Dechloromonas aromatica RCB uid58025

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|71905690|ref|YP_283277.1| rhodanese-like protein [Dechloromonas aromatica RCB]
    MPMQHLDPLAAHAFLQHQPLAVLVDCRTEIEHMYVGHPAGAEHVAWQEGPDWEIDPKFADKVKRLVRGDLSRPLLLICRS
    GRRSVDAGLALEAAGFTNVINVLEGFEGPLDEDYHRGKLGGWRCRGLPWYQS

    >gi|71905777|ref|YP_283364.1| electron transport protein SCO1/SenC [Dechloromonas aromatica RCB]
    MIRLLAFLFILLITGPAAAQATHSLELLKEGSTEGINPRYLLQDPNGRSVTSEDFRGRYQLIAFGYTYCPDICPTTLVEM
    AEILKQLGKEAKNIQAIFISVDPERDTGKILKTYTEFFDPRILGLTASPALVRRTAENFKVRYAKVQEPGATSDRYAVDH
    SAGMILLGPDGNFIKKFAFAMPVSEITEQISNLINNR

    >gi|71906080|ref|YP_283667.1| dihydrolipoamide dehydrogenase [Dechloromonas aromatica RCB]
    MSNLVEVKVPDIGDFAEVPIIDLFVKVGDSIKVDDAICTLESDKATMDVPSPVAGVVKEVLVQLGAKVAEGSLLIKVESG
    AAAAAPAPQAAAPAAAPAAVPVAAPVAGSHAGGADIECEMLVLGAGPGGYSAAFRSADLGMKTVIVERYATLGGV
    CLNVG
    CIPSKALLHVAAVMEEAEHANDLGVTFAAPTVDIDKLRAHKDKVVGKLTGGLAGMAKGRKVEIVRGYGTFIDPHHIEVEV
    TDGTGQDKTGAKKIVKFQKCIIAAGSAAMHLPFIPKDPRIVDSTGALELRFVPEKMLVIGGGIIGLEMATVYSTLGAKVD
    VVEMMDGLMQGPDRDAVKVWEKQNAKRFDKIMLKTKTVAVDAKDDGLYVKFEGEGVSPEPVKYDMILQAAGRTPNGNKIG
    ADKAGVAVTERGFINVDAQMRTNVPHIFAIGDLVGQPMLAHKAVHESHVAAEAAAGQKSAFDASVIPSVAYTHPEVAWVG
    VTEDQAKKDGRKIEAAKFPWAASGRAIANGADYGFTKLIFDAETHRVIGGAIVGPNAGDMIGEVCLAIEMGCDSVDIGKT
    IHPHPTLGETVGMAAEVAHGTCTDVPAPRKK

    >gi|71906128|ref|YP_283715.1| glutathione peroxidase [Dechloromonas aromatica RCB]
    MFSSLKRCFGIAALITVGVVPVAAAAECPPLLNHSFASLQDGKPMPLCQYAGKVILVVNTASYCGFTSQYDGLEKLYARL
    KDKGLVVLGFPSNDFGEQEPGSEKEIADFCRLTYGVEFPMVSKTVVKGKGAHPFYLKLAEITGSKPKWNFHKYLINRDAT
    QVVAYTSFTKPDDKDLLKKIDEFLK

    >gi|71906172|ref|YP_283759.1| thiol peroxidase (atypical 2-Cys peroxiredoxin) [Dechloromonas aromatica RCB]
    MTQSVTLGGNAITIAGKFPNKGDSAPAFSLVAKDLSDTTLASFAGKRKILNIFPSIDTPTCATSVRQFNAKANGLPNTAV
    LCISADLPFAQARFCGAEGLDNVVTLSTLRGREFLEAYGVAITSGPLAGLTARAVVVLDENDKVIHSELVSEIKNEPDYA
    AALAAL

    >gi|71906178|ref|YP_283765.1| methylated-DNA-(protein)-cysteine S-methyltransferase [Dechloromonas aromatica RCB]
    MQTRPNQTYQAIVAAPGFCLGVQCDDDEITGIDFLEPRPEIAASSPLAAEAVRQLKAYIADPHFAFGLPLRPAGTTFQRR
    VWEQISAIPTGQTHTYGEVAKNLKNAPRAVGQACGSNPYPVVVP
    CHRVVATGGGLGGFSRERGGFLLDVKRWLLTHENSL
    PG

    >gi|71906203|ref|YP_283790.1| Alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Dechloromonas aromatica RCB]
    MAAWLNCMFPPNLKTDHDKEFPMAVLVGKQAPDFTATAVYGNNEIKELKLSSFKGKPVVLFFYPLDFTFVCPSELIAFDH
    RLEEFKQRGVEVIGVSIDSQFTHLAWKNTAVKEGGIGPVGYPLVADVKHEICRAYDVELEAAGVALRGSFLIDKNGTVMH
    QVVNMLPLGRNIDEMLRMVDALQFFEENGEVCPAGWNKGKPGMVASTEGVAAYLAKNAKKL

    >gi|71906246|ref|YP_283833.1| UBA/THIF-type NAD/FAD binding fold:MoeZ/MoeB [Dechloromonas aromatica RCB]
    MTDDQLLRYSRHILLDALGIDGQAKILASHALIIGAGGLGSPAALYLASAGIGKITLVDDDTVDFTNLQRQILHTQSRVG
    MAKTESGRQALSAINPEISIVPLQQRLSGTELDALVASADIVLDCTDNFATRHAINRACVLHKKSLISGAAIRFDGQISV
    YDLRRDDSPCYHCLFPEGEDVEEVR
    CAVMGVFAPLTGIIGTMQAAEALKLAAGIGESLTGRLLLLDALTMEWRTVRFKKD
    SGCAVCGPNADAH

    >gi|71906251|ref|YP_283838.1| rhodanese-like protein [Dechloromonas aromatica RCB]
    MPMEFINQNVLLISLVVVSGLSMLWPLLARPSGNAVTPAEATQLINREDAHIVDVREADEYASGHLPDAKNIPVAKLADR
    IGELEKFKDKPIIVC
    CATGMRSNKACAELKKQGFDKLHNLAGGVDAWVGAGYPIKKGSKSK

    >gi|71906252|ref|YP_283839.1| glutaredoxin GrxC [Dechloromonas aromatica RCB]
    MTAPVLMYTTAVCPYCIRAKQLLAARGVTQIEEVRVDLDPERRDEMMLKTKRRTVPQIFIGDTHVGGCDDLYALDAAGQL
    KPLLEG

    >gi|71906293|ref|YP_283880.1| iron-sulfur cluster insertion protein ErpA [Dechloromonas aromatica RCB]
    MNAVNEMAVPFVFTDNAAGKVKELIEEEGNPGLKLRVFVTGGGCSGFQYGFTFDEEVNEDDTTMEKNGVTLLIDPMSYQY
    LVGAEIDYTEGLEGSQFVIRNPNATSTCGCGSSFSA

    >gi|71906341|ref|YP_283928.1| redox-active disulfide protein 2 [Dechloromonas aromatica RCB]
    MLIKILGSGCAKCNRLEQLTREVLTEQGLNATFEHVTAMDEIMAYPIMTTPALVVDEVVKVSGRIPSKDEIAAWLKA

