKYYQRIITILFFAVFNFTAFAQTPADVLDAKIEATAKIIEQIKPSELIKMIKEKQDFVLIDVREENEVLAGKIESSNY
    MHSPRGLIDIIAAKGSLKTEQTIVVY
    CKKGSRGLLAAASLHELGFKKIYNLKGGIHAWMEDGYPITNSLGTFKTVPYELT
    GCGN

    >gi|291287815|ref|YP_003504631.1| electron transport complex, RnfABCDGE type, A subunit [Denitrovibrio acetiphilus DSM 12809]
    MELFLIFIGAVLVNNLVLARFLGICPFFGVSRKVDTAIGMSLAVTFVMAVAGIITWVVQYAVLDRFGLQYLQTIVFILVI
    AALVQFVEMVIEKTSPDLYQSLGIFLPLITTN
    CAILGAAILNIQSGFTFVQMLVFTIGSALGFGLALVLFAGIRERIDLS
    DIPYYFRGMPVAFITAGILALAFMGFSGLV

    >gi|291287816|ref|YP_003504632.1| electron transport complex, RnfABCDGE type, E subunit [Denitrovibrio acetiphilus DSM 12809]
    MSLKTFTNGIFGNNPVMKQVLGLCPALAVTTSAINGIAMGLATTAVLIGSNSVVSLVKNMIPAKVRIPAYIVIIASFVTV
    VDLVMNAYVHELHKVLGLFIPLIVVN
    CVVLGRAESFASKNGLLRSIMDAVGTGLGFTLALMVLGGVREVLGNGSIMGFDL
    FGAGFKPSIVMILPPGAFIALGFLMMMYNYVEERKRVKRGGE

    >gi|291287853|ref|YP_003504669.1| heavy metal translocating P-type ATPase [Denitrovibrio acetiphilus DSM 12809]
    MNNRNFAVAPSETKEQCSCCSSCHEVPEHIYQEQPEEISSSRAVYIIANMCCPVEEALIRKKLSGITEITEMKFNLMKRM
    LTIDHELTDTTCIEEALHSINMAPQPVSQSNESVSVFSVAGMC
    CPAEEGLIKTKLLPMTGVTGLEFNLMKRTMKVRHSPA
    ALPEISKALHSLNMGAELINDNNEETNDLKAPETQWGKIAAAGILAVFSEIFELMHDWGSTPLGFDINNWSPWGVNVISY
    LPMILAVIAIILGGFSTYKKGWIAVKNMRLNINALMSVAVTGAAIIGQYPEAAMVMVLFNLSEVIEAKALDRARNAIKNL
    MALAPETITVLQEDGTWAEVDIREVAIGANVRVKPGERIGLDGVITDGHSAVNQAPITGESIPVEKSAGDTVFAGTINES
    GSFRFQVTAGATDSAIARIIHAVEEAQGSRAPIQRFIDIFAKYYTPAVFIAAFLIAVIPPILMGHEWIPSIYTALVILVI
    GCPCALVISTPVTIVSGLAAATKAGILIKGGIFLEQGRKLEWLALDKTGTITNGKPKQTDFVLTGSLDRTKAVSMAASIA
    GRSDHPVSRAIADNAKENNITLTDVRDFKAIPGRGVSGIINEQKWYLGNKNLIKEILKCPPELEEKIITLEKRGKTIVAF
    FNNAEVQVLFAVEDTVKNTSAQAISMLKKAGVKTLMLTGDNEHAAKAIAEQVGVDSFRSGLLPEDKLNVIKELGKSGKVG
    MVGDGINDAPALAKADIGFAMAAAGTDTAIETADVALMDDDLRKIPHFIKLSKASFGILVQNITFALGIKAVFFTLTLMG
    AATMWMAVLADVGASMLVIANGLRAMHK

    >gi|291287921|ref|YP_003504737.1| NADH:ubiquinone oxidoreductase, subunit E [Denitrovibrio acetiphilus DSM 12809]
    MLESYLALFIKSVFIENIALTFFLGMCTFLAVSKKVETAFGLGIAVVVVQTITVPVNNLIYTYLLKDGALSWAGLSGVDL
    TFIGLVTYIGVIAAIVQILEMALDKYVPSLYNALGIFLPLITVN
    CAILGGSLFMVQREYSFGESVVFGMGSGVGWALAIV
    ALAGLREKLKYASVPKGLDGAGITFITAGIMAIAFMIFSGIQL

