Deinococcus geothermalis DSM 11300 uid58275

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|94971860|ref|YP_593900.1| nitrite reductase (NAD(P)H) large subunit, NirB [Deinococcus geothermalis DSM 11300]
    MTHPTPQFSCPRVVIVGNGMVGHRLVENLRVVGPDALSITVVSEETRLAYDRVRLSACVDDDAPDLALATPNSYQAQGVK
    VAWGRAIAVDRAAKTVTVAGKTETQTLAYDVLVLATGSFPFVPPIPGNDAAGCFVYRTLDDLAALRDAARTARSGAVIGG
    GLLGLEAAGVLRKLGLETHVVEFAPHLMPAQLDAEGGAQLKRIIADLGIDVHVSKATREVVTDASGRVTALTFADGSRLE
    TDLVVFSAGIRPRDDLARACGLAVGERGGIQIDDRCATSDPAIYAVGECALHGGRVYGLVAPGYAMAKVAAANLLADLGL
    GEVTEAKFLGADLSTKLKLLGVEVGSFGDAQGQTPNARSISLSDNVRGTYAKLVLSPDGTYLLGGLLVGDTSRYDDLLDL
    TRSGTPLLVAPEMLLVPPRPGHDTLPDRTNALVCSCENVRTKTLIAAIEDGCRDVAGLKKCTGAGTGCGGCVPSLHSLLQ
    KELRRFGETVTNRLCEHFPHSRQELFNLIRVKGHRTWDEVLRAHGTGLGCEICKPAVASILASVHNEYILKAEHALLQDT
    NDAFLANIQKNGTYSVVPRVPGGEITADGLLAIGAVAKKYGLYCKITGGQRIDLLGAQRDDLPAIWSDLIAAGFESGHAY
    GKSLRTVKSCVGQAWCRYGVQDSTSLAVKLELRYRGLRSPHKLKSGVSGCTRECAEARSKDFGVIATEKGWNLYVGGNGG
    VTPKHAVLLAADLDEETLIRTIDRFLMFYIRTADRLQRTSTWLENLEGGLDYLRGVIIDDTLGICADLDAAMAQHVASYF
    DEWAAALADPQGLARFRAFINSDTRDNTIQWVHERGQIRPAFEHALTPLPLAGGND

    >gi|94972239|ref|YP_594279.1| thioredoxin reductase [Deinococcus geothermalis DSM 11300]
    MKQNYDVVIVGGGPAGLTAAIYTGRASLSTLVLEKGLPGGQIAQTEEVENYPGFPEPISGMELAQRMVQQAEKFGARIEM
    DEVEAITHADDDREHVYPFTIRGYSGTYRAKAVILATGANPKRLNVPGEEHFWGKGVST
    CATCDGFFYRGKKVVVVGGGD
    AAVEEGLFLTKFADEVTLIHRRDTLRANKVAQARAFANPKMKFVWDTVVEEILGQEQVMGVRLKNLKTGETSEFPTDGVF
    IFIGHVPNTEFVRDTVKLRPDGYVEVTDEIYTSVPLLFAAGDVSDYVYRQLATSVGAGTRAAMSAERALAALELETTTAA
    D

    >gi|94972219|ref|YP_594259.1| heavy metal translocating P-type ATPase [Deinococcus geothermalis DSM 11300]
    MYHGRMARPAETLPSPAVFPELRYHVGGMDCASCVQKVERAVSRLPGTCDVQSSFTTQTLRLRLDERQTSRAALEEQLRA
    LGYVPHRLVARGEATELPAPTQQSWFAGEQGRLVLVSGALLAAAWLLSLAWPPLSVWGYAAATLVGVWPLARQAAAAARL
    GEPFSINTLVTLAALGALLIGQAAEGAVVVFLFSVGELLEGVAAGRARAGVQALAALTPRTALLLRGTQVVEVSAESLRV
    GQRVQVRPGARVPADGIIETGFSALDDSPVTGESVPVEKGVGDWVYAGSVNGSGLLTVRVERAASDNTIARIIHLVEEAE
    SRKAPTARLIDRFSRVYTPLVVAVSAAVATLPPLLAGAEWHTWLYRGLALLLIGCPCALVLSVPAAITSALAAGTRRGLL
    VKGGAALEQLASIRTVAFDKTGTLTVGQPVVTDVRPLAGQDAQEVLRLAAGVESGSDHPLAHAVVDRAGALGLSVPASQD
    GQALPGQGVSAQVEGQILHVVSPGYAAARGWLTPDAQAEVAALEAQGKTVVVLAGDQALGLLALRDEARADAREAVARLR
    ALGLRAVMLTGDNVRTASAIAEPLGLEAQAGLLPGDKLRVVRDLQGMGGVAMVGDGINDAPALAAADVGIAMGGGTDVAL
    ETADAALLHARVTGVAELIELARAALNNIRQNVAFALGLKAVFLVTTLLGHTSLWLAILADTGATALVTANALRLLRWRG
    RP

