Deferribacter desulfuricans SSM1 uid46653

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|291278451|ref|YP_003495286.1| peroxiredoxin [Deferribacter desulfuricans SSM1]
    MSLVTKQAPLFEADAVYNKEFTKVKLEDYRGKWVVLFFYPLDFTFVCPTEITALSDAYEEFKKRNCEILGVSTDSKFSHL
    AWINTPREEGGLGDINYPLVADFTKKISEDYGVLLPAGMALRATFIIDPEGVVQFELIHDLGIGRNVKEILRSLDALQYT
    REHGEVCPAGWEPGKETMVPDPEKMKEFFKKVPEGHF

    >gi|291278655|ref|YP_003495490.1| methylated-DNA--[protein]-cysteine S-methyltransferase [Deferribacter desulfuricans SSM1]
    MSVIRITDFFSAEVSFDKTVEKIIKVKILFGDYDNYETEKLPADIVRYFKKYPFENIDVFSLVETEKINSTFLKIYKNLL
    DVSYGKTITYGELAEKSGIKNGARVVGNAMAKNNYPLIIP
    CHRVVAKNGLGGFYYGLDNKQKLLNWERSL

    >gi|291278725|ref|YP_003495560.1| heavy-metal transporting P-type ATPase [Deferribacter desulfuricans SSM1]
    MVKNNKKDEMLCTLDGLDCPSCAAKIEQAFHKNGLDYAMINFTSKSVKLKNSDIEKAKEILKKVEPNIHLIPNKKIQKYY
    LVGLS
    CADCAKRIEERIRKIKGLENVTLNFAAGTIAFDPRFLDKVEEIIKEVEPGVTLQKIDSDVDDEPIEENNKLATLV
    MVVSFFLLIIGIIFKQKLHNTPYSVAEYILFLSIYLLVGWKVLTTAIRNILRGNFFDENFLMTIATTGAIIIHQLPEAVG
    VMLFYYVGEYFQELAVNNSRKSIKALLDIKAEYANLRLNGTTKKVSPEMVNVGDIIVIKPGERVPLDGVVIDGVSFVDTS
    ALTGESVPKKVKKGDDVLAGMVNTNGLLTVKVTKKFEDSSLAKILDLVENAGSRKAPTEKFITKFSRYYTPVVVIGAALL
    AIVPPLIIPGAAFNDWIYRALILLVISCPCALVVSIPLGYFGGIGGSSKKGILVKGANFLEVLAKLHTVVFDKTGTLTKG
    VFKVAEIKSINGFSEEDVLKYAAIAEANSNHPIAVSILEAYKGDLNLDDIEKYEEIAGHGIKVIYKGKEIIVGNDRFFHK
    ENIEHQDYCNLEGTVVYVAVDGIFVGYLIISDEIKDDAKDTITKLKKIGVKRTVMLTGDDKSVAENVAAKLGIDDVYANL
    LPEDKVYKVEELLKGLNEKEKLAFVGDGINDAPVITRADVGIAMGGLGSDAAIEAADVVIMDDKPSKIVTAIEISRFTKK
    IVVQNIMFALGVKFIFVFLGSFGMATMWEAVFADVGVALLAVLNATRTLKFKGSSN