    >gi|71906350|ref|YP_283937.1| ATPase, E1-E2 type:copper-translocating P-type ATPase:heavy metal translocating P-type ATPase [Dechloromonas aromatica RCB]
    MPQASCYHCGLPIPDNVDLSVKIGGEPRAMCCFGCQAVAQSIVENGLEDYYRSRDSLPESPREAMPAVLDQLALFDHAEF
    QKSFVKELGQNEREASLLLEGIT
    CAACIWLNEQHIGHLPGVTAMDINYTTRRARVRWDETRIKLSDILGAIAAIGYRAYP
    YDAAKNEEISRKERRGALWRLWVAGFGMMQVMMYAYPVYIADGDMAPDIESLMRWASLLLTLPVIFYSSAPFFRNAWRDI
    KLRRVGMDVPVALGVGAAFLASCWATFMQAGEVYFDSVTMFIFFLLGGRFLEMTARQKALSVTEALAKLMPAFAQKMPGF
    PSDRTTEQCVVADLHPGDYVLVRAGDIVPADGRVIDGISCANESLLTGESKPVPKSPGDAVTGGAINAESPLVVRVDQVG
    EGTRLSAIIQLMERAAAEKPKIVELADRIASYFVAVLLAVAVFVAIGWYFVDPSKALWITVSVLVVTCPCALSLATPIAL
    TVSAGALAKDGLLVTRGHAIETLARATHFVFDKTGTLTTGRMHLVDVLPVAGLGKDECLAIAAALEHASEHPVATALRRA
    AGAQLPEISAALSEPGQGIEALVAGRRYRIGRPEYALGLGTGALPDAAAAWLESGDTVVVLGDETGCLALFRIGDELRPE
    SASLISELLAAGKKVVLLSGDAASVANRVAASLGIDDVRAGVTPQGKHDCVKRLQAEGALVAMVGDGVNDAPVLAQAQVS
    VAMGGGAQLARTQSDFVLLSENLDHLRYGLRRARKTLLVIRQNLWWSFAYNFIALPLAIGGYVTPWLAGIGMSASSLLVV
    LNSLRIQRVETD

    >gi|71906451|ref|YP_284038.1| glutathione S-transferase [Dechloromonas aromatica RCB]
    MMNLYSGTTCPFSHRCRIVLFEKGMDFQVIDVDMFNKPEEMAAINPHNRVPVLVERDLVLFEPNIINEYIDERFPHPQLM
    PADPIMRARARQLLVGMEREIFSFMEVIEKNGKTADKARQEIKARLTEIVPIFNKQKFMLGDEFSMLDVAIAPLLWRLDH
    YGIDLGKAAAPLMKYAERIFSRQGFIDALTPSEKAMRK

    >gi|71906567|ref|YP_284154.1| thioredoxin [Dechloromonas aromatica RCB]
    MSENLHLVCPHCAAVNRIPAAKLGDAPNCGQCKQPLFTGEPLELNAANFDRHLSRNDLPVVVDFWAPWCGPCRTMAPTFH
    QAAIDLEPYARLVKVNTEAEQQLAARFNIRSIPTLAVFLNGREIARQSGALDLGSLKRWLQPHLYKS

    >gi|71906673|ref|YP_284260.1| DSBA oxidoreductase [Dechloromonas aromatica RCB]
    MLTIEIVSDIVCPWCFIGLRRLDLAIAQVRQEIPDFSCTKRWRPFFLNPDTPPEGEPYLPFLEKKFGGRAPVEALFERVR
    AAGRPYGLDYAFEKIERRANTLQAHRLIHWAQQHGDAERLVERLFVAQFQRGEAVSDPALLVRLAAECGYPAATVADYLA
    SSEDADTVRAMEAEVRAAGISMVPTFIVDRKMVVVGAEDPSILAGAIRQVLAERG

    >gi|71906690|ref|YP_284277.1| ATPase, E1-E2 type:copper-translocating P-type ATPase:heavy metal translocating P-type ATPase [Dechloromonas aromatica RCB]
    MSDEADRGRVVEFAIGGMTCAACSARLEKVLNRQAGMQANVNLAAERARVRLSAMADEAAVVAAVAKAGFTAELVDSQTR
    EREKAEKLRVYQREIRRFWIAVALTLPLVGQMLFMFGEHGHLNEMPRWLQLALATPVQFWIGWRFYDGAYKALRGGGANM
    DVLVALGTSMAWGFSTVVTLFGLNQHIYFEGGAAVITLVLLGKLLEARAKARTSEAIESLIRLQPKTARVERDGQWVEMA
    VEALMPGDIFLVRPGESVPVDGEVVDGESSVNEAMLTGESMPLGKRAGDRVFAATANGQGALRCRATGVGEHTLLAGIIR
    LVGEAQGSKAPVQRLADKISSIFVPTVCIIALVTFAGWWIYSGDFSEALVNAVAVLVIACPCALGLATPTAIMVGTGQGA
    RAGILVRNAEALERAERITVLALDKTGTLTCGLPQVTDVVPRVLAGNEALRLAALLEQNSEHPLARAIVAAAGAVQSGGD
    DRKVAAFKAIPGCGVEGEIDGRVLRLGSPTWLGLAADLAVGELQQAGKTVVALNEGDSTLAIFAVADALRPSSRLAVSRL
    RERGIRVVMLTGDNVATAAAIAAEAGIDEYRAGILPGDKAAAVQELKAGGGLVAMVGDGINDAPALAAADVSFAIGAGSD
    AAIEAADLTLIRSDLLGVFDAIDLSAATLGKIRQNLFFAFIYNVLGIPLAALGWLNPVVAGAAMAMSSVSVVSNSLLLKR
    WRPKDRAGRQGMESR

    >gi|71906693|ref|YP_284280.1| selenophosphate synthetase [Dechloromonas aromatica RCB]
    MPEEKIRLTQLSHGGGCGCKIAPAVLQKILAGTTGSIIPPQLLVGTETSDDAAVYQINAQQAIVATTDFFMPIVDNPRDF
    GRIAATNAISDVYAMGGTPLFALALVGMPVNVLPLETIGQILQGGEDVCRAAGIPIAGGHTIDSVEPIYGLVAIGLVNPE
    HLKRNSGAKSGDKLILGKQLGVGIYSAALKKDQLQAKDYEAMVETTTQLNTPGPVLACLDGVHAVTDVTGFGLAGHLLEV
    CKGSGLRATVNYQDLPVLPKAREFMQAGLMTGASGRNWASYGEGVRIADGLEGIAQTLLTDPQTSGGLLVSCSPETVTEV
    LSLFLQHGFPHVSVIGEMAEGEPGIDVI

    >gi|71906729|ref|YP_284316.1| glutathione peroxidase [Dechloromonas aromatica RCB]
    MSQTLYDFSAQRLNGEPQDFEAYRGKVLLIVNTASECGFTPQYTGLEELYWMFKDRGFVVLGFPCNQFGGQEPGDAEAIG
    QFCQTRFDVTFPLFAKVDVNGDSAHPLYTWLKHEAAGVLGTEAIKWNFTKFLIDREGKVVHRYAPATRPDELVEAVEAQL


    >gi|71906742|ref|YP_284329.1| glutaredoxin family protein [Dechloromonas aromatica RCB]
    MKTVVRAFFKTLRVVIGPFMLLGEFVTRPKGVLRSAASQAEVDQQCASIVLYQYKTCPFCIKVRQEMRRLALTVQKLDAQ
    QPGANREDLVSGGGKAKVPCLKITDPAGKTQWLYESGEIIKYLRSRFATA