    >gi|94972196|ref|YP_594236.1| redoxin [Deinococcus geothermalis DSM 11300]
    MSPRPGDPAPEFETRSDRGDPLSLADFRGHWLVLFFFPRANTTHCQLQARRFEALAPAFGALNARILGVSSDARAQQVAF
    RNLCQLSFPLIPDTDHQLSERYGVLGEPFPGEETRIARRETFLISPEGRVVRHWTEVIPKTHAAEVLEELRKVLGQPAA

    >gi|94972148|ref|YP_594188.1| beta-lactamase-like [Deinococcus geothermalis DSM 11300]
    MFFKRFYDTDLAQASYMIGCQQTGECLVVDPIRDIQQYLDEAKSQKLRVTHVTETHIHADYLSGSRELAKATGAKLLLSD
    EGGEGWRYTYDDGNQIRLHDGDTFMVGNVRIDVLHTPGHTPEHLSFLVTDTPRGDTPSMILTGDFVFVGDLGRPDLLDEA
    AGGQDTRFVGAKQMFASLRDKFLSLPDYVQVWPGHGAGSACGKALGAVPTTTVGYERALSWWGKLVEKGDEEAFTQELLS
    GQPDAPLYYGRMKRENRDGPALLGEVQALPELSVKDVQAWLAAGARLIDTRRKEEHQAAAPVGSINIPDGNTFETWAGWL
    LKPERAFILLAPAHRAEVLRRRLWMVGLDNVIGFIPSAEGLETAPAQPIPASELPQHEDALILDVRAKTEYERGHIPGAH
    QLHAGRLPWRLSTLPRDREIVVH
    CQGGARSAAAASLLRAEGFQVTELAGGYDAWAKTQQETLPA

    >gi|94972147|ref|YP_594187.1| rhodanese-like protein [Deinococcus geothermalis DSM 11300]
    MPYQDIFPNELEAKQREGAHLIDVRERDEYVQGHIPGAVNVPLSELQGREDEIPDGAVLICASGNRSSQAAAYLAAQGKT
    GLMNLSGGTAAWLREGRAVSQGERP

    >gi|94972145|ref|YP_594185.1| protein of unknown function DUF395, YeeE/YedE [Deinococcus geothermalis DSM 11300]
    MTELFDFLRSPWPWYVGGPLIGLTVPLLLWLGNKSFGISSNLRHACAILLPEGAKPSFFRYDWKKERWNLMFAAGLILGG
    FVAGVLLANPEPTRLSAAGTASMQALGVTVRPGLVPAELTDLGNPGVWLLLAVSGLLVGFGTRYGGG
    CTSGHAITGLSTL
    QGPSLIATVSFFAGGILSANFLLPLFMAVIR

    >gi|94972060|ref|YP_594100.1| heavy metal translocating P-type ATPase [Deinococcus geothermalis DSM 11300]
    MSTTIELGVQGMTCASCVGRVERGLSKVPGVEVASVNLATERATVTYDPAVTTPQVLLDKVKEVGYEPLVSHLELGVQGM
    T
    CASCVGRVERALKKVDGVLDASVNLATERASVSFLHGVNTGQLKAAIREAGYEVLEEQAGLSREEQEREVRAQEVNHLR
    RQVQFSALFAIPLMIIAMAPMLIPAVEDWMMTTFGHGVMGTLNWVMLALAIPIQFGPGRRFYRLGWKSLKSKSPDMNALV
    MIGTTAAFLYSLVATVAPGIFPEGTAHVYYEASGVVITLILLGKYFEAIAKGRSSEAMKKLLSLQAKTARVVRNGQELEL
    PTDEVLVGDVISVRPGEKIPVDGEVISGNSFVDESMITGEPIPVNKQSGAGVVGGTINQNGALSFKATKIGADTALAQII
    KLVETAQGSKPPIQGLADKVVAVFVPIVLVIAALTFLAWMIFGGQTALSFALITTVAVLIIACPCAMGLATPTSIMVGTG
    KAAELGVLFKGGSALEGLQDVRVVAVDKTGTLTKGRPELTDLETAPGFNRHAVLKLVAAAEEQSEHPIARAIVDAAKREG
    VALVKPESFEAVPGYGLEAQVDGQRVQVGADRYMTKLGLDVNAFAPQAQQLGDEGKSPLYAAIDGQLAAIIAVADPIKEG
    SQEAVNALHRLGLKVAMITGDNGRTANAIARQLGIDEVLAEVLPSGKSEAVQALQAKGHKVAFVGDGINDAPALAQADVG
    LAIGTGTDVAVETADVILMSGDLRGVPNAFALSRATLKNIKFNLFWAFAYNALLIPVAAGLLYPAFGWLLSPVLAAAAMG
    FSSVFVLSNALRLRGFKPPVSVTPVPQATPAQLQHA