    >gi|291278726|ref|YP_003495561.1| heavy-metal transporting P-type ATPase [Deferribacter desulfuricans SSM1]
    MMREKIFTVKGMTCASCVNRIEKKVSKIDGIEKVSVNLATEKMLVSFNPEKVDDEKIKNAVKDAGYDIEEGSDLKTVSIP
    IKGMT
    CSSCANAISKNIGKLDGIKSANVNFASEKAVVTYDPSKVRLSEIKKAITDAGYKPLDIEKGDSVDYEKKRRDKEI
    KTLKLKVIISAIFSIPLLYISMGHLIGLNLPDFINPQKHPFNFALAQALLVIPIIIAGYKFYTIGFKNLFKLSPNMDSLI
    AIGTSSAIVYGLYGVIAIFFGNTKYVNDLYFETAGVIITLILLGKYLESVSKGKTSEAIKKLMGLQPKTALILKDGKEME
    IPVDEVEVGDIVIVKPGEKIPVDGVIIDGYTSVDESMLTGESIPVEKRVGDKVIGGSINKNGNIKFKATKVGKDTALAQI
    IKLVEEAQGSKAPIAKLADIISGYFVPVVIAIAILSAVAWYFAGAGGIFALTIFISVLVIACPCALGLATPTAIMVGTGK
    GAENGILIKSGEALETAHKIDTVVFDKTGTITEGKPKVTDVVVFDNFTKNDLLSLAASAEKGSEHPLGDAIVRAAEERGL
    EFKKVDKFLAIPGFGIEVHIDNKQIYLGNIELMREKGVDITSQMNLFEKLAKEGKTPMFVAVDGKLKGIIAVADTVKPSS
    VKAVEKLHEMGIKVAMITGDNKRTAEAIAKEVGIDIVLAEVLPQDKANEVKKLQERGHVVAMVGDGINDAPALAQADIGI
    AIGSGTDVAMESADIVLMKSDLLDVVTAIQLSKATIRNIKQNLFWAFAYNTLGIPIAAGVLHIFGGPLLSPMIAAAAMAF
    SSVSVVTNALRLKKFKIEH

    >gi|291278905|ref|YP_003495740.1| electron transport complex protein RnfE [Deferribacter desulfuricans SSM1]
    MKLQIFKDGFWNNNAVFKQVLGMCPTLAVTTSAENGIGMGLATTVVLICSNIVVSLVKNFIPSKVRIPAFIVIIASFVTV
    IDLLMNAYAHSLHKSLGLFIPLIVVN
    CLILGRAESFASKNSTIDSLIDGIASGLGFTFALFVLGSVRELLGAGSILGFNI
    FGSGYSPAIVMILPPGAFLALGFLLFIINWIENRNKIKEECCTVNE

    >gi|291278906|ref|YP_003495741.1| electron transport complex protein RnfA [Deferribacter desulfuricans SSM1]
    MKELILIFISAVLVNNFVLSRFLGICPFFGVSKKLDTAIGMSLAVTFVMTIAGIITWILQYAVLNPLHLEYLQTIVFILV
    IASLVQFVEMVIEKTSPALYKSLGIFLPLITTN
    CAILGAAILNIQFKFNFLEMLVFTVGSSIGFGLALVLFAGIRERIEL
    SNIPYFFRGVPIAFITAGILALAFLGFSGLVKI

    >gi|291278918|ref|YP_003495753.1| thioredoxin reductase [Deferribacter desulfuricans SSM1]
    MEDFFNFDNLKEEYDVVIIGGGPAGLTAGIYAARDDLNTLILEKNFPGGQVAITEIIENYPGFLEGISGGELTEKLFQHA
    KQFGVEIKNGMCKGIEFCDGYKYVSLQYKDIKIKTKTVIIASGAKPKHLEVPGENKFLGRGISF
    CATCDGAFYKDKVVAV
    IGGGDSAVEEGHYLTKFAKKVYIVHRRDKLRAAKILQDRAFANPKIEFIWNSVVKKVNGEDKIESITLYDKKLGKTHDLK
    VDGVFVFIGWNADTEAFKGLLELDESGFIIADETTHTNVPGIFAAGDVRKKELRQIVTAVADGAVAAKMAERYIEENFPQ
    EG

    >gi|291278931|ref|YP_003495766.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Deferribacter desulfuricans SSM1]
    MKVVVVGGVAGGLTCASNIKRMNKDIEVVVFEKGVDVSYGACGMPYNLLDLEKPVESLYALSLQEIREKRGIDYRLKHEV
    IGVDFDNKSVTVRNGDKEFEENYDVLVIATGARGNKIPIFEGNDDSFYFKTLEDLRKVKSYLKENDVKKVCLVGAGYVNL
    EVAEVLKEKGVDVFILEKMDYILPQFCDEVREKVYSKLKEKGIDLFLGVDITAKEKGVVRTNKGDFNADMFIISAGVTPN
    SELFDIKKGAKGAIVTDRYMQTSRKDVYAVGDVTLAYNRVIDDFVYFPLGTTANKQGRVAAYNIVNGNRLEFYGIVQTAT
    FKLFEYTVATTGLSEYQMENLGIDFEKTVVTTHTRGAYPGGGKVTVVMYHDKKNRKILGAQMVGEDVVAKRIDIIATAIS
    NNMKIDEFAWVDLSYSPPFAPVWDPVLTCAQKALRK