    >gi|71906797|ref|YP_284384.1| SoxR-reducing system protein RsxE [Dechloromonas aromatica RCB]
    MLITLSEIKQISLNGVWKQNSSLVQILGMCPLLAITTTLVNGVMLSFATLLVMAFSNFFVACLRNFIPYEIRIPVFILVA
    AAVVTVIDLGMNAYMHDLYLILGIFIPLIITN
    CLVLGRIEAFAAKNSPLGSALDGAMMGVGMIWTLGLLGGIREFIGAGT
    VLGGIELVIPGTSALQILPADYPGFLVAILPPGAFICLGCLVAWKNWVEARAAQRAQLPPPAPVAAGGCH

    >gi|71906802|ref|YP_284389.1| electron transport complex, RnfABCDGE type, A subunit [Dechloromonas aromatica RCB]
    MSHYIFILIGTVLVNNVVLVRILGLCPFMGVSKKLETAYGMGAATTFVLTVGTGASWIIDHYLLMPFDLMYLRIIAFIVT
    IAAFVQLTELVIQKTSPMLHQTLGIYLPLITTN
    CAVLGVPLLALGAKYDFVESLLFGAGSSVGFSLALILFAGLRERIEG
    ADVPTYFKGTAIALVTGGLMSLAFMGFAGLDKYQ

    >gi|71906862|ref|YP_284449.1| Alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Dechloromonas aromatica RCB]
    MAQTPQHRGIRMLDTKIPDFSLPATSGTTFNLAAQAGKIVVIYFYPKDSTPGCTTQGQNFRDLHDQFAAANAVVLGISRD
    SLKSHENFKAKQEFPFELGSDADEAVCNLFSVMKMKNMYGKQVRGIERSTFVIDLNGVLRREWRGVKVPGHVQEVLDFVK
    TL

    >gi|71906928|ref|YP_284515.1| thioredoxin reductase [Dechloromonas aromatica RCB]
    MPQNVRHNPLIILGSGPAGYTAAVYAARANLKPVLITGMAQGGQLMTTTEVDNWPAAADGIQGPELMANFEAHARRFETE
    IVFDHIHTTQLTEKPFTLIGDAGTYTCDALIIATGASAMYLGLPSEETFAGKGVSA
    CATCDGFFYRNKPVAVVGGGNTAV
    EEALYLANIASHVTVIHRREKFKAEKIMQDKLFQREKEGKVTILWNSTLDEVLGDDSGVTGLSIKNVKSGETQKVDVHGV
    FIAIGHKPNTDIFAGQLEMDNGYLVTQAGRNGNATQTSIPGIFAAGDVQDQIYKQACTSAGSGCMAALDAERYLDNLGHA


    >gi|71907014|ref|YP_284601.1| glutathione S-transferase [Dechloromonas aromatica RCB]
    MPKPLLYTYRRCPYAMRARMALLVAGIDFDAHEVSLRDKPPEMLARSPKGSVPVMLLPGGQVLEQSWDIMRWALEQQAAK
    SFWAAAQAAENLDWLARNDGVFKHHLDRYKYPERYEEASREKHREQALASFLRPLNSRLEQCSFLGGSEPCATDMALFPF
    VRQFAAVEAAWFECEELSALQAWLAGWLASPLFLHCMQKLPSQTTVPFPSFG

    >gi|71907021|ref|YP_284608.1| hypothetical protein Daro_1389 [Dechloromonas aromatica RCB]
    MEISQLGEALQRDAVWVVFLNVLLQQIGLPVPAVPTLLLAGSLIVGSWQFASVLAAAIVASVLADWVWYLAGRAFGYRVL
    AGLCKLSINPGSCVSQTEARFVRWGLGSLVFAKFVPGFSTVAPPIAGSLRMGLPGFLLAAATGAALWAGLGLGTGWLLRK
    EVHRAIEALDQNSGSLLGLIAGTIALWLGWKLWQKYRFRQLSAVPHITPVELMAAMETDQPPLVLDLRGHSMVAETGPIT
    GATVAEHDRLLDAVGEWPKNLPIVTLCA
    CPEDAGAIQAARQLLNAGFLSVRPLKGGYEAWLATANGNNV

    >gi|71907084|ref|YP_284671.1| nitrogenase-associated protein [Dechloromonas aromatica RCB]
    MAVITFYEKPGCKGNLRQKTLLAAAGHTVQAKSLKTEPWTADRLLAFLGKLPVTEWFNRAAPDIKSGQIVPENLGFEDAL
    HLLLGNPLLIRRPLMEVGDERMVGFDVATVDAWLGLNNVALPEGNIEACVHSPEGHGHCGSHAHDHEQEESSHGSCGHH

    >gi|71907090|ref|YP_284677.1| rhodanese-like protein [Dechloromonas aromatica RCB]
    MSKSDSFECIPGSMAAELIRSESDVALFDVRDSMAYRAGHVEGAAHLSEDRLLAWMKRLPKETPVVIYCYHGNASKTYAQ
    MFIDFRYTRVFSVDGGYPALDMALSAAA

    >gi|71907104|ref|YP_284691.1| electron transport protein SCO1/SenC [Dechloromonas aromatica RCB]
    MHRRQFLALSFALLAACTPAPEAFHNTDLTGATFGRGFELTDHDGRPRSLADFKGRAVVVFFGYTSCPDICPTTLARLAG
    VMTALGEDAGRVQVLFITLDPERDSSERLKTFVPWFHPSFIGLRGDVGQIKAVTEEFRVFGARRPVDGELGYVIDHSTGA
    YVYDPAGRLRLYVKDTASVEDIVADIRQLLAH

    >gi|71907122|ref|YP_284709.1| SoxR-reducing system protein RsxE [Dechloromonas aromatica RCB]
    MANSDYKTIVKDGLWDNNGVFSMLLGMCPCMAMTTSATNGFGMGLATAVVMAASSYLVAVFRNRITTEVRIPVYILIVAA
    MVTVVDLGMNAWMHELYKVLGLFIPLIVSN
    CLPLARLEAFAAKQSPTPAFLDGLFMGLGFTIALTAIGAVREIIGSGTLF
    ADASLLLGPSFKAIEMRLLPADMGVLMMILPPGGFIVTGLLVVGKRLMDLAAGKEIQMAGAHAL

    >gi|71907124|ref|YP_284711.1| electron transport complex, RnfABCDGE type, A subunit [Dechloromonas aromatica RCB]
    MKEFALMMIGAALVNNVILARFLGLCSFMGVTTRVDTAAGMGLATTFVITVSSMADWAVQTYLLDAYGLGFLRTVTFILV
    IASAVQFTEMTIKKVSPSLFQMLGIYLPLITTN
    CAVLGVALLLVEGKMGFLSSTMFAFASSVGYSLVMIIFAGLRERLVL
    AHVPRLFAGPPIAFIVAGMLAMAFMGFSGIATS

    >gi|71907145|ref|YP_284732.1| HesB/YadR/YfhF [Dechloromonas aromatica RCB]
    MINLTPAAVKAVQRFIRGSETPVIGLRLTISGGGCSGLQYGMKLENEKADDDWEMEVDGVKLLVDAMTMPMIDNVTVDFV
    DTLTHTGFKFDNPNASAQCSCGSSFSV

    >gi|71907156|ref|YP_284743.1| carboxymuconolactone decarboxylase [Dechloromonas aromatica RCB]
    MSRLTIPQTDQTPSASLPLLEAVNRQLGVVPNLMKLVGNSPAALEGYLSLNGALGKGTIGTKTSERIALAVAELNGCGYC
    LSAHSYLGSNLAKLDASELDANRHGGSNDPKAAAALRFAAQIVGTRGHVADADLVSVKAAGYSEAEIIEIVLLVALNTLT
    NYVNNVAQTDIDFPVVKPFK

