Dehalogenimonas lykanthroporepellens BL DC 9 uid48131

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|300087270|ref|YP_003757792.1| methionine sulfoxide reductase B [Dehalogenimonas lykanthroporepellens BL-DC-9]
    MTWNELTPEEEAVIVRKGTQPPFSGEYENTTAAGTYVCRRCNRALYASASKFHSGCGWPAFDDEIPDSVKRVPDADGRRT
    EIVCATCGGHLGHVFTGEGFTPKDTRH
    CVNSLSLKFIPD

    >gi|300087365|ref|YP_003757887.1| hypothetical protein Dehly_0239 [Dehalogenimonas lykanthroporepellens BL-DC-9]
    MANHLKDAVSPYLRQHADNPVEWYPWADEALARAKKENKPILLSVGYSACHWCHVMAHESFEDEATAAVMNRHFINIKVD
    REERPDIDSIYMAAVQAMTGHGGWPMTVFLTPDGKPFYGGTYYPPEDRHGLPAFTRILEAVAEAYRERPDEVAATATRLV
    TAVADKPVGDAGESSLTVELLDRAFQALTRDFDENHAGFGGAPKFPQPLVLDFLLRYHYRTSSARALEMVEKTLEAMYRG
    GMYDHLGGGFHRYSVDDAWQVPHFEKMLYDNALLARVYLHAFQITGKAQYRLVTEDILDYVLEEMTDPATSGFYSAQDAD
    SEGEEGRYYIWTPDEIESVLGRESAEIFGRRYGVTQAGNFEGRNILHLTGEFSVEASAGVSADRARLLAERRKRVPPGTD
    TKILVSWNAMTQLALASAGVALDRPDYLAAAEANAAFLLDNLLDSGRLRHTVSVAEGFLEDYALLTESLLALHKATLTPR
    WLRQAMALGAAMVELFWDEDEGVFYDTPADAGQLFQRPRNFQDGAVPSGASVASLALLRLSRLADERSYWQTAGRALKGV
    SSFMGRYPLGFGLWLGALDFYLGPQQEVAVIGPAADDASRRLVAVVGRAFRPNTVLAGLDAGDSEGIASLPLFQGRGQTA
    GQPTAWVCRSFTCYPPVTAPVDLEQVLEL

    >gi|300087367|ref|YP_003757889.1| glutaredoxin [Dehalogenimonas lykanthroporepellens BL-DC-9]
    MKVTVYTTQTCPHCHTVKGFLSQQGVPFTEIDVARDQDAARDLVARTGQMAVPVTDIDGHLVIGFDRRQLEYHIAQARSA
    APRFGASVADGEKHTGQPGAFVGAVRAGQPAALAGLKPGDVITAIDAVSIGNSADLTRALSGLQQGARVRISFIRDGQSR
    QAEGRL

    >gi|300087621|ref|YP_003758143.1| glutaredoxin [Dehalogenimonas lykanthroporepellens BL-DC-9]
    MTEQEIIMYGTAWCPDCHRAKRVFESKGVAYRWVDIGQSAEAAAEVERLNKGYRSVPTIVFPDGAILVEPSNPELETKLS
    G

    >gi|300087730|ref|YP_003758252.1| FAD-dependent pyridine nucleotide-disulfide oxidoreductase [Dehalogenimonas lykanthroporepellens BL-DC-9]
    MNNNEACYDIIIIGGGIAGLASASFANGLGKKVLLVEKERIGGSCTLKTCMPTKSLIRSSVLANSLKRAKDYGLVYELSG
    YSGDQVFPYIRNVIEEVNKIDSPESFNSIGIDTILGPAEFLNQRQIKVGDRIYTSKKFIIATGSKQAKINITGAEHSNVL
    SIDGLFKLSKLPASMIVIGGGPAGVELGLALRLLGLEVTILEASKDILNREDQEIVVKFQEYVTRLGMEVVTGCKISHIE
    CADNQVKVIAVDQTDKATHTYIAEKALITIGRTPDIESLNLENAGVKYSVRGITVNPSLRTSRRNIFAAGDVTGMTFNAS
    MVERQALIAAGNALVPVINPERKLGEVVSVIYTEPPMARFGMTEKEAENRYGKNKITVYRYDYSRLRRAKMERQAFGLAK
    IICRNNGKIIGAHLWGERSEELIHELFLLSVTGKPLKYLHGISHAYPTYGEGVLKRLGDMAYVDYMAGNPFVRIGLKLLP
    GFENKLSLIKDKL