    >gi|291279068|ref|YP_003495903.1| hypothetical protein DEFDS_0667 [Deferribacter desulfuricans SSM1]
    MLTKKRFISLALFATLLFSLYLIFGCGGATSSYDDPNEEYYAGEENVSALIEPETLYKWIKNGYKTDEGNPVRIIHIENN
    PGDEKIWFAGDVAKVANVVGPGGMAAAQALDDAGYLGHIPGAVYSVSHEGYIVSNRSDGPMDTDHLVGSGDLITQWLQKY
    GITKNTVIVLTQGNLTYPGFCPARFYWTLRYWGISKKYLKILDGGNVAWADYIKTNHPDEIATMGLQKGLTCPKITPSNI
    DVADFPRRNLDIKVTIGELIKLVDEGKTTDGTVAVLDGRQPPAPFYFDNISEYSPEKHTLKGSTNLPEWYDKGFMPIDFN
    GNDTNADGTVSAYASKIKAFVKNGFPYPFNISAKAAAFDGEIKGSKLIKGKNASGVPFNIAAPAFINVVKVIDNSTGMPA
    FLAFGKYKKPTDEAWDGTDWADNVTVAEMFARVLPDKNQTIITY
    CNSGAMAATYWFYLTEVLGYKNVKLYDGSWIEWGSL
    VAFEPNYDNVTQGLKVVSSEVYKWFPKTTLAATLNMPKLLVFGSGDFTTFHIENRNGELWAVADNISMTSVPYFECKVTD
    PDCPVQLGGNLSGNTAWDTISRSEKVVFRPDNLVNTGTMGSSDNVSNTKEYDSVIDWPTVTTYPGYVGDGSETKIEDEDY
    SGFTGGGGGSAPEAFVPQGGGC

    >gi|291279106|ref|YP_003495941.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Deferribacter desulfuricans SSM1]
    MKVVVIGGGPGGIQATRTIKMHNPDVEITMIRPEPYSVIYCALPYVIENLVEKEKIRKSDELVTSVGAKLVKDKATKVDF
    NKKVVFTEKSGEFTYDKLIIATGANPFVPPIPGSDLCNIATVKTESDLENILSYLEKGAKKAVVVGAGNIGIEMAVAMKE
    RGLETYLVEMQNRVLPNLLDEDFAKYPEEDIRETGINLLLNTRVDALEGEKYVEKVVLSNGNFIELGEHDLVVFAVGVKP
    NIEIFKDTELKIDQYGIVVNEHMMTNIDGVYAVGDVASFLSFIDGKPIAGKLATNAVPMGKIAAYNILGRNYKYQGFING
    AITKAVKWRMGGTGFTEEVAKQRGFDIVTAIGETTTRFPIIPGAKKVYVKLIADKKTMRIIGGQVVAGEGVPGRIDTISL
    AIQNRNTCYDLFNFSYCAQPFQTFFPANNAIVMAAEKLINIFESK