    >gi|71907193|ref|YP_284780.1| thioredoxin [Dechloromonas aromatica RCB]
    MSKLSASLIFCLFSGLAAADELPSSAPLFAATLNDVDDKPVALERYKGKPLVVNFWARWCGPCRVEIPELIKFRAAHKGK
    VEVLGIGIEDNAEPAKEFAKAYDMDYPVFVAKDKGIPLMQALGNTKAGLPYTLFIDRNGQVVQRKMGIVKKADFDAVQDM
    LLKK

    >gi|71907209|ref|YP_284796.1| electron transport protein SCO1/SenC [Dechloromonas aromatica RCB]
    MGERILMVIAALLALVVAGVAVFWQPEMPERPIPAAVIAAGGDFTLQSASGPVSLKDYRGKLVLLYFGYTFCPDICPTSL
    AATSEGLKQLKPEELAQVAMIFVSVDPKRDTPDRLKEYVEFFHPAIVGVTGTPENIAEIAKRYGVFYAEQKVETAGGGYV
    VDHSADTFIVAPDGQLVGKIAHATPPDQVVVAIRKHLKQP

    >gi|71907420|ref|YP_285007.1| rhodanese-like protein [Dechloromonas aromatica RCB]
    MNETTMRRLLLACLLAASQFAHAEVIDIDNAQLEKLAKSGIPVIDIRLQSEWEETGIISGSKLLTFFDEKGRHDAAGWLE
    KVKPIAKPNEPVIVI
    CRTGNRTKPVSQFLSQQAGYATVYNVKNGIKGWIGAGGPVAPATQTIASCKAAKTC

    >gi|71907450|ref|YP_285037.1| DsrE-like protein [Dechloromonas aromatica RCB]
    MQSILIIIHAPPYGSERCLSALRLATALAGRDDKPELSIFLMSDATVVGLPNQVDGAGNGLQGMVEQLVAAGVTIKLCRT
    CALARGLGELPLIPGTSIGTLIELAEYTVRADKVITF

    >gi|71907465|ref|YP_285052.1| ATPase, E1-E2 type:copper-translocating P-type ATPase:heavy metal translocating P-type ATPase [Dechloromonas aromatica RCB]
    MKNFRIAHRLRRRLRVLAPSLEKEQERCYILEILLRKHPAIKEVRIVADIGSLVVEYDPVELPEERLLATLDAVLGNLIA
    APTAAPVVAAPVDGPVQECSLAIEGMS
    CASCALLIEMKLKRDPRVRYASVNFAAETVTVNGVIDRDGVAKVVSALGYATR
    PMDTLAQRRLIVEREKERVEEARKRFIQAAILTVPVMISGMAMHRSPALRVMEFALSSAILFGSSNSIFRKAWMLAKQGE
    ANMDTLIAIGAGAAWAYSIPDVLQMHHHVYFESAAGICTFVLLGRYMEERAKGKAGEAIRKLIELQPETAQRIEADGTEF
    EVAIDNVQIGDRLRVRAGDKIPTDGCVLEGASSVDEAMITGESLPVAKTAGDKVIGGCLNGNGSFVMTVTAVGGDTVLSG
    IVKLVDQAQGSKLPVQKLADRISARFVPAVGGIAALTFAGWAMAGHPVSRALAHSVAVLLIACPCALGLATPTAIMVGTG
    QAAKRGIYIRNGEALETAAKLTTVVFDKTGTITEGKPVVTDTFILSGMSEARLARLIGAAEAGSEHFLARALADWSRPRQ
    KDALTAESFAAHPGRGVTAQVDGLDVVIGNAALLDEMGVAYAPLADEAHRLAEQGKTPVFAAVDGHSVAIFAIADQARQG
    AREAIALLHRLGLKTVMATGDLDAVASHVAREVGIDHVLARCTPADKLAAIRQLQEAGEKVGMIGDGINDAPALAAADVG
    FAIGGGADIAVESADITLVGGDIARVAAGIDLSRRTMAIIRQNLFWALGYNVIAIPVAAAGRLNPMIAAAAMAMSSTSVV
    ANSLRLQR

    >gi|71907468|ref|YP_285055.1| cytochrome C biogenesis protein [Dechloromonas aromatica RCB]
    MRVFLLIAALLLSACGNEAPKANINIGSIAPTFQAFGADGSAVHFPAAYFGKPLVIRFWADWCKYCEGEMKAIETVYQAN
    RGKLQVLAINAGQDKATINAFIKKISVTYPALLDENSAIARSYGVVGLPTTFFIDGKGIVRGKIVGEADETTFARHVQEL
    LQ

    >gi|71907518|ref|YP_285105.1| methionine sulfoxide reductase B [Dechloromonas aromatica RCB]
    MPKIEKTDAEWRAQLDENEYRVTRQKGTERAFTGKYWDTHDDGTYRCICCGAPLFRSETKFDSGCGWPSFHTPNDEKLID
    EHVDQSFGMIRTEVTCHDCGAHLGHVFDDGPAPTGLRY
    CINSASLKLEKDGK

    >gi|71907541|ref|YP_285128.1| hypothetical protein Daro_1912 [Dechloromonas aromatica RCB]
    MTATALMPRHPVPALNVALTDGSRFVLGAAPGERFDLVVFYRGLHCPICAKYLLELERLAPEFEKRGVQVVAISSDDGER
    AQAMADKVKASTMKIGYGLSLKSARQWGLYISASRGKTSIGIEEPALFSEPGVFLVRPDGTLYYGAVQTMPFARPQFQDL
    LGAIDFAIANDYPARGEYAGPV

    >gi|71907558|ref|YP_285145.1| rhodanese-like protein [Dechloromonas aromatica RCB]
    MYKKLLLAIGLSTLALCSLAEEKELLRIIGEDKQFVVQTKSGPFVITRTMTPCAKNKGWLQPLIPVAGVHPVTEIEVLHA
    MNDKDALIVDMREPDDRIKGTIPNSYHIPYTLVAGRMDELGCSKAGGKWDCSNAKKVYAFCNGPV
    CPQSPTAINAMVRDG
    FPADKIYYYRGGMLDWDALGFPVVKDEF

    >gi|71907581|ref|YP_285168.1| HesB/YadR/YfhF:Iron-sulphur cluster assembly protein IscA [Dechloromonas aromatica RCB]
    MAVTLSDKAAQHVANFLTKRGKGIGLRLGVRTSGCSGMAYKLEFVDEVNPDDLVFEQNGVKIIVDAKSLPYLDGMELDFA
    REGLNEGFKFNNPNVKDQCGCGESFNV

    >gi|71907653|ref|YP_285240.1| glutaredoxin 2 [Dechloromonas aromatica RCB]
    MVELTLMSRGYCHLCHDMELALAPLAKEFGASVAVFDVDADPALEAKYDEQVPVLLHGETELCHYFLDEAKVREYLAEIR


    >gi|71907694|ref|YP_285281.1| OsmC-like protein [Dechloromonas aromatica RCB]
    MKRTASAAWTGGLQKGAGKISTQSGILNNAQYGFKERFEESAGTNPEELIAAAHAGCFSMALAALLENEGMTPDRLETHV
    TVTLDKVDNAFSITAIQLELVANVPGADQASLERLANIAKRE
    CPVSKLFNAPITLSVKLET

