Deinococcus radiodurans R1 uid57665

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|10957471|ref|NP_051642.1| thioredoxin-related protein [Deinococcus radiodurans R1]
    MSDRPFLLLTQGACPGCERLKKMLAGPLRGQFDSHIEVIHRQSAQERFDALSAHFGVRSVPALIRVSDGTRAHDPGSLGA
    VRAFLQG

    >gi|15805092|ref|NP_293777.1| HesB/YadR/YfhF family protein [Deinococcus radiodurans R1]
    MTPAAREQICALGGVLRISLEPGGCCGTAYAFALTRQENDMVFSEESVELRFSPEAASVLYGATLDYGDRLKPPRFRVLN
    NPNTPLRCACNRSFGQPFPGRATPDCRASCPMPWKARP

    >gi|15805225|ref|NP_293913.1| thiol:disulfide interchange protein [Deinococcus radiodurans R1]
    MTEPAPASPARPAWTRALPPLLAAALVGGLGWALLKPAGNAANGPLVGKPAPQFNLTGLDGQPVALADYRGRPVVLNFWA
    SW
    CGPCREEAPLFAKLAAHPGAPAVLGILFNETKPQNARDFARQYGLTYPNLQDPGVATAIAYQVTGIPRTVFIDAQGVV
    RHIDQGGLDTARLNAGLSKIGVPGL

    >gi|15805253|ref|NP_293941.1| thiosulfate sulfurtransferase [Deinococcus radiodurans R1]
    MDYAKDVLVSTEWAAQNLQTPGVRFIEVDEDILLYETGHLPGAVKLDWQTDLWHPVERDFIEPQQVSELLGKLGIKADDT
    IVLYGDKSNWWASYAYWFLTYSGVSNLKIMNGGRQKWVAEGREMTTEAPTVTATTYPALQRDESLRAYRDEVRAHLESVN
    NGQGAMVDVRSPDEFSGKVTHMPNYPQEGVLRGGHIPGARNIPWAKATNEDGTFKSADELKALYEGEGVTADKDVIAY
    CR
    IAERSSHSWFVLRELLGYPKVRNYDGSWTEWGNGVGLPIEKTYSEE

    >gi|15805374|ref|NP_294068.1| cytochrome c biogenesis protein, thiol:disulfide interchange protein [Deinococcus radiodurans R1]
    MTSPTPPTSPSLSPQPRRASWTRWIVPAVMVGLVGLLAYGLFTPDPEGGPALLGKPAPAFALEDLGGRTHALTAAQGKPV
    VINFWASW
    CVPCRQEAPLFSKLSQETAGKAEFFGVIYNDQPADARRFMDQYGLIYPALLDPGSRTALSYGVGKLPITFIV
    DGQGKVVHIKDGPIEEPELRAALKQAGL

    >gi|15805439|ref|NP_294135.1| pyridine nucleotide-disulphide oxidoreductase, class II [Deinococcus radiodurans R1]
    MAGAMDMGAYEYDAVIVGAGPAGLNAALVLGGARRRVLLLDGGPPRNVTAQAAHGVFTRDGTPPADLKTVGLEQLAPYDV
    TVLGTPAREIRPEDDGTFSVRYEQRWVRARRLLFATGVRDVLPRIPGLRERWGRTVHH
    CPYCDGWPNRAARLAVLGSHQE
    GHHLALSVRSWSDHISLLTNGPDELTPAQRRDLRELDIERCDRPIRHFSGRDTVRVTFEDGEVREYDAIFLNPAQVQRSR
    LPELLGCELDEKSRVIVNENGMTSRRGVWAAGDMTGAPQYVMSAAASGMVAAVSLNSTLIHEDVRRGGAAFHPSPDEEKG
    VGEA

    >gi|15805466|ref|NP_294162.1| HesB/YadR/YfhF family protein [Deinococcus radiodurans R1]
    MTAIHTPERQDTPRVPDITISEFGASKAQTILAGSGKENAGVRVFIKSGGCSGYQYGMAIDDRELEGDTIVVDRGVKLLV
    DRMSIELLRGSEVDFVENMMGGGFTVHNPNATSSCGCGHSFRTDGAQSPDGEGSGGCGG