    >gi|291279186|ref|YP_003496021.1| heavy-metal transporting P-type ATPase [Deferribacter desulfuricans SSM1]
    MDKRRYILKNLDCPSCAAKIETALQKGLNDNTINVNFTNKTVLLKKDYFNTANEIVKSTDPGVELIDFSKINNDNEQFNK
    KFMLTKIFLSLFFYIIALIYKNISVPNLTVEYILFLIPYFLIGYPVILKSLNNLKNRQLFDENFLIVVATIGAIFIKELP
    EAVAVMLFYIIGEFLQDLAVDRSKKSITNLLSLKAEYATVIKSGKYITKKPDEVNAGEIIVVKPGEKIPLDGVVIEGESF
    IDTSALTGESKLKKVKKGDEILSGMINDSNLLKIKVTKPYSDSTISKILDLVENATENKSKTEKFITKFAKIYTPIVVYT
    AVFIAFIPPLVLQESYTLWIYRALILLVISCPCALVISIPLSYFAGIGKTAKNGIIVKGSNHLEALTDTGAVAFDKTGTL
    TEGVFKINKIVTKNGATEKEILKFAAYTEFNSNHPISKAILNEYKGEIDINKIEEYEEIKGYGIKTKVFGKTVFVGNDGL
    MHLMNIEHDDCDVDHSVVYVAVDNKFLGYILIDDIVKSESKLALDKLKKLGIQNIIMLTGDNYSAASKIANQIGIKEFYA
    NLLPQDKIKKVNEIKEKLSAQNKKKRVVFVGDGINDAPVIAVSDVGVAMGGIGSSITIEAADIIIMDDSPISVPKAIEIA
    KLTKKNAKENIIFSLAVKVIFITLGIAGAATMWQAVFADVGVALIAVLNSMRIFIKKLKNYE

    >gi|291279301|ref|YP_003496136.1| AhpC/Tsa family protein [Deferribacter desulfuricans SSM1]
    MTLKEIIENFKKERLSQLPDNVKVIMMKATEDLINSGIEEQLPKVGEKIFDFTLPNYDGKEVRLGELLEDGPVVLNFYRG
    GW
    CPYCNLQLNYLQSRLDDFKKYGTVLVAVLPELPNMAASTVDRHSIKFYVLLDMDNKVAKRLGLVFKLPDEVVSIYKKL
    GHDLEKYNGNDKYEIPVPATFVIDKDFTIRYSFGKADYTQRAEPDDIIEVLKTLQ

    >gi|291279303|ref|YP_003496138.1| mercuric reductase [Deferribacter desulfuricans SSM1]
    MIRLRIIGMTCQHCAKTIKKAVEGLEDVEKVNIYFPQGYAEIEGNSDVNKIIKVIEKAGYKAEKISIEKDVYISKDHVYD
    LIIVGGGSAGFAAAIKVSELGGKALIIENDVIGGT
    CLNRGCVPTKHLIDIAKTYFTPKSNPFKGIELLQKRLDLELIINE
    KNKLLDELRKEKYWNVLDSYKSIEYKKGVAEFISDGVIKINNEKLTYNKVVIASGARPLIPPIKGLDNINYMTNNEILNI
    NYLPKHLLIIGGSAVGLELGQIFLRFGSKVTIIEALSDIAFNEEPEIRSVLKDALQKEGMNIYTSAKVINIYRTNDEIEI
    EVEINGVKNSIRGTDLLLATGRKPNTDKLELKNVNVETDERGFIKVNRFMQTTNQKIYAAGDCIGGLMLVTTAALEGGIA
    GENAILGNKRKVDYLSIPHAIFTEPEISSVGLTFKQALEKKIDAEYRVLYFDMVPRAQAMKKVNGTVKIVVDKKNKRILG
    IHICGFDAADIIHKAVFLVKYGLTINDVIKMTDVYPTLSESIKLCAQTFIKDVSKLSCCAE

    >gi|291279304|ref|YP_003496139.1| mercuric ion transport protein [Deferribacter desulfuricans SSM1]
    MSINKETISGTIGTLAALLGASCCILPTLLVIFGISLGSAGGFFSNLEAYRWLFLGIGYLSVGYSIYSLYLKNWIKRKIF
    NKPSINCACKENKLNKFSKIITWISLFLLIVATFYPYILPLIF

    >gi|291279340|ref|YP_003496175.1| bacterioferritin comigratory protein [Deferribacter desulfuricans SSM1]
    MERIKLNPGDKAVDFKLIGDDEKEHTLDDFKGKKLILYFYPRDNTSGCTREAVGFTEHLEEIESLNATVVGISPDSIKSH
    KKFKEKHGLKILLLSDPDKKVAESYGAYGEKKMYGKVTKGIIRSTFIIDENGIILKPFYNVKVNGHVEKVIEFLKGLSNE


