Deinococcus deserti VCD115 uid58615

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|226354833|ref|YP_002784573.1| putative DNA-binding protein HU Histone-like protein [Deinococcus deserti VCD115]
    MSRDSLTRAELRRYSRQLLVPEWLDAGAQERVRAASVLLVGAGGLGGPVAAQLSGAGVGRLVIADGDTVALSNLHRQTLF
    AQEDVGRAKAQVAAARVQCINPHVTVHTAEAVNAGNIGPLVAEADLVIDATDNFETRYLIADVCTRAGQRWVWGAASGTS
    GMVSVFGPELGLRDVFPDAADALS
    CDEAGVLGPLPNVVGSMMALEALKVLGGVGEPLQGRLWTLDALSGRSRVLNLQATP
    QSLSFL

    >gi|226354880|ref|YP_002784620.1| putative DSBA oxidoreductase [Deinococcus deserti VCD115]
    MDIWSDIACPWCHIGKRRLEAALERFPQRDAVQVVWHSFELDPSAPVEQPLSMPEHLARKYGRSIEDAQGMMDNMTRVAA
    TDGLEYHFERTRMTNTFLAHQLIHLASEHGLQDQMKERLLLAYLTQGEHIGEIETLVRLGQEVGLDAAEVRTALEAGTYA
    QAVRQDEAQAHALGINGVPFFVLGGKYGVSGAQDASVLLGALNQVWQETNPAPLTLLGEAGDGCEDGNCAVPDRS

    >gi|226354928|ref|YP_002784668.1| putative Thioredoxin [Deinococcus deserti VCD115]
    MSHVLQCTQCQAKNRVQAVPGGAVPVCARCGAALPWLHDGTDDSFAQDIQAGVPVLVDFWAPWCGPCRVVGPMLEQIARE
    RPGQVRIVKVNVDDNPQTPSQFQVQGIPTMIIFRNGQPVDRVVGAAGKAAIEARLFPS

    >gi|226354941|ref|YP_002784681.1| putative Rhodanese domain protein [Deinococcus deserti VCD115]
    MLTKTATQLIQEAKSRIENLSVDQVASELERGDAVLIDLREPGEQAQTGTIPGAVTAPRGMLEFYADPSSPYHRSEFDPD
    RRIILH
    CAAGGRSALAADTLRQMGYTKVAHLDGGMKAWTEAGRPVVKDHTGG

    >gi|226355067|ref|YP_002784807.1| putative Alkyl hydroperoxide reductase/ Thiol specific antioxidant [Deinococcus deserti VCD115]
    MSLLGQPAPDFTLPSSTGENITLGSYRGQKHVVLVFYPLDFSPVCSMQLPEYSGRQDDFADAGAVILGINRDSVHAHKAW
    AADYGIEVPLLADMKCDVARQYGVTVDERGVSGRAVFLIDREGVVRFEHVEAKPSEYTIRPEVVLSKITEL

    >gi|226355079|ref|YP_002784819.1| putative Lead, cadmium, zinc and mercury-transporting ATPase [Deinococcus deserti VCD115]
    MTSRTAPDSTELSYIVEGMDCASCVQKVERMVGRLPGTAEVRTSFSRQSLQLQLDESQTPRDLLETNLRALGYRPSVLTP
    AEDAQLATDSDQGQHAHALEQGAGQQAAGAGPAWYATGQGRVVVTAGTLLLLAWAGSFVAPAWSVPGYIAATLLGTWPLL
    RRAVASARLGEPFSIYTLVSLAALGAIGIGEAAEGAVVVFLFAVGELLEGLAAGRARAGIRSLAALAPRTAQLVTAEGLR
    EVPAERLRPGQTVQVNPGARVPADGTILSGRSSLDDSPVTGESVPVDKEAGDHVYAGSINTNGTLTVRVDREAADNTIAR
    IIHMVQEAEGSRSPTARFIDRFSRVYTPGVVLVSALVAVVPPLLGQAWEPWLYRGISLLLIGCPCALVLSVPAAITSGIS
    AGARRGLLIKGGAALEAIGQVRTIAFDKTGTLTVGRPRVTEVQGHGLSELEVLRLAAAVESGSSHPLARAIVEEAGSRGL
    SLPAAANSQTMPGLGVGATVEGRLITVASPRFAAQHAELPVSLAQAVARYETQGRTAVLILDNAAPVGVIGLRDEPRADA
    RPAIAALRRLGVHPVMLTGDNARAAQAIAADLGLEVHAALLPADKLRLIGELPGPVAMVGDGINDAPALARADVGIAMSG
    GTDVALETAGAALLHDRVGGVADLVSLSRATLHNIRQNIAFALGLKAIFLVTTLLGFTSLWMAVLADTGATALVTANALR
    LLRWKGGSK