    >gi|94972051|ref|YP_594091.1| glutaredoxin [Deinococcus geothermalis DSM 11300]
    MSMTVTVYTVPNCSSCEAVKRFLRSRGVPFTEKNIREDPAALAEMQARANVRIAPVTVIGDQAFYGTFDDQRPLLEAALG
    ENGI

    >gi|94972049|ref|YP_594089.1| heavy metal translocating P-type ATPase [Deinococcus geothermalis DSM 11300]
    MTSSPPTSSTHLRYFVNNMDCADCARTVQSALTRLPGVGDPKVNFTTQTLSLTLDEARLSRERLEQTLRSLGYPPTLQSP
    NPTSTAPLRYFVNNMD
    CADCANKVQGVVTRLPGVSEPKVNFTTQTLSLTLDEARTPRAQLEQTLRSIGYPPELQAEVNPA
    PGTASISAPRPARVELPWYRTSKGRNVLLTGGLLALAFVFSLVAPSLAFWAYAAATAIGVWPLLRKAVASARLGEPFTIN
    TLISVAAIGAIAIGEAAEGALVVFLFAIGELLENVAAGRARAGIQALAALAPKTALLLEGNQTREVPVEQLQVGQLVRVQ
    PGGRVPADGTITEGDSNLDDSPVTGESVPVHKSAGDTVYAGSINTDGVLTVQVDRGASDNTIARIIHLVEEAESSKAPTA
    RFIDRFSRWYTPAAMAVAFLFAVLPPLLFGQPWNEWIYKGVALLLIACPCALVLSVPAAMTSGISAGARRGLLIKGGAAL
    ETIGSVSTVAFDKTGTLTENKPQVTDVIGLRAPEQEVVLLAAAVETGSAHPLAKAILARAQGQAVPAAQDAKAISGKAVT
    ATVQGRALAVGSPRYAVEVASLSPDEQAQIARLEEQGKTVVVVLDGRQVLGLLAIRDEPRADAKEAVARLKGLGVRSLML
    TGDNARTGNAIARDLGLDVEAELLPEDKLQRIAALKQSGKVAMVGDGINDAPALAQSDVGIAMGGGTDVALETADAALLR
    HSVTGVAELVELSRAVMTNIRQNVAFALGLKAIFLVTTLLGITGLWPAILSDTGATVLVTANALRLLRFKPGV

    >gi|94972022|ref|YP_594062.1| heavy metal transport/detoxification protein [Deinococcus geothermalis DSM 11300]
    MTTELTVKGMTCGHCEKAVQNALKSVSGVQDVRVNLREGTATVQGDADPQALIAAVTEEGYGAQVRV

    >gi|94972021|ref|YP_594061.1| heavy metal translocating P-type ATPase [Deinococcus geothermalis DSM 11300]
    MSKTVELGVQGMTCASCVGRVERGLKKVEGVESAVVNLATERATVAYDPEKTSPQALLDKVKDVGYEPIVGHMELGVQGM
    T
    CASCVGRVERALKKVEGVLDASVNLATERATVTYLPSGVSPGQLKAAVREAGYDVLEEQAGVSREDQEREAREREVNHL
    RRQVQFSAVFAIPLLLIAMVPMLVPAVNDWLMTTFGHGVMTTLNWVMLALALPIQFGPGLRFYRLGWKSLKNRSPDMNAL
    VMIGTTAAFLYSLVATVAPGIFPEGTAHVYYEASGVVITLILLGKYFEAIAKGRSSEAMKKLLSLQAKTARVVRNGQELE
    LPTDEVLVGDLISVRPGEKIPVDGEVVQGASFVDESMITGEPVPVSKQPGAPVVGGTINQNGALTFRATRIGADTALAQI
    IKLVETAQGSKPPIQGLADRVVAVFVPVVLGIAALTFLLWLILGGQTALSFALITTVAVLIIACPCAMGLATPTSIMVGT
    GKAAELGVLFKGGGALEGLQDVRVVAVDKTGTLTKGKPELTDLVTAPRFDRAEVLQLVAAAEEQSEHPIARAIVDAARKE
    GIADLKPESFEAVPGYGLEARVDGHLVQVGADRYMTRLGLDVNVFAAQAERLGDEGKSPLYAAVDGQLAAVIAVADPIKK
    GSQEAVNALHHMGLKVAIITGDNARTASAIARQLGIDEVLAEVLPSGKSEAVKELQAKGQKVAFVGDGINDAPALAQADV
    GLAIGTGTDVAVETADVILMSGDLRGVPNAFALSRATLRNIRLNLFWAFAYNIVLIPVAAGVLYPAFGILLSPVLAAAAM
    GFSSVFVLSNALRLRGFRPPVRPEGVSTGAPSTTPARA