    >gi|291279557|ref|YP_003496392.1| thioredoxin [Deferribacter desulfuricans SSM1]
    MALTFTEENFQKEVLESDIPVLVDFWAVWCGPCKMLAPTIDQLANELEGKVKVGKVNVDENQSLAARYGIMSIPTVMIFK
    DGKVVEQFIGVQPKGVYVDALNKYL

    >gi|291279574|ref|YP_003496409.1| hypothetical protein DEFDS_1184 [Deferribacter desulfuricans SSM1]
    MKRFLFVTLLIISLSFTAFADVKTDLLKNIKLNFQKRGLKGVEVNAKVLKKLDSPKGFYFVKINIKDKKRNKQATQYLIT
    DGKLVIPDIIELQNGKSFVKDLTFEYDKVDIPTKDLTLMQGNKNAKHKIIKISDFQ
    CPFCRRAYKYIEPKIKDNKNIALY
    MLNYPLPIHKKAMIFAQVFEAGMKMGYNFADDLYSGKYDNKQDSEIIDEFAKKTNDPARFKELIKSQEIKDRIERQKKIA
    EKYGFRATPVLVFDGKKVEGFDPNLIEKGLNSFKK

    >gi|291279684|ref|YP_003496519.1| hypothetical protein DEFDS_1296 [Deferribacter desulfuricans SSM1]
    MIKNELSKSKSRYLQQHKNNPVAWQIWSDETLKLAKEVNKPLFISIGYSSCHWCHVMAHESFEDEETANFLNNHFIPIKI
    DKEEYPEIDKKYQFYIQLIKQQGGWPLSVFATPEGDPFYAGTYFPKEEKYGLPSFMNILSQINKIYTENYNQIEESVSKY
    KDAIAQFYKIDKIDIRNLDLNSFTKNISDLLDFENGGLKGRNKFPNIPYLNFLLDYHFDEFADFLIKTARKIAFSGLYDH
    INGGFFRYCVDENWSYPHFEKMLYDNALNTIFLIKLYDKVKDPLFYHISRKTIDFILETFNTEYGLISSMDADSLDESNQ
    MVEGYFYHLDENLLNIIPQDLKKYIVSKNGFIYLNDKTDYETYKKLEIYFDKISLQNQKIEPEKDNKVICSWNMLFVNAL
    LTYAEVTGEEYYFNHAINLFNKIKTFLLSKEHIYRINYGDEIFKHETLEDYSYSINALLKLYEMTKEKDFLYYADAITKK
    ALEKFTDDNYIYLDKNKSILDTFDDAMYSPVGLMGINLLILSKYTSINQNSKIYSFLIDRAVKFPTGHPTILTFIRRLVD
    DN

    >gi|291279714|ref|YP_003496549.1| formate dehydrogenase subunit beta [Deferribacter desulfuricans SSM1]
    MGRMRFLCDVDRCIDCNGCVVACKEGHHVPVGINRRRVITINEGKPGEKSISVACMHCSDAPCIAVCPVDALYQREDGIV
    LVNKDVCIGCGYCFFACPFGAPQFPKGNSFGARGVMDKCTFCAGGPAETFSDKEKRLYGQNRIAEGKVPLCAGMCATKAL
    LAGDADKVANIYRERVFRRGSGANAWGWDKAYNRK

    >gi|291279732|ref|YP_003496567.1| peroxiredoxin [Deferribacter desulfuricans SSM1]
    MERTGLITMKGNPITLVGNEVKVGDKAPDFTVLDITLSTKRLSDYKGKLKIISVTPSLDTPVCDMQMRTFNEKASKYKDA
    VVLNISMDLPFAIKRFCTTAGIENVEGLSDYKDADFGQKYGLLIKELRLLARAVLVIDKDDNIIYYELVKEVTDHPDYDK
    LFAFLDNL