    >gi|71907877|ref|YP_285464.1| ATPase, E1-E2 type:heavy metal-(Cd/Co/Hg/Pb/Zn)-translocating P-type ATPase:heavy metal translocating P-type ATPase [Dechloromonas aromatica RCB]
    MSVRPEEIAPKRDACDHDHGRKCCAGDSSQATPADEVSLVTSDIPMGSTLTRLRIAQMDCPTEEALIRKKLGGMAAVQGL
    EFNLMQRVLSVVHDNDALAAVEAAIRELGMSSEPMQVAASATPTEQIDKPWWPLALAGVAALSAEIVHWVSMPEWVSALL
    ALIAIAIGGIGTYQKGWIALRHGNLNINALMSIAVTGAVLLRQWPEAAMVMVLFSLAELIEAKSLDRARNAIRSLVQLTP
    EQATVQQTNGDWMDMSAKAVAIGQIVRVKPGERIALDGVLTTGRSTVNQAPITGESMPVEKAIGDSVFAGTINESGSFEY
    RVTAESTQSTLARIIHAVEEAQGARAPTQRFVDQFAKIYTPAVFAFALAVALVPPLMLDGSWHDWIYRALVLLVIACPCA
    LVISTPVTIVSGLAAAARHGILIKGGVYLEEGHKLAWLAFDKTGTITHGKPALTDTVLLDQPAGLEAVRIATSLAARSDH
    PVSRAIALAGEQNNTNLLEVADFSAIPGRGVRGTVGGVNYQLGNHRLIHELGVCTPTLEAQLGELEEQGKTVILLTDSER
    VLVLFAVADTVKESSLSAIKALHELGIKTVMLTGDNAHTARAIATQVQIDEALGDQLPEDKLRAIERYALRGKVGMVGDG
    INDAPALARADIGFAMGAAGTDTAIETADVALMDDDLNKIARFVRLSRTTRTVLVQNITLALSIKAIFLVLTMLGMGTMW
    MAVFADMGASLLVVANGLRLVRQ

    >gi|71907937|ref|YP_285524.1| periplasmic thiol:disulfide interchange protein [Dechloromonas aromatica RCB]
    MATTKPMRRRALVAALSTILLGACFAANAAKPDETQLLTALQKAHPGTQFSSVARTPIAGLYEVWMNGNVAYVSARQPRY
    FLFGHLFDTQSMSDLTDPKMAQAGKAKSPDEAPQKYQPTTASPIRFEQLPLSNAIKTVHGTGQRRMAVFSDPN
    CPFCKQL
    ETELASLDNLTIYTFLLPFLGETKPIAIWCAADRAAAWQRLMLDGDDSLLNTGAACDHPIGRNLALARQLGVQGTPTLIW
    ADGTRSEGFVGQTVIESRLAATASQVAPEKQP

    >gi|71907981|ref|YP_285568.1| Alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Dechloromonas aromatica RCB]
    MLLKVGEKAPVFSLPDADMETVDLARYQGKHIVIFFYPKDGTPCCTKEVTDFSDHEDEFLRHNCVLLGISRDDCLKHAEF
    RDKEGIGIELLSDTEGVVCKQYGVWQAKDVDGHRKFGVCRSTFVIDRTGTIRHALYGVNYKGHALEVLRLVKELNS

    >gi|71907995|ref|YP_285582.1| thioredoxin-related [Dechloromonas aromatica RCB]
    MSEFSFDVTLEEFETKVLLPAQEVPVVVDFWAPWCEPCKVLKPMLEKLAEEYKGRFLLAKVNSDEFPELAQHFGVRSIPS
    VKVLFQGQLVDEFNGAIPESQIREFLDRIALPEGPEQINLREQAAALVVEGKLDEALAVLVQASQANPQDQAIQLDAVDV
    LLQLGRIDEAKQLLAGEYVNEADRANALRARLALAGGAADTAEIEARLAANPADNGARLELSRAYAAQSRFREAMEAALE
    VVIRDRAFDEGAGRKALLQLFEALGGSEQYDDLIREFRRKMSAALN

    >gi|71908152|ref|YP_285739.1| UBA/THIF-type NAD/FAD binding fold [Dechloromonas aromatica RCB]
    MEHLIDPALLDRRVSIHLVGVGGNGAQMAACLARLDIAMKAFGHPYGLHVTAFDADRVSEANVGRQLYSPADIGRHKAIV
    TIHRLNQFYGLDWIAHPTRYEAFETNRYSPLSADILVSCVDSRSARRILHEAVFDGGGRYRYWLDLGNTEASAQVVLGQG
    PRRAKGEVNLRLPCVTELFPELLDASVPDDNRPS
    CSVRVSLVSQGLFINDVAVRFAAQLLYELFSKGRLDQHGVVVNLDS
    KRTGPIEVDPKTWARFGCVMADERQDEEEAV

    >gi|71908244|ref|YP_285831.1| ATPase, E1-E2 type:heavy metal-(Cd/Co/Hg/Pb/Zn)-translocating P-type ATPase:heavy metal translocating P-type ATPase [Dechloromonas aromatica RCB]
    MSLDPHPKPLQETAHSGCAGGCSAEMTTATEIPAASDLAQSDGIPVFVIPTMDCPNEENDIRRAVAGIDGIRSLRFQLSA
    RTISIDATTDALDAALAAIRKAGFSPKAVSADQAETKNVGVSELWRSVLALGLAVGAEALDFFAPDTLPFKGFGMALAVA
    AIWLSGISTYSKGVAALRRGQLNMNALMGVAVTGAFLIGQWPEAAMVMALYAIAELIEARSVDRARNAIKGLLDLTPETA
    EVRQADGTWLDVPAAAVTLESCVRVKPGARIPLDGQVTAGSSAVNQAPVTGESIPIDKVVGDPVFAGTINETGILEFRVT
    AAADNTTLARIIHAVEQAQGTQAPTQRFVDRFAAIYTPAVFGIAVAVAVLTPWLLGWTWTQAIYKALVLLVIACPCALVL
    ATPVTVVSGLAAAARRGILIKGGVYLEEARKLRVIALDKTGTITEGKPRLVATEILPSAVPESQVLAWAASLAGHSDHPV
    SKAIATGLKVPENGLTDFVALAGRGIEARTDGQRLFLGNHRLVEERNLCSAEIEARLQAHEMQGRTVTMLASAKQVLAIF
    AVADTIKESSREAVADLHRLGVVSVMLTGDNVATAASIAKEAGIDDARGNLLPEEKLAAIEDLQRRYGPTAMTGDGINDA
    PALARADIGVAMGAAGTDTAMEAADVVIMNDDLRRIPETIRLSRRTHAVLWQNIGLALGIKAIFLGLAIFGNATMWMAVF
    ADMGASLLVVGNGVRLLRK

    >gi|71908264|ref|YP_285851.1| periplasmic thiol:disulfide interchange protein [Dechloromonas aromatica RCB]
    MATTKPMRRRALVAALSTILLGNCFAANAATLDETQLLTALQKAHPGTRFSSIARTPVTGLYEVWMNGNVAYVSARQPRY
    FLFGHLFDTKSMSDLTGPKLAQAGKAKSADKTPQKYQPTTASPIRFEQLPLSDAIKTVHGTGQRRVAVFSDPN
    CPYCKQL
    EAELASLDNLTIYTFLLPFLGETKPIAVWCATDRAAAWRRLMLNSDDSLLNTATACDHPIGRNLALARQLGVQGTPTLIW
    ADGTRSEGFVGRAVIEAQLAVTTSQVAPEKQP