    >gi|226355245|ref|YP_002784985.1| putative Peptide methionine sulfoxide reductase msrB [Deinococcus deserti VCD115]
    MSKADFRKPADAELRERLTPIQYQVTQHEGTERAYTGEYWDHTEEGIYVDVVSGEPLFSSRDKYDAGCGWPSFTRPIQNM
    SLTENTDYKIGYPRTEVRSPVADSHLGHVFPDGPQEHGGLRY
    CINSASLRFVPVGQLEAEGYADYLPLFR

    >gi|226355433|ref|YP_002785173.1| putative thioredoxin-disulfide reductase (thioredoxin reductase) [Deinococcus deserti VCD115]
    MTAHTPQTQDYDVVIVGGGPAGLTAAIYTGRASLSTVILEKGLPGGQIAQTEEVENYPGFPEPIPGMELASRMQQQAEKF
    GARIEMEEVQGITRNEHDPHYPFTVQGYGGSYRAKAVILATGANPKRLGIPGEELFWGKGVST
    CATCDGFFYRGKKVVVV
    GGGDAAVEEGLFLTKFAEEVTLIHRRDTLRANKVAQARAFSNPKMKFIWDTAVDEIQGEDHVTGVRLTNLKTGETSEMST
    DGVFIFIGHTPNTEFVKDTVKLRPDGYVDVTDEIYTSVPMLFAAGDISDYIYRQLATSVGAGTRAAMSVERSLAALEVET
    ETAAD

    >gi|226355498|ref|YP_002785238.1| putative glutaredoxin-like protein [Deinococcus deserti VCD115]
    MIKMYTTSWCPDCHVAKRALQQKGFEFEEINIENDDQAAQYVMQVNGGKRSVPTLVSGDVAHSLSGFRPQKLDAFLAAAG
    L

    >gi|226355547|ref|YP_002785287.1| hypothetical protein Deide_06780 [Deinococcus deserti VCD115]
    MTFNLECSGCVSRGIPFLKRLHSEFGGRVQLLAVHTSWGHRQLPREDVEPTLLKFSRDFARLPFPVALDLDGSFARHWNT
    EGTPHWLAFAPGGELLRSVYGSQENAQTRLQYLLQEWAGQGDGP

    >gi|226355711|ref|YP_002785451.1| putative Thiol:disulfide interchange protein DsbE (Redoxin) [Deinococcus deserti VCD115]
    MTQPAASSTNSAPVPAWKRLLPPLIAAGLVGVLGVALFRPADDATTGGPLVGKTAPDFILQSLDGPELRLSSLKGRPVVV
    NFWASW
    CVPCREEAPLFRDLSARQAPGTGLAVVGVLFQEPREDAARTFIQEYALAYPNLRDPKARTAINYGVAGIPETVF
    IDAKGVIQHVDRGGLDRARLNVGLEKIGVKGL

    >gi|226355796|ref|YP_002785536.1| putative peroxiredoxin [Deinococcus deserti VCD115]
    MSLQVGRQAPPFDVRSDDGRRVSLSAMRGQWVVLYFYPKANTPACSIEAQRFEAVLPEFERLGATVIGVSTDTEARQASF
    RDQCRLSFPLIPDGRKRLARDYGVVTGLRGLLGIASRETFLIGPEGELACHWRTVNPATHAGEVLSELERRTGAY