    >gi|291279819|ref|YP_003496654.1| hypothetical protein DEFDS_1438 [Deferribacter desulfuricans SSM1]
    MEFLISLLILFQILHFGEIKINRLFLSNSSYLKQHQTNPVNWHFFNSYSLFLSKYTNKPLFISIGFKSCHWCNELEKELF
    KKSDAANFLNKKFIPVKIDKEEMPQIDNYFQSYYFKIYGKNAGWPLNIISDYKLKPKAFFSFVPYKDEFTGKSYKKIILE
    KLNEDITIKTKNHQTLQISKVFDQKYGGFLVDGLLKFPRNEIYQLLADRYIYEHNINDKEIATLSLYNMASKGLFDIIDG
    GFFRYSTDTEWIIPHFEKMLYTNALLISTYLRWYSITNNKFYLNTVKKTLSFWLNNMYNGKYFYSSINADSNDMEGQYYL
    IDYRKLQDYLKNNYPNIDIKTFEKLHITKDGNFDYFLNQPYLSDYELDNKTRYLINILQTYRLKKPFPQIDKQIIFSWNM
    EMLKALIDYSYFDRKILNFIIKTLFNLEKDFIYHNNIFHSKNLNTLNTNSLLEDYAFYIETLIALYNRTLNKDFFYKAIK
    FTNIAINKFYKNGNWYTTESHKFIASLNEKYKKSAALTMLLNLKYILPISNKDLFIKVYKETYENISKLRLDSINNPSFY
    RLRFPTIKITGNRKNLNLLIDNKLPLKYHLIFKETQDKYLYLTACYNKICFIHTKSPYELIKIINNKINNN

    >gi|291279825|ref|YP_003496660.1| thiosulfate sulfurtransferase [Deferribacter desulfuricans SSM1]
    MKRLFLVILCLILVGSAYAAKLDSPLVSVQWLNKHLDEVIVLDVRKSMSDFIRGHIPGARFVDKSKVRVDKNINGKMLEG
    FLPDKNYFESFLRKLGVNNDSVVVIYTKQKGAVNAKYAARLYWQFKVYGFENVALLDGGYYKWVDEIKKIEKGAGKKINF
    GNVELKNVDKNMIADFENVKKLMSDQNSILIDFRNLELYLGISKKSYVLYPGHIPGSYMMPESIFFKNDGTYISKNDIYK
    TLRALNIDINKKLIVY
    CNTGNHASVGWFILHELMGAKNVLLYDGSLIEWTNLNMPTKQFVIENFTKF

    >gi|291280048|ref|YP_003496883.1| redox-active disulfide protein 2 [Deferribacter desulfuricans SSM1]
    MNVKVLGTGCRNCEFLYQATLKALEELQIDATVEYVKDINEISKYVMFTPGLVINEKVVHEGKPLPNVEQLKEIISKIK

    >gi|291280061|ref|YP_003496896.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Deferribacter desulfuricans SSM1]
    MKKVVIIGGGPTGRVVVHSLHAAEGEFDITLIKDEEINVNRCAVPYGIIDKKPVEKFCIPNSLVTDFGAKLVIDTATEIN
    TENNFVLTEKGDRYDYDYLLLATGSKPFIPPIEGVNLGNITTVRSKQDMERLREFAKKYKKCVIVGGGYIGVEVAVVLKR
    LGLDVTIVEMLDHILLATMDDDFAIEVENHVKDEGINVVTGDKVIAFEGDESVKKVVLESGEKIDTDFVVISVGVVPNVE
    LAEKSGIEVSKFGVKTDEYLRTNIENIFAAGDCAEKKSFITKKPTRGEFGTNAVFMGKVVGANIAGKNVKFPGVINANVS
    TAFEYSFGSAGLIEKAAKNEGIDVVVGESEVMDMYPMMDGVSKIKTKLVFERSTGKLIGGSVLRKGHCVAANVDFISFAI
    QKSATIEEILVHQYSTHPELAAKPSDNIYVFAAKDALKKM

    >gi|291280075|ref|YP_003496910.1| molybdopterin oxidoreductase 4Fe-4S ferredoxin, iron-sulfur binding protein [Deferribacter desulfuricans SSM1]
    MSKKKWAIVFDDSKCIDCKACTVACKMENHVPLGMYFYRNWVAERTKESEFPMIKRMFRPSQCQQCENPPCVHVCPTQAS
    YQTEDGVVLVDHNKCILCKYCMTACPYDARYVNEEIEAVDKCTFCYHRLPEGREPACVETCPPKVRVFGDLNDPESEVSK
    LVKMHDTEVLKPEKGTHPKLIYIKR