    >gi|71908330|ref|YP_285917.1| OsmC-like protein [Dechloromonas aromatica RCB]
    MSGVVVVAENGKGRYQQGVTIGQHQLLADEPVSMGGADAGPAPFDFLMSGLGACTSMTLRMYAERKGLALTKISVTLSHE
    KVEVDGATRDRIHRDIVLEGELTDEQRQRLLEIANKCPVHRALSQSILLDCALSP

    >gi|71908360|ref|YP_285947.1| hypothetical protein Daro_2747 [Dechloromonas aromatica RCB]
    MQESPLSTKEKHILSCYGIKNCDTMKKAMNWLTENGFAYEFIDYKKAGVAEANLPDWSARAGWEKLLNTRGLMWKKLTDE
    ERSAVDQSKALRLMAQYPSLIKRPVLDTGSKLLVGFSPETYAAELK

    >gi|71908470|ref|YP_286057.1| dihydrolipoamide dehydrogenase [Dechloromonas aromatica RCB]
    MSKQFDVLVIGGGPGGYIAAIRASQLGFLAACAESNPYADPKGEPRLGGTCLNVGCIPSKALLHTSHLFEEANHSFEAQG
    IKVGKATIDVPVMKARKDGVVNQLTSGIKMLLKKNKVSFLAGHGSFVGKEGDYWKVKVGAEEVLTKQVIVATGSKARHLP
    NLPVDQKIVMDNEGALNQESVPKKLAIIGAGVIGLEMGSVWRRVGSEVTVLEAMPDFLAAADVDVAKEALKLFSKQGLNI
    QMGVKIGDIKATKKSVSIAYTDKDGKEQKLDADRLIVSIGRVPNTDGLNGEAVGLKLDARGFVEVDGHCKTNLPGIWAIG
    DVVRGPMLAHKAHEEGVMVAELMAGQAGHCNFDTIPWVIYTSPEIAWVGKTEQQLKAEGVEYKAGKVPFLANGRALGMGD
    PSGFVKMLACKKTDRILGVHIIGANASEIIAEAVVAMEFGGASEDLARICHAHPTLSETVHEAALACDKRTLNF

    >gi|71908505|ref|YP_286092.1| rhodanese-like protein [Dechloromonas aromatica RCB]
    MKLRLNLMCLGLIAVLVAVPGEIIFGAACAAEAPALDVKDGWFESVVDIDFVAQYAVLPKPDGVQIIDARATERRFDPGH
    IPTAMNLPERDFDRLANQLPSDKGTLLIFYCDGFD
    CMLSHNAAFKAEARGYTNVKVYAAGYPGWIKSGHIGAVSISFLKK
    TLDEGAPLTLIDSRPKEHKYDKGHIPGAISLPDSDFEKMLDRLPSDKNSPLYFY
    CDGFSCKLSSDSAEKAVKLGYKQVKV
    VPEGYPGWVKRYGPGSMLAAAAKPAIQTTADKDAISIASFERILKEAPDSVFLVDVREPAEFARGSFKGAVNIPVATVEK
    RVSELPTDKPVIFF
    CSAGGRSGDALDRARLAKPSITAYFLDANVKWMPDGAYAITPN

    >gi|71908561|ref|YP_286148.1| thiol-disulfide isomerase and thioredoxins [Dechloromonas aromatica RCB]
    MKEVKILGPGCARCKTLTEMVKQVAEQTGVAINLEKVEDMAVIIGYGIMGTPGLVINGKVVHSGSLPDPKKVAAWLQEV

    >gi|71908610|ref|YP_286197.1| thioredoxin [Dechloromonas aromatica RCB]
    MSEHIHYVTDDTFEAEVLQSQQPVLVDYWAEWCGPCKMIAPILDEVATEYAGKLKVAKVNIDDNQATPAKFGIRGIPTLM
    IFKNGNVEATKVGALSKSQLAAFIDSNL

    >gi|71908656|ref|YP_286243.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Dechloromonas aromatica RCB]
    MEIILANPRGFCAGVERAIAIVERALEKFGAPIYVRHEVVHNKFVCDDLRAKGAVFVEELDEVPAGSTVIFSAHGVSKAV
    REDAEARGLKVFDAT
    CPLVTKVHVEVGKMRNQTREVVMIGHKGHPEVEGTMGQSQGGMYLVETADEVAQLQVSDPLHLSF
    VTQTTLSVDDATVVIDALKQRFPEIQGPKKDDICYATQNRQDAVKELAGKCDLVLVVGSPNSSNSRRLKEVAVGRNVMAF
    LIDDAEEIEESWLRGKQHIGVTAGASAPETLVERVVMHIQALTGASVTHLKGIEEGISFPLPKDLN

    >gi|71908668|ref|YP_286255.1| rhodanese-like protein [Dechloromonas aromatica RCB]
    MSYTTLVDVATLQAHLDDPNWLVVDVRHQLSDTGYGERVYAESHIPGAVFLHCDRDLSGAMTGCNGRHPLPDPEKLAQRL
    GEIGIGAMTQVVVYDDAQGMIAGRLWWLLRWLGHDAVALLDGGLQTWQAMGGAMTDVLPTQVPRVFVPLSQELLVQADYV
    LERIETPQMHLVDARGPDRFRGENETIDPVGGHIPGAVNRFFKDNLLPDGRFKPAAQLRAEWLAVLAGSTPEQVIHQ
    CGS
    GVSACLNMVAMEIAGLPGSRLYAGSWSEWCADPGRPTAC

    >gi|71908739|ref|YP_286326.1| YeeE/YedE [Dechloromonas aromatica RCB]
    MMDLNSLIETLGEKTTVTLAGLLIGLLFGLFAQRSRFCLRSAVVEFWNRAGSGRLAVWLFAFSAAVIATQLFITQGWLDV
    SQARQLAATGSISGALVGGLLFGIGMILARG
    CSSRMLVLAANGNLRALLTGLIFAVAAQASLNGLLSPVRTWISGWWTIQ
    GGGTRDLLATLHMGHSGGLLFGLIWLAAAIIFARRARLGARECLGATGVGIMVGLAWLVTYQIGTQSFEIIPVQSLSFTG
    PSADTLMLVLSPPGQPWDFNIGLVPGVVLGSFLAALWGRELKLEGFKDGHSMRRYIAGAVCMGFGGMLAGGCAVGAGVSG
    AAIFALTAWISLIGMWVGAGLTNALIDRPKASTSIPTAYQP

    >gi|71908750|ref|YP_286337.1| sulfide dehydrogenase (flavocytochrome), flavoprotein subunit [Dechloromonas aromatica RCB]
    MILMKRRDFLKVGAAAGAMASLYGCAGGNKASGHVVVVGGGYGGATVAKYLRMWSEGGVQVTLIERNPTFISCPISNLVI
    GGTKTMEDITISYEGLRSKWGVRVIQDDVVSVDAAKKTIALKGGSALSYDRLVLSPGVDFMFDQIPGLNNADAQSKILHA
    WKAGPQTVALRKQLESMKDGGTYAISIPKAPYRCPPGPYERACLVADYFKKSKPKSKVVILDANEDVMSKKALFTKAWTD
    LYKGIIEYRNNSEVKDVEVGTNTAVLEFDKFKADVLNVIPPHRAGDIAAKSGIKLINNRWVDINWLSMESTSTPGIHVLG
    DAVFPAPTMPKSGHMANQHGKLAAAAILNLLSGQEPNPEPVVMNTCYSFVDSKNVIHVSSVHQYDAATKTVQPVKGAGGV
    SVARNELEAKVAMGWAKNIWADMLT