    >gi|94971986|ref|YP_594026.1| thioredoxin [Deinococcus geothermalis DSM 11300]
    MSEVAVCTNCGAKNRLAPPPAGQVPVCGRCGHPLPWLLNVSDATFDTEVKAAVPVLVDFWATWCGPCRVVAPVLEDLARE
    HAGKLKVVKLDVDQNPAVAGRYSVRSIPTLMLFQEGRPLETWVGAIPKGSLEARLAPYLRG

    >gi|94984197|ref|YP_603561.1| ATPase, P type cation/copper-transporter [Deinococcus geothermalis DSM 11300]
    MTRTIELGVQGMTCASCVARVERALKKVDGVENASVNLATERATVTYDPAVTTPQVLLERVKDVGYEPVVSHLELGVQGM
    T
    CASCVGRVERALKKVDGVLNTSVNLATERARVTYLPSSVSPGQLKAAIREAGYEVLEAPAGVSREEQEREARAREVSHL
    RRQVLFSAVFALPLLLLAMLPMLVPAVQDWLMTTFGHGVMTTLNWVMLALALPIQFGPGRRFYRLGWKSLQHRSPDMNAL
    VMIGTTAAFLYSLVATVAPGIFPEGTAHVYYEASGVVITLILLGKYFEAIAKGRSSEAMKKLLSLQAKTARVVRSGQELE
    LPTDEVLVGDLISVRPGEKIPVDGEVVQGASFVDESMITGEPVPVSKQPGAAVVGGTINGNGALTFRATRIGADTALAQI
    IQLVETAQGSKPPIQGLADRVVAVFVPVVLGIAALTFLLWLLLGGQTALSFALITTVAVLIIACPCAMGLATPTSIMVGT
    GKAAELGVLFKDGGALERLQDVRIVALDKTGTLTRGRPELTDLVTVPSLDRSEVLKLVAAAEEQSEHPIARAIVDAAKRA
    GLTVQKPEAFEAVPGYGLDAWVEGHHVQVGADRYMAKLGLDVNTFAPQAQQLGDEGKSPLYAAIDGQLAAVLAVADPIKD
    GSQEAVNALHRMGLRVAMITGDNTRTARAIARQLGIDEVLAEVLPSGKSDAVRELQATGHKVAFVGDGINDAPALAQADV
    GLAIGTGTDVAVETADVILMSGDLRGVPNAFALSRATLRNIRLNLFWAFAYNIVLIPVAAGVLYPAFGILLSPVLAAAAM
    GFSSVFVLSNALRLRGFRPPVRPLQSQPLGQTA

    >gi|94984198|ref|YP_603562.1| heavy metal transport/detoxification protein [Deinococcus geothermalis DSM 11300]
    MTQTDQIELNITGMTCSHCQAGVTRALKQVPGVTDAQVDLKTGKAVVYGNAEPQQLIEAVAEEGYGAQVAPR

    >gi|94984230|ref|YP_603594.1| redoxin [Deinococcus geothermalis DSM 11300]
    MSLLGQPAPDFTLPSTLGEPVTLSSYRGQQHVVLVFYPLDFSPVCSMQLPEYSGRQDDFAEAGAVVLGVNRDSVYTHKAW
    AAEYGIEVPLLADMNLNVARQYGVAIDERGISGRAVFLIDKGGVVRFEYVEAQTGDYTVRPELVLAKLAEL