    >gi|291280235|ref|YP_003497070.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Deferribacter desulfuricans SSM1]
    MSKEKLIIIGGVAAGASAAAKARRTNEFIDITIYEKTANVSYANCGLPFYIAGIINNRKNLLLHTPKSLGKRFNLNIFTK
    HEVIDIDPKSKTVLVKSGDNTFEDKFDKLIIATGAKTVIPKIKGIEQTPFFQMKTVEDVDQIKEFIEKNNPKSAIIIGGG
    YIGVEIAEALYHSNIKATIIEAQKHILPNYSHEIVLAIEDKMKEVGVNIHTEKFVEEVSYDNKHYKVILNDGTILHSDML
    FVATGVAPNIELAKKAGITLGETGAIKTNEYMQTNYDFIYAAGDAVEKFHIVSKQYVFLPLAGPANREGRVAGCNAAGGM
    LQNPGVLGTSVVGFLDKIVAKTGLSFDEAIAAGFDADFVYTEDPDHAEYYPGYKYIFMKTVFDKRTKKVLGVEASGSYAT
    VRKVDAIASAIYGDLTIYDLENIDFCYAPPFGSARDNINKAGFVAANQDRGEGFGIKPQEFIEIYNKDCSIQIIDVRTKL
    EYKAYRFEKAKNIYVNDIRSHLSEIDKGRPVYIY
    CAVGFRGYLATRFLRNLGYEAFNIIGGIEAINRIKRFNFVGGSNGC
    CFKN

    >gi|291280286|ref|YP_003497121.1| Na(+)-translocating NADH-quinone reductase subunit E [Deferribacter desulfuricans SSM1]
    MMLEHLLSLFVKSIFIENMALSFFLGMCTFIAVSKKMETAVGLGMAVIIVQFITVPANNVLYQYILRDGALSWLGLKNVD
    LSFIGLVSYIGVIAAMVQILEMVVDKFFPKLYNSLGIYLPLITVN
    CAILGGSLFMVQREYTHIESIVYGLGSGMGWALAI
    ILLAGIRDKLKYSNPPKGLEGVGLTFIVAGLMAIAFMIFSGIKL

    >gi|291280287|ref|YP_003497122.1| Na(+)-translocating NADH-quinone reductase subunit D [Deferribacter desulfuricans SSM1]
    MKKYKEVLLKPIFRDNPIAVQVLGICSALAVTSKLETAIVMFLAVTFVVAFSNLFISLIRDNIPTNIRIIVETTIIATLV
    IIADQFIKAYFFEISKQLSVFVGLIITN
    CIIMGRAEAFALKNGPIESFLDGIGNGVGYGGILIVVAIIRELIGSGKLLGI
    TILKPVSEGGWYTPNGLFLLAPSAFFIIGLLIWHVKRQIGDYDA

    >gi|291280309|ref|YP_003497144.1| rhodanese domain protein [Deferribacter desulfuricans SSM1]
    MSIWYYLLSLLEEVAMKKKLIKVLLALFVIGILFSGCAKQVQAPKAEKPRKSVEQMVKEAGFEIVDFNYVKGLVGNGLRK
    FNKVVFIDARPERKYDSGHIPGAISIPDTKFDKYVGQLDQLKVTKDRLLITY
    CGGYKCVKSYHDAKYLRDKGYTNIKVYL
    AGMPDWSKKSYAEITYKYAKKLLDKGVLFVDARPALKWKKGTIPGAINIPDTKFMRDPNPYLNVLPEDKNAPIVVF
    CAGY
    H
    CIKSHNVARLLKEKFGYKKVYVYAGGVPEWKAKGFPIVKPGKAVAKKTTAAKKSVSAIKPGPDEGTVDIEFFKTLIDDR
    PDNIHIVDVRTPEEFEEGHVKGAINIPVDDMYKKGCDYIINKLPKDGYIIFM
    CASGGRAGEMYFGLKEDCNYKEMDRLYF
    LDAHVNYDSGRCEVTE

