Akkermansia muciniphila ATCC BAA 835 uid58985

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|187734577|ref|YP_001876689.1| Rhodanese domain protein [Akkermansia muciniphila ATCC BAA-835]
    MVTGLTALFVWLKGRNAERDPASSAMVVSPEGAAARPVVLVDVRTLDEYRTGHKEGALNIPADEVEQLAPRLLPDKNAVI
    MLY
    CRTGKRADKALEALRKMGYSHVENLHRFEM

    >gi|187734660|ref|YP_001876772.1| Thioredoxin domain [Akkermansia muciniphila ATCC BAA-835]
    MIKQILPIVVAACVAPCFAAEGWITDMDAAKKQAAEQKKDLMIEFTGSDWCPPCMQLRANVFSKPDFQKEAQKNFVLVEL
    DYPRGKEQSKEMKAANEKLAQQYGVRGFPTVVFADASGKPFGGFVGGRSGDDVMKAMQDALKNKEALNAAEANVAKAATD
    EAKVAALMEVLKLAPQEYVDNFYGDVKAEIKKLDKDDKSGLKAADALSDQLKKERKDVRNYLAGKLTDKTTPAEALQVVK
    AYPDRDKLLPETQQELLMMEFGTYLNSTGDVDGAVLILDKVAELKPGTEAGMQAPRIKAGILANKDKIKAQIDAAKKAQG
    K

    >gi|187734704|ref|YP_001876816.1| hypothetical protein Amuc_0191 [Akkermansia muciniphila ATCC BAA-835]
    MTTRLVILSGLLLCGSLASGKNELSFKETVVPVKVAPDQDSITASFPFTNTSGTPVTISKIHVSCDCTTAGAKDNKLTYA
    PGESGVISAVMKTGNFSGTVDKDMTVHANGSAYKLVIRAQIPDIIRMEPRKLEWARGEAAVPKTIKITISKELPVNLTTV
    DLTGDAFDYEPVTVKKGREYKIIVTPKSTARPAFNTIWVRTDSAVPRYKRQMGFLAIKEN

    >gi|187734749|ref|YP_001876861.1| arsenate reductase and related [Akkermansia muciniphila ATCC BAA-835]
    MSSLFIEYPKCTTCQKAKKWLDEQGISYEDRHIVEQNPTAEELRSWIEGSGLPAKKFFNTSGLLYKSMKLKDQLADMSLD
    EQIALLASNGMLVKRPIFITNGKICVGFKADEWKAAHRS

    >gi|187734772|ref|YP_001876884.1| Redoxin domain protein [Akkermansia muciniphila ATCC BAA-835]
    MLNSSLLVLGCSMIFAVSAGMPLHAASSEKKENKTVASEDALPSLALDGLPDVWIQGTPVKEWEKDKVYIFEFWATWCGP
    CLAAMPHMEQLHQAFKNNPHMQVIGVNVMDRKSPESLKEFLKNRPSPLTYAMAVDVDGKKTRDKWLSPMGVNGIPHAFAV
    KNGKLIWRGHPGKLSEEMMRAMLKPDFSAASLPGDNPGANARAWKLYRQVSERTGELARKGGKGEAQAFLRQIQDSGQFQ
    QDQIIQLKMVPFRVLAELEKFQEAQAVLDDLCKEYPDNYRVQIDVAGTLLNGKSVPAGKMDAALVERCLNRCIEISRRNN
    KEASLPWKLMAELRERQGNMEEALQDMEKALSLTSISKAWTKLQQLSGNKESFQNLVNQAVAEIKPEPPRKMQEMGVVQE
    DKQYTPLFSKLKWFNHPGLTGLPVGKTVFISFWRGHNNILGETAPGRALDAVLKKHGLLDHPGVKAVVLGLNPSAEKQMR
    DYLSGPEGWTPYPVGIPSDRSVIEFCDLLKLDSFPAAVVVRDGTLLWAGEIKKMPEWVAETARLDSFDKNRFAEEDAKRK
    ARQQAMYAVIKKSFELRREKKFDEYQKLIEENAGQFSDNGWFASTVAEVRAEKAWKEKNYRKMVDIFDHVLERFPREDSL
    ASYILKILNGSEEMRKYSYKAARRALQIMRDSNTKDDGGYNAACYEVMMNMAMEKKDYDQARKDAANALRELPLVHQYAV
    MKKKSGGGKK

    >gi|187734850|ref|YP_001876962.1| OsmC family protein [Akkermansia muciniphila ATCC BAA-835]
    MVKTKTTYEGGLHCSMVHEPSGATLSTDAPVDNNGKGESFSPTDLVGAALAGCMSTIMGIVAERKGINLEGMTVEVAKHM
    NADPRRIGKLEVVITVPLPSDYPDRKLLEQAALS
    CPVKHSLHPDIEIPITWKWVG