    >gi|226355801|ref|YP_002785541.1| putative Pyridine nucleotide-disulphide oxidoreductase, class II [Deinococcus deserti VCD115]
    MSFTDSGFDYDAVVIGAGPAGLNAAVVLGGARRRVLLLDGGPARNSRAQNAHGVFTRDCTPPGDLKEAGLADLAPYDVTV
    LSTPAREARILENGFSVRHDHKWVTASRLLFATGVRDVLPRIPGLRERWGDTVHH
    CPYCDGWPNREAHLAVLGSHQEGHH
    LALSVRAWSDRITLLTDGPDELTAEQRLDLERVGIPVIPTPVRRLTGKQNVTVHFRDGEKLPLDAIFLNPTQTQNSTLPA
    QLGCELNEKSRVVVNEHGMTSVRGIWAAGDMTGAPQYVMSAASSGMIAAISLNTTLIHENVRARGAAFHKSLDEQAGVGE
    A

    >gi|226355878|ref|YP_002785618.1| putative Coenzyme A disulfide reductase (CoA-disulfide reductase) (CoADR) [Deinococcus deserti VCD115]
    MRIVIVGGVAAGMSAASRARRQDPEAQIVVFERGDWISYGACGLPYVLGGDVKDFDALVARTPAQMRARGIGVRLGHEVT
    GVDSTAATITVQDRVSGQTLTEPYDRLLLATGVSALRPDWAQTDLSGVHFLREIPDGQAIEASLKGARRACVVGAGYIGI
    EMADALRARGLSVVLLEKAPEVAGRMLDPEYQRLVRAELEQHDVDVRCNTGVVSLTGRDGRVTGVQTEDGLVRADLVIVA
    VGIQPRTELARAAGVRLGKSGAVAVNARQETNVPGIYSAGDNTECIHRVTRRKVHIPLALSANRMGRVAGVNMAGGDARF
    PGVAGTGIFKVFELGAARTGLTQTDADTLGLNAVSVDVKSTDHAGYYRDAQPIFVRLTGERGSGRLLGAQLVGCGDSVKR
    VDVVAALLHRRASVQDLFESDLAYAPPYSGVWDVLLVAADRLSREL

    >gi|226356000|ref|YP_002785740.1| putative peroxiredoxin (bacterioferritin comigratory protein) [Deinococcus deserti VCD115]
    MTEPQRIEPGATFPEFSLPDASGKAHRLSEYAGRYVVLYTYPKDDTPGCTKEACDFRDHTLLKSLNAVILGVSRDDASSH
    AQFAEKYSLPFPLLSDPDAEFLKSIGSYGPKTLYGKVTEGVKRQTFLIGPDGRLVKSWLAVTVDGHADAVADAIREHQSK
    EPVA

    >gi|226356002|ref|YP_002785742.1| hypothetical protein Deide_10920 [Deinococcus deserti VCD115]
    MVWRSRSSGASTLGDMNRLASESSPYLLQHKDNPVNWWPWSPEAFAEARQRDLPVLLSVGYSTCHWCHVMAHESFEDEAT
    AAQMNEHFVCVKVDREERPDVDAVYMTATQAMTGQGGWPMTVFLTPDGEPFYAGTYFPPQDGYGLPSFRRLLASIANAWQ
    NDREKLTGNARALTDHIREASRPRPSQGDLPAGFLQQAPDKLRRVFDADLGGFGGAPKFPAPTLLEFLLTRPEGRDMALH
    TLRRMAAGGIYDQLGGGFHRYSVDERWLVPHFEKMLYDNAQLTRVLVQAYQHTDDEDFARLARETLTYLEREMLSPAGGF
    YSAQDADTPTDHGGVEGLTFTWTPAEIRAVLGGDSALIERVYGVTDQGNFLDPHRREYGSRNVLHLPTPLEQLARDLGED
    PQAFHSRVDQARARLLEAREQRTQPGTDDKVLTSWNGLALAAFADAARVLGEPRYLEIARQNAEFVRRELRLPDGTLRHT
    FKDGQARVEGLLEDHALYGLGLVALFQAGGDLGHLEWARELWTLVRRDFWDEDAGVFHSTGGQAEPLLSRQVQGFDSAVL
    SDNAAAALLGLWMHRYFADQEAEAIARRTVQSFRTDMQAAPSGFGGLWRAAAFLHAGHTEVAILGTAAERAPLERVAARF
    PLPFTALAFTEPGGNLPVLEGRRGGGTAYVCVNHACQLPTQAPEELARQLGSLRTE

