Dehalococcoides ethenogenes 195 uid57763

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|57235038|ref|YP_180946.1| glutaredoxin family protein [Dehalococcoides ethenogenes 195]
    MEKVTGKNAGEIKLYALSTCGWCRLTRQLLAELGVAYEFEYVDLLTGSERDKAVTELSALNPSKSFPTMLIGGSKVIIGY
    KEAEIREALKA

    >gi|57234663|ref|YP_181286.1| thioredoxin-disulfide reductase [Dehalococcoides ethenogenes 195]
    MSPLLYDVIIIGGGPAGLTAALYTGRAKLKTLVIERAFIGGQITRSEKVDNYPGFPEGITGFDLTQQMQIQAEKYGAEII
    SAEVTALNKAKDSFELSTEAGKLSGRCIIICGGTERNKLGVPGEEEFSGRGVSY
    CATCDAPFYNDKVVAAVGGGNMAIYE
    ALHLSEFAKKVYLIHRRQGFRADAVLVDKAKSKGNIEMVLDTVITSINGKDSIQSLSLNNLKTQKTSDLPVNGLFVAVGL
    QPNTAYLKGVVDMDKNGSILVNDQMETSVSGILCAGDIRSGSIRQVISAAGDGAVAALSAKRYLDR

    >gi|57234563|ref|YP_181360.1| thiol-disulfide oxidoreductase, putative [Dehalococcoides ethenogenes 195]
    MKRKLITLSFLLIGSLCLSACNQAAPLPPDDGEALTGIRINNLAPDFSLKDLTGQDISLSGLKGSGVVLNFWMISCGYCQ
    DEMPFFEAAYNENKSLPSGIKVFMVNIRESQSLIERFMANTGFTFPVLLDTTGDIGQLYNANYIPITYFINAEGIIKAIK
    FGGVSSQADFDNQLKKIT

    >gi|57234585|ref|YP_181403.1| thioredoxin [Dehalococcoides ethenogenes 195]
    MVMEITDQSFAAEVLKSDKPVLVDFWAPWCGPCRMVAPIIDKLSTKYEGKFKFCKLNVDENKTTAAQYRVMSIPTLLFFK
    SGQVADMVVGAVPESALSQKIDQLLQK

    >gi|57234511|ref|YP_181437.1| thioredoxin [Dehalococcoides ethenogenes 195]
    MVMEITDQSFAAEVLKSDKPVLVDFWAPWCGPCRMVAPIIDKLSTKYEGKFKFCKLNVDENKTTAAQYRVMSIPTLLFFK
    SGQVADMVVGAVPESALSQKIDQLLQK

    >gi|57234506|ref|YP_181467.1| [Fe] hydrogenase, HymB subunit, putative [Dehalococcoides ethenogenes 195]
    MINTAIKKFNSVAELEAKRQEILKDRNSQKTVIAICCGTGCQAYGAKKVADAFEEELSKAGLGDKVEVRTTGCHGFCERG
    PLVVIRPQNIFYQRLKISDIPEIIEKTIKNNEVIERLLYVDPMTKDKKVHEHDVPFYKKQMRLVFGNNGNIDPTSIDDYL
    AVGGYKSLAKAISGLKPEEIVEEVIKSGLRGRGGGGFPTGWKWKSCRDAHDPVKYVICNCDEGDPGAFMDRSLMEGNPHS
    VIEGMIIGAYAIGSHEAYIYIRDEYPMAVKHALLAIKQAEDYGLLGENILGSGFDLKIHINRGGGAFVCGESTALMASLE
    GKVGEPRAKYVHTSEKGLHDKPTTLNNVETWANIPLIIEKGADWFNKIGTEGSKGTKIFSLVGKVNNTGLIEVPMGITLR
    EIVYDIGGGIPKGKKFKAIQTGGPSGGCLPESMLDLPVDFDELTKAGSMMGSGAMIVMDEDNCMVEIARYFLSFLEGESC
    GKCVPCREGVKRMRQILERITKGEGEEGDIELLEQLSQAIQDASL
    CALGGSAPNPVLSTIKYFRDEYEAHIRQKTCPAKE
    CKALITYNIIDANCPGCGLCYKACPTGAIISQGKKMPVILDQSKCTKCGACFDACKLHAVEIR