    >gi|187734851|ref|YP_001876963.1| Thiol:disulfide interchange protein-like protein [Akkermansia muciniphila ATCC BAA-835]
    MVTAFAMRNFLKAAVGCLGMIAGCFSTGEAQDFGGMSFGEAGNFGPPQTSGSSKATVTSYGEASFVIVTELALPDHWHVY
    YKNPGTVGLPMEAALQPVPGFRVEGPFWQIPELEKGLVDFYGYSGKAKMAFRVTPEKDAPPEATFITTMTWQMCAEQCAA
    PETKNFSVTLKRGDGQTAPDAAELTGNMAGLAAPDWAEGLKARISQEGKTVTLHLRTNGRPVPQDSVYFFCNQGEINPTT
    PQIFKKLDDSNYELSMQFNDTTDGLYPNNLPDADRGKPLTSLSGILRAGREGIIITADDRPFSGESQSTAAGTESAPEPS
    ASIPAPPLMGLGEIMFFMFIGGIILNVMPCVFPVIGLKIMGFVQLGGGERKKVLAHSLTFVLGILISFWLITAILIALKA
    NMFDWSAPAGPGVFSGDFWLGRGAEGVVNWAFWFENPWVNFCLLGLMLAMGLSMFGVFEIGVKATTMGNDLQHRKGYAGS
    FWSGALATVISTPCSAPFLGQAIGAAMLQPPLGIVLCLTMMGLGMSLPYIILGAFPVLTRYLPKPGAWMESFKQSMSFLM
    FGTAAYFLWIYMAFFDAENHPQDILFLFFGLVLFSMAFWVYGRWCPMYRSRKSRITGGIFSVIFLLAGLYYMLPPEGAAW
    FGRGSAPGAAESAAAAPSLQEEGNIWIPWSPEAMQAALDGGKPVYVDFTARW
    CSTCQVNKASYTDEVLAAFKKYGIVMMK
    ADKTRTNPAIDQELKNLGRTAVPVNALYLPGRKPAVTRELLSPAYLLEFLEKEMER

    >gi|187734886|ref|YP_001876998.1| Redoxin domain protein [Akkermansia muciniphila ATCC BAA-835]
    MMGSSLCWADSSGVADDPSLRTWTNKNTGSTVEARPVALNMKTVKLVTTAKKPITMPLEKLSDEDRAWLEEHKEVIGKPI
    AEWSSMPSGPVAEEMKGKTYMLENGKLKKRDGKLNPKHFILYFSASW
    CGPCCRNAPHSVEAYNRVVKDNPDVEVIMCNLD
    QNLDAAQKWAAANNMPWPILLKEDLTELAKKVAPRGIPTMILVDKDGKPIQSSQNMEQLVKAIGSSRSSR

    >gi|187735197|ref|YP_001877309.1| thioredoxin [Akkermansia muciniphila ATCC BAA-835]
    MANVFSEANFEDEVLKSDIPVLVDFWATWCGPCRMIAPIIDQLSTELAGKIKVGKVDVDANNGLAATYGVRTIPTLLIIK
    DGEIMDTMVGASSKDAIMQRLRPFM

    >gi|187735231|ref|YP_001877343.1| methylated-DNA/protein-cysteine methyltransferase [Akkermansia muciniphila ATCC BAA-835]
    MKTTFPPHGRALLHQMPAGAVVIVENGTAVTHLFFSRMAQPEHLEWEETPLLRQTADQLDEYFQGSRRVFDVPLSPQGTE
    FERTVWKALQAIPYGETRSYGDIARRIGRPSACRAVGQANNRNPVGIIIP
    CHRVIGADGKLTGYASGLTIKQYLLELEQG
    SATPFTLFTDVERMPGNTPASP

    >gi|187735378|ref|YP_001877490.1| heavy metal translocating P-type ATPase [Akkermansia muciniphila ATCC BAA-835]
    MEEKNYLVSGMHCAGCAAKVERAVEGLEGVERVELNLLTGKMTVLFEKPDSPAMERIAPVVEKAGFRLADWKEEPLAGTE
    REERLEQEETGGSRLVWSILLLVPLMYLSMGPMWHWPVPEGSWGLWMNWWTQGILAGAVLWLNRHYLINGVRQLVALSPN
    MDSLIAIGSGSAFLYGLYLLVAGMWQGFSVEGMELYFESAAMIVTLISLGKYLERRSYRKTNAAVKGLVKLVPQEALVWH
    DGAERAVPLDEIRSGDLVVVKTGQRIPVDGMIEEGQAALDESDLTGESMPVDRAAGDRVISGTFNRAGYLKIRAERVGGD
    STLARMIRLVEQASQSKAPIARLADRVCYFFVPAVIAVALVSLVGWMAAGEGFSFALARAIAVLVISCPCVLGLATPIAI
    MVGTGRGARLGILCKSAGALEALSRVDTVVFDKTGTLTEGEPRVVAVLPEEGMDADALVEMAAALEQGSEHPVGKAVYEH
    ARLLNLPVRAVADLSVVPGRGIAGTVDGVPYAVGNSGFMQDKGISWKEDESRLREFMRQGASPLYVGRGGCPAGVIMVAD
    SLKPDSRAAVDSLKRMNLRVVMLTGDNAATARHMAGELHIDEVVSDVLPDEKASHVMKMEERGDKVAMVGDGVNDAPALA
    CARVGISMKSGTELAMESSDIVLMKSNPAGVAEAVQLGRTTLLIIRQNLFWAFFYNIIGIPLAAGCLYPAFGLTLNPMIA
    AGAMSLSSLCVVFNSLRLRGFTPRLGGLGK