    >gi|300087744|ref|YP_003758266.1| thioredoxin reductase [Dehalogenimonas lykanthroporepellens BL-DC-9]
    MPTQLPYDIIIIGGGPAGLTAGLYTSRAKLKTAIIEGSAIGGRMAEAWEIENYPGFVEVINGYDLTQRMHEQTNKFGVEH
    IQTGVNGIEDKGSYKVVKTRLGDYQAKALIIAGGSERRKLGVPGEKELVGRGVSF
    CATCDGPFFRNKIVAVIGGGNGALN
    EAVHLTHFAERVFIIHRRDSLRATPVLQEKAKSDPKISFIWNTDVVAIEGKDSVERLKLINTKTGDESILEVGGIFVAVG
    LIPNTDYLKGVVDLDRNGAVVTNVRMETSVSGIYAAGDVRADSARQVVSAAGDGATAASYAQNYLSGIKTQQ

    >gi|300087813|ref|YP_003758335.1| FAD-dependent pyridine nucleotide-disulfide oxidoreductase [Dehalogenimonas lykanthroporepellens BL-DC-9]
    MSSTEIRTGVYVCHCGLNIAGTVDVEELTEYGANLPDVVICRSNKYTCSDAGQTSIQNDISEHRLNRIVIAACSPSMHEK
    TYRRMMTASELNPYLLEIANIREQCAWVNPDRLKATSKSKDLLRAAVVKVGSDVALEPEMIPVNPVTLVVGGGIAGITAA
    LEIAEADHQVILVEKEPGIGGHMAQLDKTFPTLDCAA
    CISTPKMSQIGQHPNVRLLTHSQVTNVTGHPGSFKVTIEKKPR
    YVKESDCKGCGDCATACPVIVPSEFDLGLGKRKAVYRQFPQSVPNVYTIDRRGISPCRSACPAGVNAQGYIALISQGKFT
    EALEIVRRTMPLSSVCGRVCHSPCEDNCARIQFDQAVAIRALKRFVADQELSTSLNDSNSSEPMSTDRIAIVGSGPAGLS
    CASDLADAGYQITVFEAADKPGGLLRYGIPAYRLPEAALDRDIAYIADKGIQIKTCSPVTSVTELEEQGFKAVFIAVGAW
    QNIKLDIQGEHADGVMFALDFLKQVRQGTPPAIGAKVGVIGGGNAAIDAARSAIRLGATTVRVIYRRTRAEMPAIEAEIV
    AAENEGVLFTFLSSPIEVLTAKSRATGLRCLRNTLGAPDKTGRAGISTVPDSEYDIELDTVIVAVGQAPDKLNFSEIARR
    NNGTIEVDDVTLETKNPGVFAGGDTVTGPSNVIEAVAAGKKAAESIKRFLQGNDMTTGRNVNPVTTTYQGMKPRHSARAT
    VSHDIDLSNKFGEAEGPLTPEQAISEASRCLNCAVCSDCRQCVKVCEPGCIDFDQVAETIEITAGNIIVATGYDVFNPTP
    LSRYGYGKLDDIYTSLEFERLANASGPTNGRILLKNGNNPQSVAFVHCVGSRDKNYQDYCSQICCMYSLKHAHLVKERTG
    ADVYQMYIDIRCVGKGYEEFYHRVAEEGINLIRGKVAEITEQTTGDEEQGQMIIIVEDTLSGQVLRIPVDMVVLAGAMIP
    QSDSSSTARLFGLSRSQDGFLLEQHPKMGPISTMNEGVYIAGCAQGPKDIPHTVVQAQAAAGRVLATIARGYLTQEPFIS
    QVVDENCDGCAYCVDPCPYDAISLIEYRKNGETKKTVEADPMRCHGCGVCMATCPKQGITVRNFGTAQLGAMVDAIISA