    >gi|57234504|ref|YP_181469.1| mercuric reductase, putative [Dehalococcoides ethenogenes 195]
    MKYQYDLVVIGGGLAGFTAAVFANGLGKKVAIVEKGKLGGACTWNACVPSKALLQLGLRIRQLNNYNRSGTKLASVNLQT
    ENVMPYLHSVLENISRIDDFASLVNTGIDILNGEAVFNGRHQVSLNGQLISAKHFIIATGSSPAIPPVEGLSDIPYYTNE
    TVFDIKAIPSSMIVLGGGPAGIELGLAFAWLGCKVDIIEMADRILPKDDTELSALLLEYLNAEENLNIHISTKAVRFQSQ
    TDGSLKLEMQTREGKISEISSETVLVAVGRRANVAGLALEKAGVKYTPRGISINNRLQTSSSNIFAAGDVAGPIQLGMMA
    EKQAILAASNACLPFKQSIRYEDVAWVTYSEPQMAHIGLTEDEARRKYGNNVRVIRYPLTKVRRAVMDHDTRGLCKFILD
    KNDRLIGAHLLCSHAENLVHELQIVKCLNKPLSKLHTIPHIYPTYEEGIIKRAADISYTIKMQRNPFVRLVLRYWPGYKD
    RLDTVISRL

    >gi|57234243|ref|YP_181678.1| copper-translocating P-type ATPase [Dehalococcoides ethenogenes 195]
    MPEKNLPDTLPKIIMGISGMSCTRCAASIEARLSKTDGITDPKLNFASAKLIFSYDPAVISLADIKSIISGLGYGVISRK
    SIFPIKGLH
    CASCVARAEKALKNTNGVLSASVNLANQTANVEYLDFISYRELSQAIKNTGYELLSEETPQNELNSSENAE
    TRKLQQELTVALVLGISLMIIGFLPAFGGKEFIMFLLATPVQFWAGLRFYRGAFAALKNRTSDMNTLIALGTSAAYLYSL
    TALVFPSIFDSPLLEKHLYFDTSAMIIALILTGRFLEARAKGRTSDAIRRLVGLQPSTASIIRDGKEILVGISEVVAGDK
    IVIRPGERLPVDGLILEGYSSLDESMVTGESIPAEKKAGDYVIGGTFNQTGAFTYEAQKVGADTALARIIRLVEEAQGSK
    APIQRLADKIASVFVPAVISIAILTFVFWLVFGPEPSFTYAALNMIAVLVIACPCALGLATPTALIVGMGKGAENGILIR
    SAVALEKMHKLDTIVLDKTGTLTRGKPVLSNLVSHTMDKDSFLTLVASAEQFSEHPLAKAVVKEAARKKLKITSSSEFSA
    LPGAGLKATVSGKQILIGNANLMQSNRISLAEYQSEADKLWEAGENLIFVAADGKLEGMVAVRDILKRESQAVVAELKAN
    KLRTIMLTGDNQRAAKRIADELGLDQYISEVKPEDKSRLVQELQDQGHFVAMVGDGINDAPALAKADVGIAIGTGTDIAM
    ETGDITLISGDLFGLTKAIVLSKATFNTIRQNLFWAFFYNIILIPVAAGVLYLFLSHSGVPQSLHFFLGEYGFLNPILAA
    LAMAVSSLTVVSNSLRLRRVKLNTYLKQ