    >gi|15805489|ref|NP_294185.1| hypothetical protein DR_0462 [Deinococcus radiodurans R1]
    MGEPFGGPLMGRLVSLLPSATDLIFELGLGEQLLGVSHCCDHPGAASLPVLTRSIIGSDLPQAEIDRAVSEAVRAGRALY
    TVDGPLLDRLRPDLVVTQGVCEV
    CAVTPGTVAEAVRFLPGCLPAEQVLSLEGKTFAGILADLRALARAAGVRERGEALAA
    ESERRWNAIRPVGVQVPEPPRVLTLEWVDPPFYGGHWVPEQVAQAGGKDVLGHAGRDSGRTSWEDVVQLDPDVIVVMCCG
    YGLSDNAEFARQVLSHPELRAVRAGQVWGVDANAHFSRPSLGVVRGAEVLAALLRGEESAGESVRVRAE

    >gi|15805587|ref|NP_294283.1| hypothetical protein DR_0560 [Deinococcus radiodurans R1]
    MLGWAWWGGPLLRMCARCFAAEVRKSPAPASMLWAMKRLLAALLGALLLPSAHAQLGQPTDALLKSPLFVGAQTSRAGII
    TLKSGVNVVLGQRGGRLTTVTITTPYTEPQGISGSSDTAVAAGSVEQRVGGSALAAQTVGAVTGYGEGLSAPLLQFLRQP
    DVVKQLPQGVTVDAPPLTIQAQVQGRALVLKLSMTQVPAGQFTATKNLRPAAKPGKDVVLRVYSDFQ
    CPYCQKLELETMP
    ALLRALPDDVRVEFHQFPLEQIHPLARPAAEASECAAQQGRFWDYKDALFRDRSWLQNNPNETFLRLAGDLKLDPGKFKD
    CLALRGGKAGVDAGLAEAQQLGLNATPTVFVDGYRVGNPFDTAAVLQLIDVARATR

    >gi|15805686|ref|NP_294382.1| frnE protein [Deinococcus radiodurans R1]
    MTNLAPANSEKIRVDIWSDIACPWCYIGKRRFESALGQFPQRDQVEVVWHSFELDPSARPLNPIAMRDGLAMKYSISPAQ
    AQGSLDHMTQTAAQEGLEYHFDRVKLANTFLAHQLIHYAAEQGQGDAMKERLLRAYMSEGQNVNDLDTLQKLAAEVGLDA
    GAARAALEAGTYAQAVRYDEAQAQQLGITGVPFFVLGGKYGVSGAQAPETLLGALSQVWAEQHPAPLTMLGQDAPAEGCE
    DGQCAVPQRPNN

    >gi|15805779|ref|NP_294477.1| hypothetical protein DR_0753 [Deinococcus radiodurans R1]
    MGVEAGGGVAAGVPGGDSGPECRRREAGRLPGSMTRLSGNNQNRSVLIIGTLVAAALIALALFAVRGKSTTTTGEAQTFT
    YANLPYAGQANAPVNVLVVEDFK
    CPNCKSFEETVAPELRTKYVGTGKVKMYSLVYPFLADRLPEDDSKYAAQAARCVYAQ
    GKNDAFNTYKEILFRAQGPETEVWATKSRLKELATSLDIDQAKFATCLDNDETAAQVETDKQEALKAGVGGTPTVFVNGK
    LVNVQSDYVKDISAAIDEALKP

    >gi|15805870|ref|NP_294568.1| hypothetical protein DR_0844 [Deinococcus radiodurans R1]
    MQPRAGPCVGLACPMPNRLAQESSPYLLQHQDNPVDWWPWSPEAFAEARQRDVPVLLSVGYSTCHWCHVMAHESFENERT
    AAFMNAHFVNIKVDREERPDVDAVYMAATQALTGQGGWPMTVFLTPDAEPFYAGTYFPPQEGMGMPSFMRVLASIDDVWQ
    NRRDQALGNAQALTEHVRGASQPTRREGELPGGALARAVENAARLYDAQFGGFGRAPKFPAPSTLDFLLTQPQGREMALH
    TLRMMGAGGIYDQLGGGFHRYSVDAQWLVPHFEKMLYDNAQLVRTLLRAYQLTGEDDFARLARETLAYLEREMLAPDGGF
    YSAQDADTPTEHGGVEGLTFTWTPDEIRAVLGEDADLALRSFNVTAQGNFRDPHQPAYGSRNVLHTPTPLPALARELGDD
    AAQRLQAARAKLFAARQVRPQPHTDDKVLTSWNGLVLAALADAARILGEEKYLDLARRNADFVHRELRLPGGTLRHTFKD
    GRASVEGLLEDHALYGLGLVALFQAGGDLAHLHWARELWNIVRRDFWDEGAGVFYSSGGHAETLLTRQASFFDSAILSDN
    AAAALLGVWMNRYFGDAEAEAIARRTVQSFHAELLAAPTGLGGLWQVAAFLEAPHTEIAVIGTPAERQPLERELAWHFLP
    FTALAPADEGGDLPVLEARPGGGQAYVCVNHACQLPTRDPAELARQVAAL