    >gi|94984267|ref|YP_603631.1| 3-mercaptopyruvate sulfurtransferase [Deinococcus geothermalis DSM 11300]
    MTATESPLKSAEWLLAHLNDPQVRVLDCRYALTDPLLGRIAYLEGHIPGAIYADLETDLSGPVRPDGAGGRHPLPDPATL
    AAWLGRVGIGNDSVVVAYDDPRGGQGFYATRAWWLLRWLGHQQVYVLDGGWPAFLAAGGQPSTAEPEFAPTTFRPDVQMD
    MVATAEDVAGRDAHTLLIDARAPNRYRGEVEPLDRKAGHIPGAVNREWAGALDESGHWREAQAQAARLKAGDAPTITY
    CG
    SGVSATPNLLARELAGVPLGPQNRLYAGSWSDWISDDARPVATGEEPGSRKP

    >gi|94984284|ref|YP_603648.1| UBA/THIF-type NAD/FAD binding fold [Deinococcus geothermalis DSM 11300]
    MTPSLSRTELRRYSRQLLVPEWQGAGAQERVRGAAVLVVGAGGLGGPVILQLAGAGVGRLVIADGDTVDLSNLHRQTQFS
    LADVGRPKAEVAAARAQALNPFVRVEVAPRLDAGNADTLLAGVDLIVDATDNFEARYAIADACGRAQREWVWGAASGTSG
    LVSVFGPDLGLRDVFPDPGDAAS
    CDEAGVLGPLPNVVGGVMALEALKLLGGVGEPLRGRLWTFDALSGRVRVLHLRGTGG
    QVGGRA

    >gi|94984431|ref|YP_603795.1| HesB/YadR/YfhF [Deinococcus geothermalis DSM 11300]
    MTATSLPEPRGDVPAKAISISEFGAQKALAILAQSGKENAGVRVFIKSGGCSGYQYGMAIDDRELEGDTIVVDRGVKLLV
    DRMSLPLLRGSEVDFVENMMGGGFTVHNPNATSSCGCGHSFRTDGAQSPEGQGSGGCGSF

    >gi|94984461|ref|YP_603825.1| dihydrolipoamide dehydrogenase [Deinococcus geothermalis DSM 11300]
    MDAYDVLVIGGGPAGYVAAIRAAQLGFKTACVDAFTRNGKASLGGTCLNVGCIPSKALLDSSERFEMIKHEAGEHGIQVD
    GATVDVAKMLGRKESVVDKLTGGIAYLFKKNKVTSIHGLGRLVRREGDSWIVDAAGTEVRAKNVIVATGSTPRQLPGVPF
    GGNIVDNEGALAFTQVPAQLGVIGAGVIGVELGSVWRRLGAQVTILEALPGFLMAADDAVSKEALKQFQKQGLDFHFGVK
    ITEVKQDDSGVTVTYEEQGQPVTARFDKLIVSIGRVPNTQGLGAQEVGLQLDERGFVKVDHHFRTNLPGVYAIGDVIGGP
    MLAHKAEEEGVAVAELLAGQAGHVNYAVVPWVIYTSPEIAWAGLTEKQAKEQGHKVKTGQFPFSANGRALGHGDPRGFVK
    VVADADTDRILGVHMVGPNVSELIGETVALMEFGASAEDLARTVHAHPTLSEVVKEAALATDKRALHM

    >gi|94984554|ref|YP_603918.1| OsmC-like protein protein [Deinococcus geothermalis DSM 11300]
    MSGIMSAMSNLYTAEATATGGRTGAVKSSDGRLDLPLSSPRELGGDGGPGTNPEQLFAAGYAACFQSALGVVARREKVEL
    PEDSTVTARVGLQRNGLAFALDVELEGHFPGLSSEQAHALMHAAHQV
    CPYSVALRDNVAVRLKVAG

    >gi|94984633|ref|YP_603997.1| OsmC-like protein protein [Deinococcus geothermalis DSM 11300]
    MADIARKASAQWRGDLRSGQGTIRTESGVLKDAQYSFKTRFENGAGTNPEELLAAAHAGCFTMQLSALLAADGHDPQDLR
    TEATCEMVREGQGFKVSAMRLVVRGRVGNIDQAEFERHVQQAAQM
    CPLSRVMQGNVEITHEAVLE

    >gi|94984799|ref|YP_604163.1| DSBA oxidoreductase [Deinococcus geothermalis DSM 11300]
    MTRLQGSNQNRTVLVIGTLIAALLIALALFAARGRSSGQTGTANFDLTGQPVLGQENAPVTLVVFEDFKCPNCKRFEEEF
    MPELRSKYIDTGKAKLISMNFPFIAAMSNLPVDDSKLAAQAAECAYLQGGSEAYDRMKQILFRAQGAESEVWASKSRLKD
    LAGSVEGIDQAKFNTCLDNDETAAAVEADKQQAEKAGVSGTPSVFVNGKLVSSYDAATVGAAIDAASR