    >gi|57234251|ref|YP_181727.1| redox-active disulfide protein 2 [Dehalococcoides ethenogenes 195]
    MIIKVLGTGCTKCNKLEEMTKEAVLELGLSAQIVKVKDIDKISAYPVLMTPALVINEEVVVSGKLPTKEEMQKLLLSKAS


    >gi|57234010|ref|YP_181954.1| peptide methionine sulfoxide reductase MsrA [Dehalococcoides ethenogenes 195]
    MTETAVFGGGCFWCMEAVFSRLSGVLKVEPGYAGGTLPNPTYQQVCAGDTGHAEVVKLEFDPALVSYTDLLDVFFQMHDP
    TTPNRQGQDIGTQYRSVIFYTTPAQKVQAEETIKKLDESAGFPERIVTGVLPLEKFYPAEDYHRQYYALHSRQPYCRFVI
    QPKLDKLKEHFGGMQK

    >gi|57233869|ref|YP_182101.1| rhodanese-like domain-containing protein [Dehalococcoides ethenogenes 195]
    MPSKRNLIAVLALLLTFCGVLTGCDTGSAVDDANLPAVQNISVAEAKALIDRNAVSADFIILDVRTPSEYAQGHIPGAVN
    LDYYASFEASLSAFDKTKTYLVY
    CRTGNRSASAARLMLDNGFAAIYNMQGGINAWISGGLPLET

    >gi|57233796|ref|YP_182128.1| arsenite S-adenosylmethyltransferase [Dehalococcoides ethenogenes 195]
    MTDIKKLVRDEYGHIAERAASPASGCSCCSCNSDIAAESSLQAGYTEEEINSVPEGANLGLGCGNPLALAEIKEGETVLD
    LGSGGGFDCFLASPRVGAKGKVIGVDMTPQMLSIAKRNAFQGGYTNVEFIQGEIENLPLESDSIDLIISNCVINLSPDKP
    AVFKEALRVLKPGGRIVISDIVLEGELPDEVRKSAAAYIS
    CIAGAEQFDDYLDIINEAGFVDITLLSKETYGADSCCNDD
    EGCGCSCGCSGESCQSGEDTETNALDGLISSLRLRAYKPL

    >gi|57233730|ref|YP_182163.1| methylated-DNA--protein-cysteine methyltransferase [Dehalococcoides ethenogenes 195]
    MSRVTPNGPKPVSSRVKAAAGISWGILEIQPGWVGVMASAQGICRLTLPQPGQTEALAELNPPAETIRTDSLFHPLATKL
    ESYFQGNSTDFPFSLDLSGYTPFESQVFKTCALIPYGQTASYGQIARRIGRPKAARAVGQALHKNPVPILIP
    CHRVIAAN
    GKTGGFNGGTNIKCWLLTLETRKPSG

    >gi|57233665|ref|YP_182278.1| anti-oxidant AhpCTSA family protein [Dehalococcoides ethenogenes 195]
    MEEVTQPMPRIGDIAPQFEALTTHGVLKLEDFKGQWLIIFSHPADFTPVCTTEFIAFSEIYPELQKRGVELLGLSVDSNS
    SHIAWVRNVEEKTGIKIPFPIIADLNKEVSLAYGMIHPGQSKTETVRCVFILDPDQKIRLIMYYPMNVGRNMKEILRVID
    ALQTADENKVALPANWHPGDKVVVPPPSTQEMAEERMGQGYECIDWYLCKKNL

    >gi|57234990|ref|YP_180903.1| hypothetical protein DET0153 [Dehalococcoides ethenogenes 195]
    MAVAGFICEKTAVKLKLADMKKFPKRTYSNPAQFLSDIGFILKNRRKLKESRLSGFPSPAFRERLMLAVTGVNECRFCTY
    AHTKMALESGISQPEVKALLDGDFGNCPSGELNAVLYAQHWADTAAKPSAEMQSKLEADYGAEKAGFIHLYLRMIRIGNL
    SGNTADKFLYYLTFGKIGLNRQP