    >gi|300087814|ref|YP_003758336.1| thioredoxin [Dehalogenimonas lykanthroporepellens BL-DC-9]
    MPIEISDDTFESEVIKSELPVLVDFWAPWCGPCRMVAPVVDKLEEKHQGKFKFCKINVDDNQKTAGQFRVMSIPTLMFFK
    DGEVQETVVGAVPESSLQEKIDKLI

    >gi|300087828|ref|YP_003758350.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Dehalogenimonas lykanthroporepellens BL-DC-9]
    MHIGRIMLTIILFSLLTLTFTGCNDGLIGSEAPKFTLPDTQGKQVSSSLPDATPTLLNFWQMNCPECIEEMPYIQALHQN
    SEKNIRILAVNLGDSTASVSSFMNDNGYSFQVLFDNFGVVAGHYGIRFTPTSYLVDTNGRIADVRIGPFADMDDLYQFIE


    >gi|300087835|ref|YP_003758357.1| FAD-dependent pyridine nucleotide-disulfide oxidoreductase [Dehalogenimonas lykanthroporepellens BL-DC-9]
    MGENKIGAALVIGGGVGGMQTALDLAEAGIKVYLLEEAPAIGGKMVQLDKTFPTNDCAMCTVSPRLVNIDRHLNIELITN
    SKFISYEGKAGNFKVRIKKKARCVDESKCTGCNVCIEKCPAKTESEFDRGLAKRKAIYTLYSQAVPNVPVIDKDNCIFFK
    KGKGCRACEMFCEANAVLLDQQDEEIEINVGAVVMAPGYDLFDANEKPQLGYGRYPDVLTSLQFERMLSASGPSAGKVAR
    PSNGQLPKKVAFIQCVGSREISADFCSAVCCMYATKEALILKEHHPEIEVTIFYIDIRAYGKGFESYYERAKKAGVRYVR
    CQPSSLKQIPANSDIIVRYQDEQGRMMDETFEMVMLSCGLRPSVAGQELAGKLGVKTTPDGFCATEGMDPVATNVEGVYA
    VGTFTSPKDIPDTVVQAGAAASRVLALLADERGQLVKERTYPEERPIGEEIRTGVFVCHCGKNISSVVDIPTVVEDARNL
    ENVAFVDDTLFACASDAGEKIKQAIINNGLNRVVIAACTPRTHEGLFQDTMREAGLNPYLMEIANIRNQCSWVHMNQPEE
    ATSKAKDIVRLAVVKVSHLKPLYPGNMSVCNEGLVIGGGLAGMTAALDLADAGFGTHLMEITDELGGNLRRVKFGRSGED
    PQTKLNELMARVKVHPGITLHLNTEVTSFEGSAGNFVIEYTEDGQTGKLKVGAVIVATGANEYRPVEYLYGKDERVVTQL
    ELESLVSENRVQARTIVMVQCVGSRDEKHPYCSRLCCIQAIKNSIKLKARYPETDVFILYRDIRAYSLHEAEYSRARKLG
    VRFIRYEEGQNPEVAVEKDSLKVSVIDQVLKAKINIPADLVVLSTGVVPGEDQKLAKLMKVPFSDDGFLMEAHIKLRPVD
    SPVEGVFLAGLAHSPKLAEESIAQAGAAAAKAAAILSKDSIRLEACVSEVLDENCDGCAYCVDPCPYDAISLLEYNFKGG
    LKKTVEADPAKCHGCGVCMATCPKKGIMVKNFYLDELSEMVATIMNPV

    >gi|300087949|ref|YP_003758471.1| FAD-dependent pyridine nucleotide-disulfide oxidoreductase [Dehalogenimonas lykanthroporepellens BL-DC-9]
    MENVELLVIGGGTAGETAAMTAAGRVESIAVIEQEKVGGDCIYNACIPTKALVHSARVHKKRLSAGFFGLPDCDTRVDYR
    RVKEAKDAIIDGIAKDRDSKLEAKGIRLFRGQARFRNSHEVTVGDTLISADRIIIATGSAPAIPPIPGLDEAGYITNVEA
    LRMTEVPARLAIIGGGAVSVEFAQIFNAFGAHVTIFEAAERILPVEDEEISSEAKKLYQQAGMEVLTSVKIEGVKKTGRS
    RSITGKKADGETFSLGFDEILVATGRRPVLDGLNLKDAGVDFTRKGIIVDDTLKTSVSHIRAAGDITGIALFTFVAWQQG
    ALAVNNMLNETAVGLDYSVLPHATFSDPEIAGVGLTEAEARAKGYRVKTGKFAFADITRAIVADETAGFIKVVTDTDSGL
    ILGGHIIGTEASSLIHELAAAMAGGVTARKIADTFHAFPTLSEGVRYACQATLQS