    >gi|187735407|ref|YP_001877519.1| methionine-R-sulfoxide reductase [Akkermansia muciniphila ATCC BAA-835]
    MKRIYHGPWTLAGLACAILAAVAMLSFFSCGEKGQSSSNDKPHMDNKDLKTIYLAGGCFWGVEKYFSLMPGVKETEAGYA
    NGSTASPTYEEVCSGKTGHAETVKVVFDPEELSLPFLLERYYSIIDPVSVNKQGNDRGIQYRTGIYYADEKDKPVIETSL
    KRLQQHFRQPLAIEVQPLRQFSRAEKYHQRYLDKNPGGYCHIPPAKFREASQARENEPVYRKKSDEELRRVLTREQFAVT
    RNNATEPPFRNEYFNNDRPGIYVDVTTGEPLFLSTDKFDSGCGWPSFSRPIKEELIQEKQDFSHGMRRTEVRSKTGDAHL
    GHVFTDGPKEQGGLRY
    CINSASLKFIPEQDMEAQGYGKYLPLLHREGTDRKAAEK

    >gi|187735763|ref|YP_001877875.1| thioredoxin reductase [Akkermansia muciniphila ATCC BAA-835]
    MSEQVIIIGAGCAGYTAAIYTARANLSPLLITGSQIGGQLTTTTEVENFPGFPDGVMGPDLMFLMQQQAEKFGTRFAYED
    VKSVVRDEATGLFTVKTSGQNYETRSIIVATGASARYLGIPGEEGLVGHGLTA
    CATCDGAFYRDVPVCVVGGGDSACEEA
    MFLTRFASRVYLIHRRDTLRASKIMAERTLSNEKIFPMWNSTIVSYKTDDKGELEAVMLKDVVEGDETELPVKCVFMAIG
    HTPNTSFLGDLVDRDDAGYIIRETGMMATRTPGLFAAGDVADPHYRQAISSAGMGCSAAIEAERYLLGL

    >gi|187735814|ref|YP_001877926.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Akkermansia muciniphila ATCC BAA-835]
    MLLIGKPAPHFSANAVVNGTIVPDFSLDQFKGKKYVILFFYPKDFTFVCPTELIGFQEALGEFEKRDVAVVGCSTDSEFS
    HWAWINTPRSQGGIQGVTYPIVSDINKTISADYGVLAGDEEIDEDGNVEVNGELIAYRGLFLIDKDGIVRHQLINDFPLG
    RSIDEAIRVVDALQHFELYGEVCPLGWHKGDAAMTPSHEGVASYLSK

    >gi|187735822|ref|YP_001877934.1| Methionine sulfoxide reductase B [Akkermansia muciniphila ATCC BAA-835]
    MAVNGGIPASRDVPDPGPARTRRPLTETEKRIIEHQGTEPPFSGEFVSFFEPGIYSCRKCGAPLFRSEDKFDAGCGWPCF
    DDSLPDAVTSVHAGGGRRTEITCARCGGHLGHIFNGERLTPKNLRY
    CVNSLSLEFRAAPLPIAADAPR

    >gi|187735975|ref|YP_001878087.1| hypothetical protein Amuc_1484 [Akkermansia muciniphila ATCC BAA-835]
    MKTIIHPLAAILLAWSAGASETWSTSPAEAMQQAAAQNKGVMLEFTGSDWCGACIMQKKQALSLPEIQTAISRSFIPVEL
    DYPRKKQQDAQTKTSLETYKKSYGITGFPTLVFADAQGRPVHTVVGYANPAQVMQDTKKAAEALNTQQSLTNKLAEKLTD
    QQRRDTLVQLLKTVPQSSIRTFYKPALAELEKLDPQDASGILAKLHRDDLLHAQKLEWADTFRKKNIHILADQNPDEALS
    IMDSYLKKNGLLPEVKQAVLMQKVYLLMQQNRVNELEQPLKEGVALLPKSFEGKAFGKLLDKLPEIKKERGLLKPGEEPP
    LPPGAIRATKMIVPTAPAK