    >gi|15805872|ref|NP_294570.1| bacterioferritin comigratory protein [Deinococcus radiodurans R1]
    MTDSDSQSPDTQPEVARLQPGDTFPDFSLPDAAGDLHSLGQYDGKYVVLYVYPKDDTPGCTREACDFRDHQLLRQHGAVI
    LGVSRDDAASHQQFADKYSLPFPLLSDPDAEFLRAIGSYGPKTMYGKTSEGVKRQTFLIGPDGKLVKSWLAVQVDGHADA
    VAAAIDKDLQKKGQA

    >gi|15805968|ref|NP_294668.1| thioredoxin [Deinococcus radiodurans R1]
    MRASIPGRLRLAQPVPMPRLSADMREGGIVPNMKPVELTDGNFTSEIAQGLTLVDFWAPWCGPCRIIAPVIEELAGQYEG
    RVKVAKVNVDDNPATSGQFRVMSIPTMILFKDGQPVEGMVGAQPKRAFESVLDKHLGVAVN

    >gi|15805972|ref|NP_294672.1| hypothetical protein DR_0948 [Deinococcus radiodurans R1]
    MRWPDPADFVHGSPLPPPTEWGRPGLLMTFNLECPGCVSRGIPFLKRLHAEYGEQVHLLAVHTSFGHRQLTREEVEPTLV
    KFARDFAKLPFPVALDLDGSFAREWQTEGTPHWLAFAPGGELLRSVYGSQENAQTRLEYLLAEWAAASRP

    >gi|15806015|ref|NP_294716.1| NADH oxidase [Deinococcus radiodurans R1]
    MRIVIVGGVAAGMSAASRAKRFDPDAEVVVFERGDFISYGACGLPYVLGGAVGEWDDLIARTPAQMRGRGIGVQLGHEVT
    GVDAEARTVTVLDRAAGRVATEPYDRLLVATGVSAVRPDWAQTDLAGVHVLREIPDGQAIADSLKGAGRVCIVGGGYIGL
    ELAENMCRQGLSVVLLERNPDVGGRVLDPEYRPRLLDELGRHGVDVRCGTTVEGLIGKAGRVTGVQTDGGLVRADVVVVA
    VGVKPNVDLLRAAGARLGKTGAAAVDVRQQTNVDGVYAAGDNCESLHRVTRRRVHIPLGLTANRMGRIAGINMAGGDAKF
    PGVVGTSIFKVFGLGVARTGLTQGEAAALGLNAVSVDVTSTDHAGYYADARPIHVRLTGERGTGRLLGGQLVAENPLSVK
    RVDVIAAHLHSRGKVEDLFQMDLAYAPPFSGVWDVLLVAADRLNRALRA

    >gi|15806227|ref|NP_294932.1| bacterioferritin comigratory protein [Deinococcus radiodurans R1]
    MTLLPGYPAPAFKLPGDDGRWWGLPDLRGQAAVLYFYPLAHSRDCALEAMAFEVLLGEFAAAGARVLGISTDSRAQLARF
    RHAQGLTFPLLSDAGREVSRLYGARRSPWGLVGRAGRQTYLLDERGRVVHHWPQVDPAWHAQAVLDTLRRWRDGQDGAVT
    LGA

    >gi|15806228|ref|NP_294933.1| bacterioferritin comigratory protein [Deinococcus radiodurans R1]
    MTPRVGQPAPPFRARSDDGRLIDLAELRGRWVVLYFYPRAGTPGCSVEAQRFEEALPEFERLGAEVIGVSTDTEAQQARF
    RDRCGLSFPLLPDGDRAVAEAYGVLGGVGKLLGMTARQTFLIDPAGRLAFHWKRVNPLGHAAEVLQTLEQCQRTDPPTS