    >gi|94984818|ref|YP_604182.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Deinococcus geothermalis DSM 11300]
    MRIVVVGGVAAGMSAASRARRQNPQAQVTVFERGGEISYGACGLPYVIGGEVPGFERLIARTPEQMRAQGIDVRLRHEVT
    DVNTATRTVTVHDRGAGRSFTEPYDRLLLATGVNAIWPEWASSHLHAVHVLRDLADGRAILASLAGASRACIVGGGYIGL
    EMAEALRSRGLEVILLEKGPEVAGRMLDRASQQRVRAELERHGVDVRCGTTVEGLAGKDRRVSSVQTDGGPVPADVVIVA
    VGVQPNTALARAAGARLGETGAVAVDARQETSVAGVYAAGDNTESTHRVTGQKVHLPLGLTANRMGRVAGVNMAGGDARF
    PGIVGTGIFKAFDLGAARTGVTQAEAEGLGLKAVSVDVDSTDHAEYYPDAAPIHVRLTGERGSGRLLGVQLVGQPESVKR
    VDVVAALLHQGGSAQDLFELDLAYAPPFSSVWDVLLVAADRLGRELCEEG

    >gi|94984836|ref|YP_604200.1| glutaredoxin 2 [Deinococcus geothermalis DSM 11300]
    MLPVLTLYTRAGCHLCEQAQANLQALEYRYEPLDVDRVPALQARYGDDVPVLALGERVLLKGVLSRGRLSALKLQLLREQ
    AGQRKRV

    >gi|94984854|ref|YP_604218.1| DSBA oxidoreductase [Deinococcus geothermalis DSM 11300]
    MNRVIGLVAGALLAANLGSQASAQLLATPAATAAQPLLAGFRVSGSTLTRGTTTLTLDTAGGRVVGVLVQADNPQDVARA
    LVAAWGGPEQNVAAVAQALGRDDLQREARGAQGLRDDSEGTLLRVKLNGTGGAQRWTAYTALLIFPDRAFPATANVQGSA
    QAPNVLRIFSDFQ
    CPYCKELWDTAHPKWAAQPNVYRVMHYHFPLSFHKNAEPAAIASECAAEQGKFWPYADLLFRHTAEW
    TGLPSASAKFSEYAQAAGLNVAAFQTCLTSAAPKAVVRAQQAAGLKLGVQGTPTVYLNGVQLRNYSDENELAAVRAVTAA
    SPGAVEVIAARLKRF

    >gi|94984950|ref|YP_604314.1| peptide methionine sulfoxide reductase [Deinococcus geothermalis DSM 11300]
    MPTFTRCSTVLQRPVPSPSRRENLSMTSAQSEQTQQAIFAGGCFWCTEAVMKDVRGVTRVESGYIGGHVPNPDYAAVCSG
    ETGHAEAVRVTFDPAQVSFRDLLMLFFATHDPTSLNRQGADVGTQYRSAVFPLNEEQERETREVIGELTAQGVFERPIVT
    TIEPAGPFYVAEDYHQDYYARNPYQPYCMAVITPKVAKFRKAYSDRLRG

    >gi|94985080|ref|YP_604444.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Deinococcus geothermalis DSM 11300]
    MQEFDVIVVGAGPAGLNAALVLGGARRRVLLLDGGPPRNASAAAAHNVFTRDGTPPVQLKTLGLADLTPYPVTVLPGMAR
    EARAHPDGFAVRHDDGWFHARRLLLATGVRDVLPNVPGLRERWGLTVHH
    CPYCDGWENREAALAVLGSGQEGHHLALSVR
    AWSKNVTLLTDGPDELTDEQRRDLARVGVPISTAPILRVEGTDTVTVKFRRGERLTLHAIFLNPTQQQNSTLPAALGCEM
    NEKGRVVVNEHGMTSVHGVWAAGDMTGAPQYVMSAAASGMTAAVSLNTTLIHENVRKLGAAFHKSPGEEGGEPPSGGEAS


    >gi|94985095|ref|YP_604459.1| redoxin [Deinococcus geothermalis DSM 11300]
    MPLHPGQPAPEFDVRSDDGQRVRLADLRGRWVVLYFYPRANTPGCSVEARRFEAALPEFERLNAVVIGVSTDTEARQANF
    RDTCGLSFPLIPDGDRTLSRAYGVIGGLGGLLGVAARQTFLIDPEGRIAQHWRTVNPATHAADVLQALQERV