    >gi|300087953|ref|YP_003758475.1| peptide methionine sulfoxide reductase [Dehalogenimonas lykanthroporepellens BL-DC-9]
    MEKIILGGGCFWCLEEIFRRVPGVAAVTPGYAGGTLAQPTYEKVCSGTTGHAEVVEVEYDPSVIDTTKIIDYFFAAHDPT
    TPNRQGMDTGSQYRSIILYTSEGQKETLENILNSASFQKQWPQPVVTEVKRLEKFYPAEDYHRNYYMRHAEQPYCRVVIA
    PKLTKLFNDK

    >gi|300087987|ref|YP_003758509.1| FAD-dependent pyridine nucleotide-disulfide oxidoreductase [Dehalogenimonas lykanthroporepellens BL-DC-9]
    MKHYDVIVIGSGAGLDVLDNAVELGLKAALVDRGPVGGTCLNVGCIPSKMLIFPADRIMEIREAARLGVEGRVESIDFPA
    IMKRMRQVVHEDSSGIRRYLESSDALDFYDGTGEFIAPYTLRVGSTEIKAEKIFIAAGTRPAVPPIQGLNNVDYLTNETL
    LELEERPDSLVIIGGGYIGVEFAHFFEAMGTRVTLLEMRSDILTGEEPEIIETVTRALRRRMEVITGARVTDVASAGDQL
    GFIVNYERAGGSGADSVRAQKLLVATGRIPNTDLLKVKQSGIETDEPGFIKVNEHLETGVKGIYAFGDINGREQFTHTAH
    AEAAVAAANGLHGHQAVMDYQSSPHAVFTHPQIGSVGLTEATARKNHTKIMVGRADYKDTALGTAMMDDDGFAKIILEQD
    TGKILGAHIVGPWSSVLVQEVVNAMANEGGIDHIASGIHIHPALSELVLKALSNAVPE

    >gi|300088101|ref|YP_003758623.1| rhodanese domain-containing protein [Dehalogenimonas lykanthroporepellens BL-DC-9]
    MFKKTLLITLATILAMIPLACSSEPAVEGQIILDLSPAEARTMIQENLGQTDFVLLDVRTPSEFAAGHIEGAVLLDFNSG
    NFQAEAEKLDKNKRYLVY
    CRTSNRSGQAVNLMKNLGFMEVYDLDGGIVAWEAAGYPVVR

    >gi|300088130|ref|YP_003758652.1| glutaredoxin [Dehalogenimonas lykanthroporepellens BL-DC-9]
    MTKVKVAGTDKGDIMLYALSTCVWCGKTKKLLDELGVAYAYEDVDLLKGEERSAAVKEITAWNPAASFPTLVINNEKSIV
    GFKEAEIRQALA

    >gi|300088296|ref|YP_003758818.1| heavy metal transport/detoxification protein [Dehalogenimonas lykanthroporepellens BL-DC-9]
    MTMTTLTVKGMSCGNCVRHVEGALRKLPGVATVTVDLAAGQATVEYNPEEANITLLKQAVADAGYEAAVNGE