    >gi|15806395|ref|NP_295101.1| methionine sulfoxide reductase B [Deinococcus radiodurans R1]
    MTQDTKTDFQKPSDNDLRERLTPIQYQVTQHEGTERAFTGEYWDHDEDGIYVDVVSGEPLFSSLDKYDAGCGWPSFTQPI
    PDVALTENTDYKIGYARTEVRSASADSHLGHVFPDGPRDRGGLRY
    CINSAALRFVPLSELDAQGYGQYRALFEGRQG

    >gi|15806548|ref|NP_295261.1| osmotically inducible protein C [Deinococcus radiodurans R1]
    MHSGSVEHCIKGRSRRAAPRSEHTGRMADIARKASAHWEGDLKSGNGTITTESGVLSQAQYSFKTRFENGKGTNPEELLA
    SAHAGCFTMQLSALLAEHGHEIKALDTDATCEMVKDGPGFKINHMHLRVRAQLTGSDQADFEAHVKDAAEK
    CPLSRIMQG
    NVEVTHEAILEG

    >gi|15806766|ref|NP_295488.1| hypothetical protein DR_1765 [Deinococcus radiodurans R1]
    MPGQAAVSTAAGQKTVKRKVNSLGYPLLMPTTQPRLSFLAVPTEDNAHEGVKKLWSKAEANMGFVPNVFRAQALNGEQFL
    AWWNYFNLLVNKEGGLSNAERELLAVVVSGLNRCVY
    CAVSHGAALREFSGDAVKADAVAVNWRQAELSEREQAMCAYAEK
    LTLRPAEMTEADLAPLRAAGLSDEAILEAVQVIAMFNMTNRVSSALGFVPNPEYHIQSR

    >gi|15806849|ref|NP_295572.1| peptide methionine sulfoxide reductase [Deinococcus radiodurans R1]
    MGWHPLGEHGAPHNSSMTQQTNSQGTQPGAAQEQAIFAGGCFWCTEAVMQDLRGVQKVESGYIGGTVPNPDYRSVCGGQT
    GHAEAVRVTFDPNQISYRDLLGLFFATHDPTSLNRQGADVGTQYRSALFPLTQEQEQTAREMIEQLGTEDVFGRPIVTSI
    EPASTFYVAEDYHQNYYKNNPGQGYCMAVISPKVAKLRQYYGDKLR

    >gi|15806857|ref|NP_295580.1| organic hydroperoxide resistance protein [Deinococcus radiodurans R1]
    MANVYTAEATATGGRAGTTRSSDDRLNLDLSVPAEMGGDGGPGTNPEQLFAAGYAACFQGALGVVSRRQKIDVPADSTIT
    ARVGLQKAGLAFALDVELEGHFPGLSREQAEGLMHAAHEV
    CPYSAATRNNVDVRLKVRE

    >gi|15806980|ref|NP_295705.1| thioredoxin reductase [Deinococcus radiodurans R1]
    MTAPTAHDYDVVIIGGGPAGLTAAIYTGRAQLSTLILEKGMPGGQIAWSEEVENFPGFPEPIAGMELAQRMHQQAEKFGA
    KVEMDEVQGVQHDATSHPYPFTVRGYNGEYRAKAVILATGADPRKLGIPGEDNFWGKGVST
    CATCDGFFYKGKKVVVIGG
    GDAAVEEGMFLTKFADEVTVIHRRDTLRANKVAQARAFANPKMKFIWDTAVEEIQGADSVSGVKLRNLKTGEVSELATDG
    VFIFIGHVPNTAFVKDTVSLRDDGYVDVRDEIYTNIPMLFAAGDVSDYIYRQLATSVGAGTRAAMMTERQLAALEVEGEE
    VTAAD

    >gi|15807079|ref|NP_295808.1| glutaredoxin, putative [Deinococcus radiodurans R1]
    MVKMYTTTWCPDCHAAKRALTQKGIAYEEINIEQDEQAAEYVMSVNGGRRSVPTLVSGDVAHSLSGFRPQKLDAFLAEAG
    L