    >gi|94985349|ref|YP_604713.1| redoxin [Deinococcus geothermalis DSM 11300]
    MTELPSTSKPAAPAPLWRRLIPPLLAAALVAVLGIALLNPAHNATDGGPLVGKPAPEFTLTSLDGTPVSLASLRGRPVVL
    NFWASW
    CGPCREEAPLFRELSTRQSAGQGLAVVGILFQETNEQNARDFIREYALAYPSLRDPGIQTGINYGVSGIPETFF
    IDREGVIRHVDRGGLTRERLNVGLKKIGVPEL

    >gi|94985364|ref|YP_604728.1| hypothetical protein Dgeo_1263 [Deinococcus geothermalis DSM 11300]
    MNRLAQETSPYLLQHAENPVDWWPWGEAAFAEARRRDVPVLLSIGYSTCHWCHVMAHESFEDPSTAEFMNKHFVNIKVDR
    EERPDVDSVYMTATQLMTGQGGWPMTVFLTPDGKPFYAGTYFPPEDRYGMPGFRRLLASVAQAWAQDRDKLTGNAQTLTE
    HIREASRPRRGAGDLPTDFLRRGVDNLRRVYDADLGGFGSAPKFPAPTTLDFLLTQPEGRDMALHTLRMMGRGGIYDQLG
    GGFHRYSVDERWLVPHFEKMLYDNAQLTRTLLRAWQFTGDPTFTRLARETLAYLEREMLAPQGGFFSAQDADTQGVEGLT
    FTWTPQEIREVLGAGPDTDLVLRVYGVTEEGNFADPHRPEYGRRNVLHVLTPPAELARDLGESAEALSARLDAARRKLLT
    AREQRPQPGTDRKVLTSWNGLALAAFADAGRILGEGHYLEIARRNADFVRQHLRLPDGTLRHTYKDGEARVEGLLEDHAL
    YGLGLVALYQAGGDLAHLAWARELWGIVRRDFWDGEAGLFRSTGGRAETLLTRQAQGFDAAVLSDNAAAALLGLWISRYF
    GDEEAERLARATVRTYQADMLAAAGGFGGLWQAAAFLAAPQVEVALIGTPAERAPLERVVARFPLPFAAIAPAEHGEGLP
    VLEGRPGGGTAYVCVGHACDLPTRDPEVLAGQLERLPR

    >gi|94985381|ref|YP_604745.1| rhodanese-like protein [Deinococcus geothermalis DSM 11300]
    MASSETATMGSEIRPASGSRRRSSAGRRSIRVTPLGRVMLRVYPECIPVPSVPADACMLKRMKADSLKDVSPAEGQRRVQ
    EGALLVDVREPNEYQEVHAEGALLLPLSEFEARYAELPRDRELVMI
    CRSGARSARAGQYLLDNGYTKVVNLEGGTLAWKE
    AGLPTEEGGA

    >gi|94985546|ref|YP_604910.1| hypothetical protein Dgeo_1446 [Deinococcus geothermalis DSM 11300]
    MTTTQPEAKDRISSLPVPDATQVPEGVRKLWAKAEANIGFVPNVFRAQAVNGEQFLAWWNYFNLLLNKEGYLTNAERELV
    AVVVSGVNRCLY
    CAVSHGAALREFLGDPQKADAVAVNWRHADLTEREQALAAYAEKLTRHPAEVTAADLEPLRAVGLDDH
    QIMELVQVIGMFNLTNRVSSALGFVPNPEYYRQAR

    >gi|94985608|ref|YP_604972.1| glutaredoxin-like protein protein, YruB [Deinococcus geothermalis DSM 11300]
    MIKMYTTSWCPDCHAAKRALSSKGIPFEEINIEQDEQAAEYVMSVNGGKRSVPTLVSGDVARSLSGFRPQKLDAFLAEAG
    L

    >gi|94985676|ref|YP_605040.1| thioredoxin reductase [Deinococcus geothermalis DSM 11300]
    MTSASQHSHDYDVVIVGGGPAGLTAAIYTGRASLSTLVLEKGLPGGQIAQTEEVENYPGFPEPIHGMELAQRMVQQAEKF
    GARIEMDEVEAITHAEDDREHVYPFTIRGYSGTYRAKAVILATGANPKRLNVPGEEHFWGKGVST
    CATCDGFFYRGKKVV
    VVGGGDAAVEEGLFLTKFADEVTLIHRRDTLRANKVAQARAFANPKMKFVWDTVVEEILGQEQVMGVRLKNLKTGETSEF
    PTDGVFIFIGHVPNTEFVRDTVKLRPDGYVEVTDEIYTSVPLLFAAGDVSDYVYRQLATSVGAGTRAAMSAERALAALEL
    ETETAAD