    >gi|187736028|ref|YP_001878140.1| OsmC family protein [Akkermansia muciniphila ATCC BAA-835]
    MTDHYYTSETENVGQFRCETTFIPSNVTFSTDLPASFEGRAEFPSPGVLLGSTLASCMMSLVSVVAARKGVDLKGMRVLA
    RAAESSKGIEKIELKVIMPLEGSHPLRAMLEKTALS
    CPVRQALRPDLETPIEWEWK

    >gi|187736057|ref|YP_001878169.1| methylated-DNA/protein-cysteine methyltransferase [Akkermansia muciniphila ATCC BAA-835]
    MEAIKIIRYLSPVGEMMIGSYGGNLCICDWAKEKRRGTIDRRICRHLNAEYEEGTSEVIEQAVSQLREYFQGERRDFDIP
    IVFTGSEFQNSVWHELMKVPYGSTISYAELARRIHHPRAVRAVASANATNPISIFVP
    CHRVIGSNQKLTGYGGGLDAKRE
    LLALEARVSGSVLAL

    >gi|187736176|ref|YP_001878288.1| dihydrolipoamide dehydrogenase [Akkermansia muciniphila ATCC BAA-835]
    MQYDLIVIGGGPAGYVGAIRAAQLGKSVVCVERDRVGGTCLNWGCIPTKALLKNAEAYRIVTDRAREFGMMVEGVSVDWS
    EVIGRSRKVSDRLAGGVGFLFKKNKVDSVTGEASIISPGRVEVKAADGTVNVLEGKNILI
    CTGCVTRTVPSLPLNGTTVI
    GSREAMVLEKRPESMIIIGSGAIGTEFAYIYNSFGTRVTLIEALPRMLPNEDDDSCMTLERAFKKQGIKVMTGASVESVT
    ETCDGQVRANVKNSRGQEEEITADVCLVAIGVKPVVPAAPGLELTEKGFIKVNDRYATSIPGVYAAGDVIGGVLLAHTAS
    FEAVQAVEGMFNPDYQPRQVGFFPSCTYCYPQVASVGKTERALKEAGVEYKVGKFPFQAIGKAVAAGEPDGFVKTLYGAK
    NGELLGAHIVGPEATELIAALGIGIQAELTDEDIHATIFAHPTLSEAIHESMLASEGIAIHM

    >gi|187736327|ref|YP_001878439.1| Thioredoxin domain [Akkermansia muciniphila ATCC BAA-835]
    MRNSFFPAIGVLSLASALICSASSSWETDWNKALEKAGKGGHPVLADFTGSDWCPGCIYLRKNIFDTDAFAKYAADHQFV
    LLELDFPKAAGKMPPEQLKFHEELMRRYGVSSFPSVLLMEGNGAPYAKIVGATRTPEEYLKKLEAAGETRRKLKEAVAAA
    QPLKGKEKLEQLVKALNVLPEDLQPFQKGLIAEISALDPEDKYGFAKKSEKAAAMEKQRLVWEQFCQKYSGRLSAEETRA
    GREEALQMLEKKDTLPPIRLKIAKYISDGYTLERNLPKALEYLEIARDADPESQAAKKLEPWIDNMRKHINQEK

    >gi|187736536|ref|YP_001878648.1| hypothetical protein Amuc_2057 [Akkermansia muciniphila ATCC BAA-835]
    MMNRHFIFALCTVLGFSVSGISMAQSVPTDKEAAAKAAKAAKVKFRWGKSLKSAQKQAEETGLPIVLLFTGTSWCGFCVK
    LEKEILSKKDFKQGMDGVAIGVKFEFGSSDFSKSKEAKTYNITGVPAMVVVDADGKELGRTGYVPGRTPAQYVEFFKKYA
    PKTAEGK

    >gi|187736649|ref|YP_001878761.1| Redoxin domain protein [Akkermansia muciniphila ATCC BAA-835]
    MNAFPAFILSGIIAAMAVPASAQTAESANGPKVTYPAFNDGSHIHGPKLKTSDLKGKVVFFEYWGINCPPCIASMPHLQE
    LQEKFQSKGFTVIGSHSQLPSPRVKQFLEEKKITFPIYQSLSIPEAPCPGGLPHAVLIGANGKVVAKGYPPQLYDLVKKE
    VMKMERGLPILEGVELNKYKSLAKTVVSTGSNIESKITPLRKKTNDEEAQAVCEAFDAWLENTKEIVQARIQSDPLEAVT
    AIMRLKTAVPSVKEFDEPLAALKANRDLSKLADLNKKISALEQRKAKGRKISESDLKSLTQAVDKFTESDNEATQTAAAN
    LKKNLSSLAAPETPGK