    >gi|15807234|ref|NP_295964.1| thiol-specific antioxidant protein, putative [Deinococcus radiodurans R1]
    MTLVGQPAPDFTLPASTGQDITLSSYRGQSHVVLVFYPLDFSPVCSMQLPEYSGSQDDFTEAGAVVLGINRDSVYAHRAW
    AAEYGIEVPLLADMQLEVARQYGVAIDERGISGRAVFVIDREGVVRYQHVEEQTGQYTVRPGAVLEQLRGL

    >gi|15807260|ref|NP_295990.1| molybdopterin biosynthesis MoeB [Deinococcus radiodurans R1]
    MTLTREELRRVSRPLLVPEWAEAGAQEKLRAARVLVVGAGGLGGPVIRQLAGAGVGALTVADGDTVSVTNLHRQQLYRTA
    DVGRSKAETACAVAQGVNPFVQIQAAPALTPETAPTLIAAHDLTVDATDNFETRYLIADTCRELGREWVWGAASGVSGLC
    SVFGPHLGLRDVFPTPEDDSS
    CDELGVLGPVPNLVGDLMALQALLVLGGVGEPLRGKLWTFDALTGRVRVLKMGG

    >gi|15807326|ref|NP_296056.1| hypothetical protein DR_2335 [Deinococcus radiodurans R1]
    MTPQPTDAQPTDAQPTDLYFDFLCPYAWRGVEMAHVLRGSGEGFRLRHFSLVQGNHPQNKDQETVQWWLTDQPLGAEGGS
    GYMKYQRPSLNAFLAAHAAARQGEEKSWAFALALFRLHHEDKRDLDEAAFQDAATRAGLDLSQWKQDRQDEAGLRRELRA
    DLEAAAALGVFGTPTFDLGGGDVAYFKFEELTRDPQAARDLWNLFTSTLRSEARVATIRRPVPKKG

    >gi|15807360|ref|NP_296091.1| pyruvate dehydrogenase complex, dihydrolipoamide dehydrogenase E3 component, putative [Deinococcus radiodurans R1]
    MTNNFDYDVLVIGAGPGGYHAAIRASQLGLKTACVERGAVGGVCLNIGCIPTKALLHAAETMQASKHAAEFGLTFSGQAL
    DIARLNGWKDSIVKKLTGGVSGLFKANKVTLLTGQASFVDDHTVQVGDKTYTAANIIIATGSDPAKLPGLEVDQQQIVDS
    TGALVMPDPVPARMLCVGGGVIGFEFAQVYNNLGSQVKIIEFLPSVIPGADADAVKEFSKIMSRQGIEIVTQMKANRAEK
    KSDGVHVELENVKTGEKTTEVFDRVLVAVGRRPRTDGLNPEQAGVTVTERGFIPADKQQRTNVPHIFSIGDVAGNPMLAH
    KAMKEGLVAAEVIAGKPAEQDAVAIPGVVYTNPELAWVGLTEAEAQEKGYEVKTGVFPMSASGRAMTLQATEGFVKMVVE
    KDTDLLLGVHIVAPHASDMLAEAGLALEMAATATDISLTIHAHPTLGESILEAAEASHKQAIHIVNR

    >gi|15807439|ref|NP_296172.1| hypothetical protein DR_2452 [Deinococcus radiodurans R1]
    MQTELNVTGMSCGHCVKAVEGALKAVPGVEGVQVSLEGGKATVQGDADAQALIAAVKEEGYGAEVAGQ