    >gi|300088297|ref|YP_003758819.1| heavy metal translocating P-type ATPase [Dehalogenimonas lykanthroporepellens BL-DC-9]
    MSTEAPGITLNMFIGGMTCAACVRHVESALQSVPGTADVIVNLALGKATLNFDPKQAALADLKRAVEEGGYSATFDTARL
    SLSGLT
    CAACVAAVERAVGALPGVAGITVNLSAGSAQLEYAPPLTSLKEVIAVIRELGYEAAEKIEGQAALDREQQARER
    EISRQKKNLIISWTLGMLVMVGMFQPYWILPNFVPEWMNNKVFLFFLTTPIVFGPGRQFFVNSWHGLKRGLTDMNLLYAT
    GIGAAYLIAVINTFFPEAGFGGPEATFYEAAALLTAFIILGRYLEAVTRGRTSESIRRLMKLQPRLARVIRNGQEQEIPV
    DAVVAGDIIAVRPGEAVPVDGVVRDGYSAVDQAMITGESLPVEKQVGDEVIGGTINKTGAFRFEATRVGGDTALAQIIKL
    VEDAQTTRAPIQKLADRVAGHFIMGVHIIALLVFLFWFFFGYDMWFTPETRLILTPYTLHDLGVFGFALLTSVTVLVISC
    PCALGLATPSAVMAGSGKGAEYGILFKGADAMENTARLNAVVLDKTGTLTRGEPSVTDVVAADGFDRDTVLSLASAVERQ
    SEHPLGEAIVKAASHLPATAEAVEFQAVPGHGVAATVAGQRVLLGNRKLMQERNIDITMVEPSAERLETEGKTAMFVAAD
    NRTAGVIAVADTLKETSARAVGELKKLGLQVMMITGDNRRTAEAIGRQAGIDRILAEVLPEDKAGEVRKLQTAGFKVAMV
    GDGINDAPALAQADVGIAIGSGTDVAKETGHVILVRDDILDVAAALQVGRRTLGLIKQNLFWAFGYNTLAIPLGMGLLYP
    FTGQMVSPELAALLMATSSLSVTLNTLRMRGFVPEVRRTADEKGVTA

    >gi|300088426|ref|YP_003758948.1| AhpD family alkylhydroperoxidase-like protein [Dehalogenimonas lykanthroporepellens BL-DC-9]
    MIDNLNQEQSESRVEAGPLLEEIRQALGMVPNFFQAQADADPAWLELNWKREKAIMLAPGALDRKTRELIALTVSLTNRC
    QY
    CSLAHETMALMTGATREEIIELKKVVELFSSFNAIADSLQVPCDVTPSMLDGR

    >gi|300088509|ref|YP_003759031.1| methyltransferase type 11 [Dehalogenimonas lykanthroporepellens BL-DC-9]
    MKDTEIKSYVKERYGAVARGSECGCGSGCCGAASPDRVASVIGYSDEELAGVPDGANLGLGCGNPTAIAELVPGETVLDL
    GSGAGFDAFLAARQVGPAGKVIGVDMTPDMLSRARDNAARSGFTNVEFRQGEIEDLPVASGTIDTVISNCVINLSPDKPA
    VFAEAFRVLKPGGRLAVSDIVLTEPLPDYVRDSMAAYTA
    CVAGAVLKEEYLGAMKDAGFEKIEVRGESVFDLDFIDMAPE
    LMKSAASPGLTEEKIQDISETIVSVKVTAVKPIK

    >gi|300088562|ref|YP_003759084.1| DSBA oxidoreductase [Dehalogenimonas lykanthroporepellens BL-DC-9]
    MTIKLTIFSDYICPFCYIGKGLVERLRDEFTIEDTWLGFEIHPETPADGADLSGRYDPADMAQMKAMLQNRAEELGLPYQ
    PAPILANSALALAGAEFARDEGRFEDFHREMLEAVFSRGQNIGLREVIADIAVRAGLDGSAMLQAIDEKRYDQRLRQSQE
    LGQQLQVSGVPTFIVNDRYAIVGAQPEQTFRDIFRRVEEEAGAGDSGT

    >gi|300088677|ref|YP_003759199.1| redox-active disulfide protein 2 [Dehalogenimonas lykanthroporepellens BL-DC-9]
    MKIKILGTGCAKCNQLESLTREAVQELGLEADIEKVKDIERIMEYPVMLTPALVVNEKLVLSGKVPSKADLVEVIAKAVG
    RKT

    >gi|300088790|ref|YP_003759312.1| methylated-DNA/protein-cysteine methyltransferase [Dehalogenimonas lykanthroporepellens BL-DC-9]
    MKNRNPDSRFDVIETAAGWTGVEVTEKGVRRLTLPAENRQAAIEALGIEEKDITHEAGGAGLVDRLKHFFLGEPVVFREG
    LDLSEATDFQREVYSAACRIPHGQTASYGELAKVIGRPGAARAVGRALGANPVPVIIP
    CHRVVGADGSLTGFTGGLETKR
    KLLELEKKNRP