    >gi|226356008|ref|YP_002785748.1| Peptide-methionine-(S)-S-oxide reductase (Peptide methionine sulfoxide reductase) [Deinococcus deserti VCD115]
    MRVFCRRQNAAMTDTAMQGMQQAILAGGCFWCTEAVMKDLRGVHKVESGYIGGHTARPDYRSVCSGTTGYAEAVRVTFDP
    AQVSFRDLLGLFFATHDPTTLNRQGADVGTQYRSAVFPLTPEQERETREMIADLNAQNIFEAPIVTTIEPASEFFVAEAY
    HQDYYANNPNDGYCRAVIAPKVAKLRQYYGEKLRA

    >gi|226356042|ref|YP_002785782.1| putative thiosulfate sulfurtransferase (rhodanese) [Deinococcus deserti VCD115]
    MACRLIATTRNPSPSSGWARRRSSGLRSTTVTGSGSGIHTAYPHSSGHIPTCTLRYAESMEEVTPQEGQRRVQQGALLVD
    VREQNEFDEIHAEGAQLIALSEFEARAGELPRDRELVMI
    CRSGARSARAGQFLLDQGYSSVVNLAGGTLAWVDAGLPSVR
    GK

    >gi|226356207|ref|YP_002785947.1| putative Disulphide bond formation protein DsbB (BdbC) (Disulfide oxidoreductase) (Thiol-disulfide oxidoreductase) [Deinococcus deserti VCD115]
    MLSSADNRIYAAWVVALVATLGSLYLSNVLGFKPCVLCWYQRICMYPLALWLGIAALRGDTGIRVYAWPLAAVGWIIALV
    QNAEDWGWIPTLKA
    CAPDPTTVACNIPWPLWGSGALSGLNSVITIPVLSMIAFTLILALLSWRRERFI

    >gi|226356208|ref|YP_002785948.1| putative disulfide oxidoreductase precursor, DsbA-Com1-like, DsbA family [Deinococcus deserti VCD115]
    MTRLQGSNPNRTMLVVGTLLAALLIGLALIAVRGKPAPGAGLTADFNLSTVPYAGLAEAPVSVVVVEDFKCPVCKTFEET
    IAPELTSKYVQTGKAKLYTVVWPFLAEARRLPTDDSKLAAQAARCVYDQGGNKAFGSFKSILFRAQGDEGTVWATKARLK
    ELAANVEGLDTGKFATCLDTDATASLVEAEKKMVEDARVNHTPTVFVNGKEVMNTQGQSSYLMADVSKAIEDASN

    >gi|226356239|ref|YP_002785979.1| hypothetical protein Deide_13030 [Deinococcus deserti VCD115]
    MNRISWLEVPDEHSAPEGVRKLWGKAEANLGFVPNVFRAQALNGEQFLAWWNYFNLLVNKEGQLSNTDRELLAVVVSGMN
    RCVY
    CAVSHGAALREYSADPVLADTVAINWRHANLGARERAMCAYAEKLTRTPEAMTQEDLTPLRQAGLSDPQILELVQV
    VGMFNMTNRISSALGFAPNAEYHAQARPDSQS

    >gi|226356329|ref|YP_002786069.1| putative Glutaredoxin [Deinococcus deserti VCD115]
    MQRPAVPALTLYSRLGCHLCEQAESHLKALAFTFQVVDVDTDPLLKARYGQDVPVLASGGRVLGKGAFSRSRLSQIKLLL
    LRETRTQPDSPG

    >gi|226356588|ref|YP_002786328.1| putative Osmotically-inducible protein C (OsmC-like protein) [Deinococcus deserti VCD115]
    MADISRKANAQWFGDLKSGNGTVSTESGALKDNSYSFKARFEQDKAPGTNPEELLAAAHAGCFTMQLSAMLAAHGHQPED
    LRTEATCEMVKDGPGFKVSTMRLTIRGKVGNIDQAEFEKHVAQAADA
    CPLSRVMKGNVEITHEAVLE