    >gi|15807440|ref|NP_296173.1| cation-transporting ATPase [Deinococcus radiodurans R1]
    MKTLDLDISGMTCAACVGRVERGLRKVEGVQEAHVNLATERASVTYDPALTNAAALVQKVVDTGYDAPTAELSFPVAGMT
    CAACVGRVERALNKTDGVLDASVNLATERASVRYLPASVSPAELKSAVVNAGYDVPEEQTQAASRLELERARKAEELAGL
    RRSLTFSAVFSVPLLLLSMVPMLYPLLHHWLLGTLGERAMNVLMLLLAAPVQFGPGLRFYRTGWAALRHRSPDMNTLVML
    GTSAAFFYSLAVTLWPQLFPAGSRHVYFEASAVVITLILLGKYFEALAKGRSSEAMRTLLQLQPQSARVQRGTEVVEVPV
    DGVRVGDTVLVRSGERLPVDGEVLSGESYVDESMLTGESVPVHKAAGAKVTGGTVNGTGSLTFRATGVGADTALARIIRL
    VEDAQASRPPIQGLADRVVAQFVPLVLAIALVTFLAWLYVGGPSALSNALIHTVAVLIIACPCAMGLATPVSIMVGSGRA
    AQLGVLFRSGAALEGLGEAQTVALDKTGTVTRGVMEVTDVVVDGRWVMGDGELLRLAAIAEGPSEHPLARAIERAATLSP
    SPLAGEGLAQPGVRGRVTNEPAPSPTLPQPSSFQALPGYGLRAEVDGRRVEIGAARFMAQLGLPLGELGAKADELAARAR
    TPVFAAVDGQLAGLLGVADPIREGSAEAIRTLTAQGLDVAMVTGDARATAEAVAREAGVNRVLAEVLPEGKAQAVAELQQ
    CGQRVAFVGDGINDAPALAGADVGVAIGTGTDVAVETADVILLGGDLRSVPNAVALSRAVIRNIKLNLFWAFAYNVLLIP
    VAAGVLAPWGLGLSPVLAAAAMGLSSVFVMSNALRLRGFTPPLSVKG

    >gi|15807510|ref|NP_296246.1| dihydrolipoamide dehydrogenase [Deinococcus radiodurans R1]
    MPLWRGGTLRSDMDTFDVLVIGGGPAGYVAAIRAAQLGFKTACVDAFERGGKPSLGGTCLNVGCIPSKALLDSSERFEMI
    SHDTAEHGIQVAQPQIDVSKMLARKDGVVDKLTGGVAFLFRKNKVTSFHGYGKLVRQDGQEWVVDAAGTEVKAKNVIVAT
    GSNPRALPGVPFGGHIVENSGALQIDQVPGKLGVIGAGVIGLELGSVWRRLGAQVTILEAMPGFLMAADDAIAKEALKQF
    QKQGLDFHFGVKIGEIKQDDSGVTVTYEENGSQVTAQFDKLIVSIGRVPNTGGLNADGVGLALDERGFVKVDQHYRTNLP
    GVYAIGDVIGGAMLAHKAEEEGVALAEMIAGQAGHVNYDVIPWIIYTSPEIAWAGLTEKQAKERGLNVKTGQFPFSANGR
    ALGHGDPRGFVKVVADAQTDKLLGVHMIGGGVSELIGEIVAIMEFGGSAEDLARTIHAHPTLSEVVKEAALAVDKRAIHM


    >gi|15807515|ref|NP_296251.1| thiosulfate sulfurtransferase [Deinococcus radiodurans R1]
    MTPPSPLKSAAWLLAQRPGAVRVLDCRYALSDPLLGRLAYLEGHIPGAVYADLETDLSGPVQPGGEGGRHPLPDPPVLAD
    WLGAAGIGNGDVVVCYDDPGGGQGFYAARAWWLLRWLGHREVYVLDGGWPAYLAAGGEASTEEPHPVPTTFTPDVQPELV
    ATAQDVQNREDGVLLIDSRAPERYRGDSEPLDKKAGHIPGAVNRPFSAALDEQGQFRAGAEQAGRLAAGDAPTIIY
    CGSG
    VSATPNLLARELAGVPLGPNNRLYAGSWSDWVSDEGRPVATGE

    >gi|15807740|ref|NP_285395.1| hypothetical protein DR_A0072 [Deinococcus radiodurans R1]
    MPERSPAPDITVYTVPDCPDCEAVQALLRRRGLTPTVRNVRGDPAALAEMQRRADGVRIAPVTIIGEQVFYGPFDEQRPR
    LLAALERQGTQ