    >gi|71908758|ref|YP_286345.1| disulphide bond formation protein DsbB [Dechloromonas aromatica RCB]
    MICSKVPVRAWFATLGLGCLGLVAVGMALQTLLHLAPCPLCIFQRLLYIMIGFVGLLGFVLPAGRLLWSTLAAGLGVLGF
    GVAAYQTWMQAFPDLAPE
    CGFTDPNAIERLVDWLGMEWPSMFLATGFCTSRDWELLGLSMANWSVLIFAGIVAYAVLLFV
    RKDRA

    >gi|71908768|ref|YP_286355.1| hypothetical protein Daro_3155 [Dechloromonas aromatica RCB]
    MKTIAILALSAAANLAFALDIQPYSADTLAAKQKAGESVTLHFHADWCPTCRAQDKVLNSWKGDASVPGTLLLVDYDKER
    ELKRQLGVRTQSTLIAYKGAVEKARLAGETDPKALRALLDSTK

    >gi|71908827|ref|YP_286414.1| hypothetical protein Daro_3214 [Dechloromonas aromatica RCB]
    MEIKVNFLDKLRLEAKFDDFTVIADQPIRYKGDGSAPGPFDYFLASSALCAAYFVKLYCDTRNIPTEHIRLSQNNIVDPE
    NRYQQIFKIQVELPADISAKDRQGILRSIDRCTVKKVVQTGPEFVIEEVENLDADAQALLTLNPDSEASTYIAGKDLPLE
    QTIANMSGILAGLGMKIEIASWRNLVPNVWSLHIRDAHSPMCFTNGKGATKESALASALGEFIERMNCNHFYNDQFWGED
    IGNAPFVHYPHERWFKPGKKDALPKGLLDDYCLEIYNPDSELRGSHLYDTNSGNTERGICALPYVRQSDGETVYFPTNLI
    DNLFLSNGMSAGNTLAEAQVQCLSEIFERAVKREILEGEIALPDVPSDVLAKYPGILAGIAELENQGFPVLVKDASLGGE
    FPVMCVTLMNPRTGGVFASFGAHPSLEVALERSLTELLQGRSFEGLNDLPRPTFESNAVTEPNNFVEHFIDSSGVVSWRF
    FSAKADYDFVEWDFSGHGEESNAEEAAALFGILEDMGKEVYMAVYDQLGATACRILVPGYSEIYPIEDLIWDNTNKALAF
    RADILNLHRLDDAALEALLERLEDSELDDYTDIITLIGVEFDENTDWGQLTILELKLLINLALQDFEAAKEQVEAYLQYN
    ENTVERGLFYQALNVVLEVLLDDELELEDYEANFRRMFGHPRMDAVLGSVDGSVRFYGLTPTSLKLEGLARHQRLIDSYQ
    KLHTARAKVAASSS

    >gi|71909064|ref|YP_286651.1| suppressor for copper-sensitivity D, putative [Dechloromonas aromatica RCB]
    MPRWRRWALEVLIFVILFAAFQAWQTRNAPRGPAPNFSGTLIDGQPFDLTAWRQQHPDKAGLIYFWAEWCGICRTTAGTV
    SNISEDWPVISVAMQSGPANRVAETMQQREYVWPTLADPEAQVFLQYGSRVVPAFFILDPAGNIRAVSVGYTSEIGLRLR
    LWWASHTNT

    >gi|71909121|ref|YP_286708.1| putative thiol:disulphide interchange protein (periplasmic) [Dechloromonas aromatica RCB]
    MLKKLLPLLLAVAFGAQAMADEADIKKAMESKLGTKVESVTKSGYLGLYEVFADGNIVYTDEKGTAILVGPLIDGKTMKN
    VTEERMKKLTAIKFGELPLERAIKQVRGDGKRVMATFEDPN
    CGYCKRLAKELQKLDNVTIYTFLLPILSEDSVRKSRQIW
    CSPDRAKTWNDWMIDGKAPAGREDCDTSALSKNQEFGRKLNITGTPTMFFGDGERVPGAMPLARIEQKLGQVR

    >gi|71909129|ref|YP_286716.1| Alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Dechloromonas aromatica RCB]
    MSLINTQVQPFKVQAFHNGKFIEVTEASLKGKWSVMIFMPAAFTFNCPTEIEDAANNYGEFQKAGAEVYIVTTDTHFSHK
    VWHETSPAVGKAQFPLIGDPTHQMTRAFDVHIDEEGLALRGTFVINPDGVIKTVEVHSNEIARDVSETLRKLKAAQYTAS
    HPNEVCPAKWKEGEKTLAPSLDLVGKI

    >gi|71909130|ref|YP_286717.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase:pyridine nucleotide-disulphide oxidoreductase, class-II, active site [Dechloromonas aromatica RCB]
    MLDTAIKGQLKAYLERLQRPIELVGTLDDSAKGQEMRALLNDILECSDKVTLRENGGATRIPSFAVALPGETPRIHFAGL
    PMGHEFTSLVLALLQTGGHPPKVEQSVIDQINALPGSFKFETYISLS
    CHNCPDVVQALNLMAVLNPNVTSTMIDGAMFQD
    EVNARQIMAVPTTYLNDAEFGAGRMLIEEILAKVDTGATARAAEELGKKETFDVLVVGGGPAGAAAAIYAARKGIRTGIV
    AERFGGQVMDTLGIENFISVPYTEGPKLVASLEQHVKEYAVDVMNLQRANKLTPASENGGLVGLELENGAKLQAKTVILS
    TGARWREMNVPGENQYKAKGVCF
    CPHCDGPLFKGKRVAVIGGGNSGVEAAIDLAGIVAHVTLLEFADTLRADAVLQSKLN
    SLPNVTVIKSAQTTEVTGDDQKVNGITYKDRITGEEKHVELEGIFVQIGLLPNTDWLKGSLDLSKFGEIIIDAKGQTSAP
    GVFAAGDCTTVPYKQIIIAMGAGATASLSAFDHLIRSSAPA

    >gi|71909144|ref|YP_286731.1| methionine sulfoxide reductase A [Dechloromonas aromatica RCB]
    MSQSAHSFATLAGGCFWCLEAAFEQLDGVVAVLPGYMGGHDPRPTYEAVCRGDSGHAEVVQIEFDPAIIDFETLLTAFFT
    IHDPTTLNRQGHDVGTQYRSAIYFHDAGQQSAAEAMIARLNAEGVWASPIVTEVSPASAFFVAEDYHHQYFRRNPYQGYC
    MAVVAPKAMKLRQVFAERIKAG

    >gi|71909199|ref|YP_286786.1| hypothetical protein Daro_3587 [Dechloromonas aromatica RCB]
    MVALNPPVCDFGQPAVDFDLPGTDGRRHTLANCRGPKGLLVMFICNHCPYVKAIIDRLIRDCRELASHGIGCVAIMSNDV
    TAYPDDAPENMKRWAEELAFPFPYLYDETQSVARAYGAVCTPDFFGYNSQLELQYRGRLDASGRAAAPADARRELFEAMS
    DIARSGRGPSQQTASIGCSIKWDL

    >gi|71909259|ref|YP_286846.1| hypothetical protein Daro_3647 [Dechloromonas aromatica RCB]
    MRYLLMLCLTLAATFAQADTYRWLDSGGRTVVSDTPPPGKTKGVVKNGGKAEAGDNQSFATKKAAEAFPVTLYTSAECVD
    GCKQARDLLNGRGVPFTEKMLQTQAEIDELKQLVGDAAVPALKVGNQRFRGFEAAAYDNLLDLAGYPKTAAYGSKPSGGL
    SK