    >gi|226356862|ref|YP_002786602.1| putative Thioredoxin [Deinococcus deserti VCD115]
    MQDVSTAAYIRGMKPVELTDTNFTSEIEQGLTLVDFWAPWCGPCRIIAPVIEELAGQYEGRVKIGKVNVDDNPVTQGQYR
    VMSIPTLILFKDGQPVEGVVGAQPKRAFESLLDKHLGVAAN

    >gi|226356944|ref|YP_002786684.1| putative thiosulfate sulfurtransferase (Rhodanese) [Deinococcus deserti VCD115]
    MNYAKDVLVNTDWVAQNLGQEGIRLIEVDEDILLYDTGHIPGAVKLDWQTDLWHPVQRDFITAEEVSALLGRLGIKPTDQ
    IILYGDKSNWWAAYAYWFLTYSGVQNLKLMNGGRQKWMAEGRDVTTDVPTYPATEYPALQRDESLRAYRDEVRAHLESVQ
    AGQGALVDVRSPDEFSGKVTHMANYPQEGVLRGGHIPGARSIPWAKATNEDGTFKSAEELKALYEGEGVTADKDVIAY
    CR
    IAERSSHSWFVLRELLGYPKVRNYDGSWTEWGNAVGMPIEKTYSEA

    >gi|226357084|ref|YP_002786824.1| putative dihydrolipoyl dehydrogenase (E3 component of alpha-ketoacid dehydrogenase complexes) [Deinococcus deserti VCD115]
    MDSFDVLVIGGGPAGYVAAIRAAQLGFSTACVDAFERDGKASLGGTCLNVGCIPSKAMLDSSEKFEMITHEAAEHGIDVQ
    GASVDVARMLSRKAGVVDKLTGGIAYLFKKNKVKSFFGLGRLVRQDGDGWVVDAAGTEVRAKHVIVATGSNPRALPLAPF
    GGHIVENSGALAFEQVPGKLGVIGAGVIGLELGSVWRRLGAQVTVLEALPGFLMAADDAIAKEALKQFQKQGLEFHFGVS
    ITEVTQDNAGVTVTYQENGNAVTAQFDKLIVSIGRVPNTQGLGADTVGLELDERGFVKVDSHYRTNLPGIYAIGDVIGGA
    MLAHKAEEEGVALAEMIAGQAGHVNYDVIPWVIYTSPEIAWAGLTEKGAKEKGLQVKTGQFPFSANGRALGHGDTRGFVK
    VVADAQTDKLIGIHMVGGGVSELIGEVVAIMEFGGSSEDLARTVHAHPTLSEAVKEAALAADKRALHM

    >gi|226357098|ref|YP_002786838.1| putative Iron-sulfur cluster biosynthesis protein IscA, putative HesB/YadR/YfhF protein family [Deinococcus deserti VCD115]
    MTATFPTDISGEALHKDIRISEFGAQKALGILQSSGKENAGVRVFIKSGGCSGYQYGMAIDDRELEGDTIVVDRGVKLLV
    DRMSIDLLRGCEVDFVENMMGGGFTVNNPNATSSCGCGHSFRTDGAQSPDGEGSGGCGSH

    >gi|226357155|ref|YP_002786895.1| putative OsmC-like protein (Osmotically-inducible protein C-like protein) [Deinococcus deserti VCD115]
    MQIEVQVRQISPATSQATARTHQVMIDRPLEKGGEDRGMMGGEQLLVSLGGCFISNLLAAIKAREADITDVQLTVTGTLE
    SSPSRFSAIEVVVDAQAQDRALLEKLVEMSDRACIVSNTLRPAVALSFRLA