    >gi|15807741|ref|NP_285396.1| cation-transporting P-type ATPase [Deinococcus radiodurans R1]
    MEAHGTRLSYFVEGMDCANCVARVEKMVGGLPGTGEVKTSFTRQTLTLELDETQTSRAALEKNLRSLGYGPSLLPDRDAP
    QTGEGAHTHDHADHQHAGHSHSHDPAEQGKPWYRTGQGQLVVASGVLLALAWVFGRFEPAWAQWGYAAAALLGAWPLAKK
    AWASVRLGDPFSINLLVTLAAIGAVAIGQAAEGAVVVFLFAVGELLEGVAAGRARAGIATLAALAPKTALLVEPGGVREV
    PADTLQVGQTVQVGPGARVPADGTITAGQSSLDDSPVTGESVPVSKGPGDHVYAGSINTDGVLTVRVDRAAADNTIARII
    HLVEEAESSKAPTARFIDRFSRWYTPGVVAVAALTAALPPLLLGQPWYPWLYKGIALLLIGCPCALVLSVPAAITSGISA
    GTRRGLLIKGGAALETIGSVRTIAFDKTGTLTSGRPRVTDVLADNPAELLRLAAAVETGSSHPLAQAITAEAQARGLTVP
    AASEARALPGQGVTALVEGRPVQVTSPIFAASQATLSAEQQQTVATLEQQGRTVVVGLDGGRVLGLIALRDEPREDAREA
    LAELRRLGIRPLMLTGDNARTGQAVAADLGLDVQAELLPADKLNIIDELRAQGGVAMVGDGINDAPALARADVGIAMGSG
    TDVALETADAALLRGQVQGVGELVQLSRDTLANIRQNVAFALGLKAIFLVTTLLGYTNLWMAVLADTGATAIVTANALRL
    LNWRPRHA

    >gi|15807831|ref|NP_285486.1| hypothetical protein DR_A0162 [Deinococcus radiodurans R1]
    MTDLLDLLRSPWPWWVGGPLIGLTVPLLLWLGNKSFGISSNLRHLCAIALPEAAKPPFFRYDWRAEGWNLAFALGLVLAG
    AVFGGLLANPQPTHLSAAGVQSLHDLGVAVRPGLVPAELTDLRHPGVWGLLALSGLLIGFGTRYAGG
    CTSGHAITGLSTL
    QLPSLIATVSFFAGGIFSANVLLPLLFGALGIGGLK

    >gi|15807833|ref|NP_285488.1| thioredoxin 1 [Deinococcus radiodurans R1]
    MSDILTCTHCQAKNRVGAVPAGQVPSCARCGAALPWLHDGTDATFEQDLQTSVPVLVDFWAPWCGPCRVMGPVLEDLARD
    LPGKVRVVKVNVDENPRTAARFEVRSIPTLLMFKDGEEVDQMVGVTQKAALRARVEHLNQLS

    >gi|15807964|ref|NP_285627.1| hypothetical protein DR_A0304 [Deinococcus radiodurans R1]
    MTLYPRGVYFHSKSEPSRSLFRRTTMFFERFYDTDLAQASYMVGCQRTGECLVIDPVRDVQQYLEKAASQRLRVTHVTET
    HIHADYLSGSRELAAATGAQLLLPGEGGAEWRYDFGDQKLHHGDVFWVGNVKVEVRHTPGHTPESLSFLVTDTPRGDVPV
    MCFTGDFVFVGDVGRPDLLDEAAGGVETRFVGARQMFASLRDQFLTLPDGVQVWPAHGSGSACGKALGAVPSTTVGYERA
    LAWWAPYVERGDEQGFTDELLSGQPDAPLYYGRMKTQNRAGPTVLGEVSALPQLSAAEVERQLAAGALLIDTRPREQHQA
    AAPRRSVNLPVGNTFETWSGWLLRPEDGDYVLLAASAEQAEALRRRLWMVGLDNVSGFITSTDGLDTAPQRPFAPADLPQ
    HKDALVLDVRKKTEYDAGHIPGARQLHAGRLPWKLGELPQEQEIVVH
    CQSGARSAAAASFLRARGFNVSELAGGYEAWEK
    AQG

    >gi|15805098|ref|NP_293783.1| hypothetical protein DR_0057 [Deinococcus radiodurans R1]
    MTPLPTLTLYHRPGCHLCEQAQTHLDELGFAYQLHDISGDAALTARHGDHIPVLALGDRVLLRGVLSRSRLSTLKLRLLR
    EQEA

    >gi|15806196|ref|NP_294901.1| hypothetical protein DR_1177 [Deinococcus radiodurans R1]
    MSTKKTLNVTWLGEQRYLGVSESGHQLLIDNSPVKVGVSPMEALLGALATCTAYDVVEIMKKRRTPLASYRIEVEGERAD
    TDPKRYTRITVRHIAAGEGVTAEALSKAAHLSHEKYCSVAASLNSEIVVEAELAGEPAAS