    >gi|291287922|ref|YP_003504738.1| NADH:ubiquinone oxidoreductase, subunit D [Denitrovibrio acetiphilus DSM 12809]
    MAGYGKILFEPIFKNNPIAIQILGICSALAVTSKMQTTLVMSVAVICILGFSNFFISLIRKMMPSSIRLIMEMTIIATLV
    IIADQIIKAYMFEVSKQLSVFVGLIITN
    CILLGRAEAYAINNTPFKSFLDGVGNAAGYSIILIQVAFARELIGSGKLLGF
    SILTPVTEGGWYTPNGLFLLAPSAFFLIGVLIWVAKLTVAKEDI

    >gi|291287935|ref|YP_003504751.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Denitrovibrio acetiphilus DSM 12809]
    MSEFQMPTLGEKFPEMEVKTTHGMKQLPGDYAGKWFVLFSHPGDFTPVCTTEFIEFQNRAADFKAVNCELIGASVDQVFS
    HIKWVDWIEEKLNVKIEFPVIADELGRVANQLGMIHSGKGTNTVRAVFIVDDKGVIRIVLYYPQEIGRNIDEVLRAVKAL
    QKTDNDGVATPANWPNNKILSDRVIIPPAPDEQTKAKRLESAAKGEIECYDWWFCHKAK

    >gi|291287985|ref|YP_003504801.1| hypothetical protein Dacet_2082 [Denitrovibrio acetiphilus DSM 12809]
    MFLKRGLFTKKLSPWLTGSLTGITAAACCVFAGKTLGASGGFVTIDSYIGNYFNTGWAKLPYFTAAKPPILSFQIIQYIG
    MLAGAIISALMSKDFHIRSLPAKEWKPNFGKSVVKRWIMIFIGGILVELGACIAGG
    CTSGLGISGIIQLSPAGFIFFISA
    FTSGIITAGILFRRT

    >gi|291287986|ref|YP_003504802.1| hypothetical protein Dacet_2083 [Denitrovibrio acetiphilus DSM 12809]
    MQNFALPLIIGFIFGFLLQKTGLGHYDKIVNQFRFRDNTMLKFVLGALTSGMMTIAIFKSAGLLSPVSMPDTYILGNASG
    GLILGIGMVIAGA
    CPGTLIAGIGQGNIDYLIPGLLGFLAGGLLFGYLFSFFAVNIATVAFYKGISITDITNLNNYIFAFA
    MLAVSVAAAKLLR

    >gi|291288028|ref|YP_003504844.1| Thioredoxin domain protein [Denitrovibrio acetiphilus DSM 12809]
    MLKNKHASKILILMVVLMCVTGIWFLKKSNTSSEVVKSNTAPSDFSLNVVDKIDLNKLISYKIPIIIDFGADSCIPCKKM
    APVLAALNSELQGKAIIKFVDVWKYGSLAQGFPVRVIPTQIFINPKGESYKPSHEVLSKINFQSAVISGIHYTFHEGGLA
    EDDFRIILNDMETQ

    >gi|291288120|ref|YP_003504936.1| hypothetical protein Dacet_2218 [Denitrovibrio acetiphilus DSM 12809]
    MKKVFLVFILVVILGASGYYYMSNQPTKVASPLPMPAFGEITVEHAAPLFADGLPSDYAIVDVRTAEEFEKIHTDKTINI
    PVAIFEDADEPCKDIMAKLPKDKKIIFV
    CPFGPRSKDMYQFLTDPVEDLGCGMAKEGLYHLWANIKYKKNHIVIKGK

    >gi|291288162|ref|YP_003504978.1| redox-active disulfide protein 2 [Denitrovibrio acetiphilus DSM 12809]
    MKIKVLGPGCRNCKTMYEMALAAVNELQISDAEIEYVKDMSEITKYIMTTPGLVVDEVVVHEGKPLPSYERVKEIFSGK

    >gi|291288170|ref|YP_003504986.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Denitrovibrio acetiphilus DSM 12809]
    MSLVTKAAPTFTAEAVVNKEFKDIKLEDYKGKWLVLFFYPLDFTFVCPTEITALSDAYAEFQKRDCEVIGVSTDSKFSHL
    AWINTPRTEGGLGNVAYPLVADFTKSIAEDYGVLLDQGMALRGTFIIDPNGVIQFELIHDNGIGRNVNEILRNIDALQFV
    AKHGEVCPAGWTPGKETMTPDPEKMKDYYKNNPEGWQK