    >gi|226357316|ref|YP_002787056.1| putative dihydrolipoyl dehydrogenase (E3 component of alpha-ketoacid dehydrogenase complexes) [Deinococcus deserti VCD115]
    MTKSYDFDVLVIGAGPGGYHAAIRAAQLGLKVACAERESVGGVCLNVGCIPTKALLHAGEQVAAARHAADFGLTFSGQSL
    DIAKLNGWKDGIVKKLTGGVGALFKANKVTHLQGQASFVDDHTVQVGDKTYTAANFIIATGSEPAKLPGLEVDQQVIVDS
    TGALVVPDPVPARMLCVGGGVIGFEFAHVYTNMGSQVKVIEFLPTIIPGADADAVKAFQKSMEKQGIKVATQTKANRAEK
    KADGVHVELENVKTGEKTTEVFDRVLVAVGRRPRTDGLNAQNAGVTVTDRGFIPATTQQRTNVSHIYSIGDVASNPMLAH
    KAMKEGLVAAEVIAGKPAEQDAVAIPGVVYTSPELAWVGLTEQEAKDKGYEVKTGNFPFSASGRAMTLQQTDGFVKMVVE
    KDTDLLLGVHIVGPHASDMLGEAGLALEMAATATDIALTIHAHPTLGESVLEAAEAVHKQAIHIMNR

    >gi|226357346|ref|YP_002787086.1| putative Sulfurtransferases (Thiosulfate, 3-mercaptopyruvate) [Deinococcus deserti VCD115]
    MTAAPPGSPLTRADWLVAHLNDSRVRVLDCRYALSDPLLGRIAYLEGHVPGAVYADLETDLSGPVQPGGTGGRHPLPAPE
    VLAAWLGQAGIGNDSVVVCYDDPSGGQGFYAARAWWLLRWLGHREVSVLDGGWPAYLAAGGPVSTEDPTHPPARFIPEVQ
    ADFVASADEVAARDRATLLIDSRAASRYRGETEPLDRKAGHIPGAVNRDWSGALHPDGTFRSAGEQASRLQAGEQATITY
    CGSGVSATPNLLARELAGIPLGPHNRLYAGSWSDWVSDDSRPVATGDEDSGA

    >gi|226357427|ref|YP_002787166.1| putative dihydrolipoyl dehydrogenase [Deinococcus deserti VCD115]
    MTQNTAGPEQVHRDVIVIGAGQAGGPLAGALARSGRCVSLIERLHVGGTCVNEGCTPTKTIIASARVAHLARQAEQYGVN
    TGAVSVDFGRVQARKNAVVESFRSGSVSGLQEAGVEVIMGHARFASSHSVVVTNRAGTPQEIHAPLVFINTGTRPRWPDI
    PGLRD
    CGALDSTGLLNLGVQPEHLVILGGGYIGLEFGQVYARLGSRVTIVEQAERLAIKEDLDVVAALTDALCEDGVEFH
    FGQKAAGVRRTPAGIELTLAGPQGKQILAGSHLLVAAGRTANTDDLNLAAAGVETDDHGNIVVDEHLRTNVDGIYALGDV
    KGGPAFTHISYDDFRIVRDALLHGRHRSVHDRLVPYTVFTDPQLARVGLNETQAREKGLRAQVYTLPMSRVARAIETGEI
    RGLMKAIVDEETDLILGATVLGVDGGEVLSVLQMAMMGGVSASAVRDGVFSHPTLSESLNNLFMGTPVSVEPEQAAR

    >gi|226357527|ref|YP_002787267.1| putative rhodanese domain protein [Deinococcus deserti VCD115]
    MQPWSMPTLGINWSRRGSLFSSFDGISGALPPVSWAPGCLPGTYWRINMKRLTPKELNTLNSSRKAPVTVDVRSSEEFEA
    GHVDGALNIPITDLPQRLGELPKDRPVVTY
    CNMFHPGASRGEKAAAQLLELGFDAGVLEGGYPAWKDAGAADPAPENK