    >gi|94985876|ref|YP_605240.1| thioredoxin-related protein [Deinococcus geothermalis DSM 11300]
    MLLTQANCPACVRLERMLSGPLRGAYWEQIEVVRREDDERQFLALAGEYGVRSTPALVERGTGRQITGAGSLHEVRLLLG
    V

    >gi|94985937|ref|YP_605301.1| thioredoxin [Deinococcus geothermalis DSM 11300]
    MKPVELTDSNFQSETAQGLTLVDFWAPWCGPCRIIAPVVEELADQYEGRVKVGKLNVDDNPGISGQYRVMSIPTLILFKD
    GQPVEGMVGAQPKRAFEALLDKYVAPAATH

    >gi|94986059|ref|YP_605423.1| hypothetical protein Dgeo_1960 [Deinococcus geothermalis DSM 11300]
    MFSIDAVPPGRTLACMDWPAPEDFVHGDPLPPPDQWTRPGLVMVFNLECPGCVSRGLPFLRQLHTEFGDRVHLLALHTSR
    GHRRLPREDVEPTLVRFAREYARLPFPVALDLEGDLARTWATEGTPHWLAFAAGGELLRSVYGSQENAQTRLQYLLEELV
    GPA

    >gi|94986171|ref|YP_605535.1| methionine sulfoxide reductase B [Deinococcus geothermalis DSM 11300]
    MTRDFVKPSEAELRQKLTPEQYRVTQQEGTERAFTGEYWDHDEPGIYVDVVSGEPLFSSLDKYDAGCGWPSFTRPIPGVT
    LTERTDHKIGYPRTEVRSGLADSHLGHVFPDGPSEAGGLRY
    CINSAALRFVPLERLEEEGYGEYRKLFEQQD

    >gi|94986172|ref|YP_605536.1| DSBA oxidoreductase [Deinococcus geothermalis DSM 11300]
    MTRFHPSTPDKLRVDIWSDLACPWCSIGKRRFEQALAGFSHRDQVGVVWHSFELDPSAPVQSPLSLREGLARKYGRTLQQ
    AQDMLDSMTRTAAGEGLDYHFERVQPTNTFLAHQLTHLAAEKGLADAMEERLFAAYLSEGELLGDPEVLVRLASEVGLDA
    AEVRAALERGTYAQAVRQDEAQAQALGITGVPFFVLGGKYGVSGAQPAEVLRSALEQVWQETHPAPLTLLAAGASAEGCE
    DGQCAVPGRDAANVQG

    >gi|94986305|ref|YP_605669.1| thiosulfate sulfurtransferase [Deinococcus geothermalis DSM 11300]
    MEYAKDVLVSTDWVAQNLNREGVRLIEVDEDILLYDTGHIPGAVKIDWQQDFWDPVMREFIQPEQLQALLGRLGLKPEDT
    IVLYGDKSNWWAAYAYWFLTYNGVQNLKLMNGGRQKWVAEGRELTTEVPSYAPTEYPPLQRDESLRAYRDEVKAHIEAVR
    AGQGAMVDVRSPDEFSGKVTHMPNYPQEGVLRGGHIPGARNIPWARATNEDGTFKSADELKALYEGEGVTPDKDVIAY
    CR
    IAERSSHSWFVLRELLGYPKVRNYDGSWTEWGNAVGMPIEKTYQEA

    >gi|94986420|ref|YP_605784.1| dihydrolipoamide dehydrogenase [Deinococcus geothermalis DSM 11300]
    MTKQMDFDLLVIGAGPGGYHAAIRGAQLGLKVACAEREALGGVCLNVGCIPTKALLHAGEMMAAAHEAADFGLSFGEQRL
    NVAKLNAWKDGIVKRLTGGVGSLFKANKVTHLQGQASFVDPHTVKVGDKTYTAANIIIATGSEPARLPGLDVDQQSIVDS
    TGALVVPDPIPARMLCVGGGVIGFEFAHVYNNLGSKVKVIEFLPSIIPGADADAVKEFSRAMKKQGIEIETETKANKAEK
    KADGIHVELESVKTGEKRVEVFDRVLVAVGRRPRTDGLNVQAAGVTITERGFIPADREQRTNVPHIYAIGDVAGNPMLAH
    KAMKEGLVAAEVIAGKPAAQDAVAIPGVVYTSPELAWVGLTEQEAKDKGYEVKTGTFPFSASGRAMTLQQTDGFVKMVVE
    KDTDLVLGVHIVGPHASDMLGEASLALEMAATATDIALTIHAHPTLGESVLEAAEAVHKQAIHIMNR