    >gi|291288270|ref|YP_003505086.1| copper ion binding protein [Denitrovibrio acetiphilus DSM 12809]
    MKEKVFNVDGMSCNHCVMAVKEAVEDMEGVSGCDVNLEQGTAKVTFSEDVIESDIVEAIEEEGFKVS

    >gi|291288348|ref|YP_003505164.1| Redoxin domain protein [Denitrovibrio acetiphilus DSM 12809]
    MKRLIIALFIMIFAVSCGDSGSKPSDASSVDIKTVTKGFIDQLKEEHKGKVMIVNFFASWCPPCRGETPDFVEAYNKNKD
    NNFVIVGLSLDKKPSDAAKFLDEFKVTYPVYIADNALGSEMSISTIPTSLIYKPDGKLFDIVVGPLTAKELDIIAGSFKE


    >gi|291288412|ref|YP_003505228.1| Peroxiredoxin [Denitrovibrio acetiphilus DSM 12809]
    MSLLNFEIPLVTGEMKNLDEYSGKVVLAVNTASKCGFTPQYEGLEEIYRMYKDQGFVVLAFPCNQFGAQEPGTEEEIHEF
    LSCNYTITFPVFQKIDVNGANQHPFFRALKTMAPGTMGTKPIKWNFTKFLISRDGTRVERFASSKDPEKLRTAIERELAK
    EA

    >gi|291288417|ref|YP_003505233.1| methionine-R-sulfoxide reductase [Denitrovibrio acetiphilus DSM 12809]
    MKSIKLILIFALFLITMGAAMAETKMKEAIFAGGCFWCMEPPYSLINGVSDVSAGYTGGDVPNPTYEMVSTGKTGHYEAI
    RIIYNPEKVSYERLLDIFWVNIDPTDKGGQFADRGTQYKTAIFYADDKQKAAAEQSRKNLDESGKFNVPVATAILKAATF
    YEAEDYHQDFYKKNPERYDSYKKGSGRADFISKTWKDKIKAAGNVPQADLSRWEDYVKPDKEKLKSQLTKLQYEVTQKDG
    TERAFNNEYWDEKRAGIYVDIVSGEPLFSSTDKYKSGTGWPSFVKPIVPQFISEHTDKSWFSVRTEVRSAYGDSHLGHVF
    EDGPKDRGGLRY
    CINSAALRFIPAEDLEKEGYGEFRYLFE

    >gi|291288435|ref|YP_003505251.1| methylated-DNA/protein-cysteinemethyltransferase [Denitrovibrio acetiphilus DSM 12809]
    MWAHVRNISGLDIYVSYDEDKIYEITSHKPSQEISENIPAKYAYIAEYLRDHTKKSVITEALKDFDLKWTTSFQSRVYKA
    LASIPCGELVSYAHLAELAGSPGACRAVGSVMSKNRFIIALP
    CHRVVASGRKIGGFSSGLDTKRQLLRAEGIYDI

    >gi|291288827|ref|YP_003505643.1| Carboxymuconolactone decarboxylase [Denitrovibrio acetiphilus DSM 12809]
    MSIIEKYETTRKGFWDYLGEVGETNEIFQEHYTKSYAPGIISAKNKRLMGMVGAAVAGCEGCMLGQVTHAIAEGATRAEI
    VEACAVAFSLGGTMAGSKISLIIQFMDEKEIK

    >gi|291286499|ref|YP_003503315.1| glutaredoxin 2 [Denitrovibrio acetiphilus DSM 12809]
    MAKKRLLCFLIVLLALNGFCQSDKPFYKDKGHGWYNYEDPKPQSEKQLKDDYRKPVIDWKAVQIMHPDRLNKLIEDVKDY
    ALMFPSHENVKDYLKLQGVAIDRSREYMESFMYVVQTNPELSKENEIPTSKFGQDEKHRIKVEKIEQTLAENRDKFALLY
    LYAPN
    CGYCAKQQPVLEYFVKDSGWQVKPVNIQQDQKAALNFNIAQTPSIVLIRRDSPDWLLISSGIIAMSELKERIVRG
    LGLI