    >gi|291280314|ref|YP_003497149.1| thioredoxin family protein [Deferribacter desulfuricans SSM1]
    MRIKSILAVSILVLSLLFSSCSQNQQAENTKQIVSSLETINVAQFKELKNRYKDKVILVNFFASWCPPCNQETPGFVRVY
    NKLKDKGFIILAFSIDDNVDDAVKFVNKYGITYPVYHADRSLEAYFNVSTIPTSVFYKKGGTLYNLHVGYIDEKDLENYI
    LDLLNK

    >gi|291280352|ref|YP_003497187.1| NADH-quinone oxidoreductase subunit F [Deferribacter desulfuricans SSM1]
    MSAQNLDRIEVHVCMGTAGVASGGAEVMAAFEEEFKKHGLIGEVKERNCKVKATGCRGLCARDVLVDIHIPGQEEVTYEH
    VTPEIVPTIVEEHILKGEVVKKWAAKKDYYDFYKLQKRYVLADCGKVDPEDIDDYIAHGGYEAIKKVLKEMTPEEVIEEV
    KKSGLRGRGGGGFPTGLKWTFCRASKGDLKYLICNADEGDPGAFMDRSIIEGNPHVVIEGMLIAAYAIGCKEGYIYCRAE
    YPLAIKRVKKALKIAEERGFLGKNILGTDFEFHLHLKEGAGAFVCGEETALIASIEGERGMPRPRPPFPAVKGLWGKPSN
    VNNVETFANLPLIINNGADWYASIGTEKSKGTKIFALSGKVKSTGLIEVPMGVTVRQLVFDVGGGIPKKRKIKAVQLGGP
    SGGCLPESLLDTPIDYDSLIAAGAMMGSGGVVVMDETNCMVNVAKFFLTFTQRESCGKCIPCRIGTKTMLDILERICAGE
    GREGDIELLESLAMDIKTASL
    CGLGQTAPNPVLTTIKYFRHEYEAHIKDRKCPARECPELIEFVVDEDRCKKCGICFKVC
    PVGAISWEKGKPAYIDKSKCVKCRECIVNCPFNAID

    >gi|291280369|ref|YP_003497204.1| hypothetical protein DEFDS_1997 [Deferribacter desulfuricans SSM1]
    MKKYLILLLIIFIADISYSSNRLSVKEYEGIIKGEKSDVIVVFWASYCPYCKKEIKELHENNLFLSKKNINVILVAIDKI
    ESSAKRAYKKLNVNYPFYLASEELVNHINARFVPITAVYNKKGELVDIAPGYKTFDEILEMLKE

    >gi|291280565|ref|YP_003497399.1| hypothetical protein DEFDS_P015 [Deferribacter desulfuricans SSM1]
    MILFTKLKFNKFLIILSLIIFIVSINIRTGFSNNDASIFGIGDNFYDEINLQVGLRGIKIPDITQELRGKPTVAVGVTTT
    CPFCREYVKTLSQLYPNYKGLINVMLCVVDFRNAKKYIDQYPEFVIFPASLTGFTRLTSVPYTVILDREGNVLAQYKGGL
    SGAYLKQILDYLVKNY

    >gi|291280607|ref|YP_003497441.1| hypothetical protein DEFDS_P061 [Deferribacter desulfuricans SSM1]
    MKKNILKIINFVMLLLFVLTSISMASGNSYSNTISQKLKKIIESKDNNIEVTVEKSIPSKEIAGFAYVLLKIHPKGNKEL
    SQELFVLSNGKYIIPALIDIDKDLNMLDLVKIDINKIQFNPDKNKLELGNADAKVKIVMFSDFE
    CPFCRQAFPFIKNLAQ
    KYNKQVAVYHYNFPLNFHKHARNLAIVYEAGKELGLNLADVLYSMKLDNIKSIDDILNNLKDKIPAPKYGKLKDLVKKSN
    KYNKIIESDMKVGSDLGVKGTPFFIINGSIISGFNPNLIKIAVDKYVKSK