    >gi|226357634|ref|YP_002787374.1| putative copper-exporting ATPase; putative membrane protein [Deinococcus deserti VCD115]
    MTKTVELGVQGMTCASCVGRVERGLSKVEGVDQATVNLATERATVSYDPEKTSPQALMDKVRAIGYEPVVGTLELGVQGM
    T
    CANCVGRVERTLKKVDGVLEANVNLATERASIRYLPASVSPGQLKAAVRASGYEILENEAGKDRTDQEREVREREVQGL
    RRAVIFSAVFAVPLLLLAMVPMLYMPFHMWLTGYVDMGTLNWIMLALAAPVQFGPGLRFYRLGWKSLTHRSPDMNSLVMI
    GTSAAFFYSLLVTVAPQIFPEGTAHVYYEASAVVITLILLGKYFEAIAKGRSSEAMKKLLSLQPKTARVVRQGQEHEVPT
    DEVLIGDLLAVRPGEKIPVDGEVTGGNSFVDESMITGEPVPVNKQAGSSVVGGTINQNGALTFKATRVGADTALAQIIKL
    VETAQGSKPPIQGLADKVVSVFVPVVLGIAALTFVLWMIFGGQTALSFALVNTVAVLIIACPCAMGLATPTSIMVGTGKA
    AELGVLFRNGSALEGLQGVQVVAVDKTGTLTRGRPELTDLVTTPAFDRQQVLGLVAAAEAQSEHPIAQAIVEAARREGIT
    PLTTDHFEAVPGFGLEARVAGHLVQIGADRYMTRLGLDTGAFTAQAHQLGDEGKSPMYAAIDGQLAAIIAVADPIKEGSF
    EAVRALHRQGLKVAMITGDNGRTAHAIARQLGIDEVLAEVLPSGKSDAVKALQAQGHKVAFVGDGINDAPALAQADVGLA
    IGTGTDVAVETADVILMSGDLRGVPNAYALSRATLRNIRLNLFWAFAYNVILIPVAAGVLYPTFGWLLSPVLAAAAMGFS
    SVFVLTNALRLRGFRPPVRPDHVPAHTPASSPLHA

    >gi|226357635|ref|YP_002787375.1| hypothetical protein Deide_1p01705 [Deinococcus deserti VCD115]
    MTTELIVSGMTCGHCETAVKNALKDVPGVQDVRVDLKGGTAAVEGDVDAQALIAAVTEEGYGAQVCQ

    >gi|226357832|ref|YP_002787572.1| putative thiosulfate sulfurtransferase (Rhodanese) [Deinococcus deserti VCD115]
    MTNSTAPTPYARDVLVSTAWVAQHLGDPTVRLIEVNEDILLYDTGHLPGALKIDWQIDFWHPVMRDFITPKEVSALLGRL
    GIREYDQIILYGDKSNWWAAYAFWFLSYSGVQNLKLMDGGRQKWMAEGREVTTDVPEVRPTVYPALQCDESIRAYREDVL
    AHLDGVQAGRGALLDIRSPDEFSGKVTHMANYPQEGVLRGGHIPGARNVPWAKAANEDGTFKSVEELRALYEGEGVTPDK
    DVIAY
    CRIAERSSHSWFALTQLLGYPRVRNYDGSWTEWGNAVGLPIEKTYVPE

    >gi|226357838|ref|YP_002787578.1| putative thiosulfate sulfurtransferase (Rhodanese) [Deinococcus deserti VCD115]
    MPGAVQLDCRADLWDPVIRDFVSPEAFAALMGRLGITPDTTVVLYGDKSNWWATYAFWVLRYCGHERVRLVNGGRQKLMT
    DGFDLTDEIPDVQPCTYPVQERNEQLRIYRDEVQHHIHAVRAGRGALVDVRSPDEYAGHVTHMPEYPQEGVLRGGHIPGA
    VNLPWAMAVKHDGTFKAADQLRRMYEKADVTPDRMVVTY
    CRIAERSSHTWFVLTQLLGYPDVRNYDGSWTEWGNAVGVPI
    ETAPR

    >gi|226358061|ref|YP_002787800.1| putative Thiol-disulfide oxidoreductases ResA/TlpA/DsbE (Cytochrome c biogenesis protein CcmG), precursor [Deinococcus deserti VCD115]
    MRLLRIKGRTIQKQLTLLLFLITSLASAVRPGDVAPDFTLNDPSGKKVTLSALRGQPVVLTFWATWCLVCKEELPELNQE
    AARAKVKNMFAVSATDTPKAALDYFKQAKLGAITPLVDAPKAKGPGTGAGVAKSYRIIGQPVSVFIDSKGKVTAVHSGYL
    PPEQFRVYLKQIRP