    >gi|71909290|ref|YP_286877.1| hypothetical protein Daro_3678 [Dechloromonas aromatica RCB]
    MTTAEPERRGGAGKWLLVLLAFGAAFWFARPLLQQRSVQAEAAVTASQPEVLLYATDWCGYCKMSREFFAANGIRYTEYD
    IEKSSSALSEHKKLGGNGVPLIKVGDEVINGYNEAALRQLLGPWIRG

    >gi|71909295|ref|YP_286882.1| glutaredoxin-like protein [Dechloromonas aromatica RCB]
    MSDVQQRIHATVTGNPVVLYMKGDARFPQCGFSATAVQILKVCGVNDFVTVNVLADEEIRNGVKEYANWPTIPQLYIKGE
    FVGGCDIMKEMYQTGELQQMLEGIAA

    >gi|71909386|ref|YP_286973.1| thiol-disulfide isomerase-like protein [Dechloromonas aromatica RCB]
    MIKMFRVFLMCITGLGVLQNAYSANASVQVIDEQLADAALNDLASGAGKLAQFRGKPLLINVWASWCGPCREEMGSLERL
    AKRYDGKQINIIGISTDDDRSAALAYLKRAGITFRNYIDRNLVLEKILRADRLPLTVLVDADGRVIKRIYGSRNWDSPEA
    TNLITQAFRLGAR

    >gi|71909443|ref|YP_287030.1| alkylhydroperoxidase AhpD core [Dechloromonas aromatica RCB]
    MNQEKIMSRIPAISPQELNDSSRTLFEKIQKTVGKVPNAYALIGSYSPASLGLLLEGDALLSKGQLSRSEIESVRIAVSE
    LNGCDY
    CVAAHVAIGKMVGLNEHEIRGVRNGGQTGNLQRDALIQFSRQVAGSRGLVDESVLKAVLEAGYSPSQVIEVLLV
    IALITFTNLVNRVNDTTIDFPKPI

    >gi|71909475|ref|YP_287062.1| twin-arginine translocation pathway signal [Dechloromonas aromatica RCB]
    MKVSRRSFVSTIFAFGAALAVAMPSFAQTVGKDYTPIVPAQATEDAAKIEVLEFFSYGCPHCADFNPLLTAWVAKQQGDV
    VVKKVPITFGRAAWANIAKLYYTLEITGDLHRLEADVFKAIHAERQNLFDEKTVTEWALKKGVDAKKFAETFNSFGVMSK
    VKRGDQMAQAYKITGVPALAVEGKYLVGGKDFNEALAITDSLIAKVRSEKSGKGAGKK

    >gi|71909536|ref|YP_287123.1| rhodanese-like protein [Dechloromonas aromatica RCB]
    MKQVRAQQLAEWLADEARPKPVLLDVREPWELELCQLEGSQHIPMHLVPTRCDEIDSTQDVVVICHHGGRSMQVAMFLER
    KGFGAVYNLMGGVEAWAGEVDPTMRRY

    >gi|71909607|ref|YP_287194.1| periplasmic protein thiol:disulfide oxidoreductase DsbE [Dechloromonas aromatica RCB]
    MNRYYWVLGAFAALVALLAVGLNLNPRDVPSPLVGKPAPAFNLNVLATPDKTLGPKDMQGKVWLLNVWSSWCVSCRQEHP
    VLVEFSRKVDVPLVGLNYKEVRGDGNFDMSKMPADEEKKLAFQRANQWLAQHGNPYTLTVMDLDGRVGIDYGVYGVPETY
    IIDKAGIIRMKHTGPISPDVLAQKIMPLLAELNK

    >gi|71909647|ref|YP_287234.1| hypothetical protein Daro_4038 [Dechloromonas aromatica RCB]
    MNAPESLPVEFPVFDNSFAALPEAFYTRLEPHPLPEPYVVGVSTEVADLLGLPAELMNSPQFAEIFAGNRLLPGSEPLAA
    VYSGHQFGVWAGQLGDGRAHLLGGLRNDQGHWEIQLKGAGRTPYSRGADGRAVLRSSIREFLCSEAMAGLGVPTTRALCV
    IGADQPVRREEIETAALVARVAPGFVRFGSFEHWASRDRSRELQQLADYVIDTFRPACRDAENPYDALLRDISRRTGELI
    AHWMAVGFMHGVMNTDNMSILGLTLDYGPFGFMEAFDAGHICNHSDHQGRYTYRNQPHVAQWNLYCLADAFLPLLKHPDI
    SRVAVDETYGDAFAQTFERLMCAKLGLRHALPDDENFIGETFGFLQQHRPDFTLFFRRLSRLSGGLDGEAMAKADAPLRD
    LFVDRAACDAWLANWRARLAQTPWDDGERQASMLAANPKYVLRNWLAEAAIRKAKLKDYSDVQRLLTCLRRPYDEQPEFD
    DLAALPPDWASGLEVS
    CSS

    >gi|71909650|ref|YP_287237.1| YeeE/YedE [Dechloromonas aromatica RCB]
    METAVSPNAVLWLAFAVAFVFGAIAQKTHFCTMGAVADIVNMDDWSRMRMWLLAIGVAILGAGALHGAGLIDLGKSIYRT
    PNFTWLSYLVGGACFGIGMVLASG
    CGGKTLIRIGGGNLKSLVVFMVLGLVAYMTMRGIFGVFRVNVLEKAVMTFPGGQDI
    PALLVALGLEAKTAFLLAVIAIGGGLTAFSLLKRDFWTFDNLLAGFGVGLTVVAAWYVSGHLGYIAEHPDTLEEAFIATN
    SGRMEALSFVAPQAYSLELLMLWSDSSRTVSFGIATALGVIAGSFVWSIVTRSFRWEGFAGIEDTANHLLGAALMGFGGV
    VAMG
    CTVGQGISGFSTLALGSIVTFLAIVGGAAATLKFQYWRLMREA

    >gi|71909701|ref|YP_287288.1| signal peptide protein [Dechloromonas aromatica RCB]
    MKRLAILIAALLIAGLAQAEMRPFVSGSLQKIERAQKGKPFILGFWSASCTHCPAELKALGELVRKYPKLELILVATDTP
    AEAPELEQLAQDYGVAPQARWVFADAQPERLRYEIDRRWYGELPRTYFYDGRQQRKGHSGVLPTAQLEQWASEHVK

    >gi|71909776|ref|YP_287363.1| cytochrome c biogenesis protein, transmembrane region [Dechloromonas aromatica RCB]
    MTMRLLFLVFAFFISLAHADEFLDPAVAFKPSVRALDGQTIEVSYEIAKGYYLYRDKFRVRVEGESVTLGTPSFPKGKEH
    NDENFGKVEVYYKTVAIRIPVERNASGPLPLKLNVTAQGCADAGVCYPPQTQPLSVELPDPASAPALTPAATEGDESGQI
    ASTLKHAGFWANLAFFFLAGLGLSLTPCVFPMIPILSGIIAGQGHKNSHSRGFALSLAYVLGMAVTYAAAGVAAGMTGTL
    ISSALQNSWVLGSFALVFVVLSFSMFGFYELQLPTSLQSKLSEESGHLQGGRGIGVFLMGALSALIVGPCVAAPLAGALL
    YIGQTGDAVLGGTALFVMALGMGAPLIAVGIAGGSLLPKTGAWMEGVKKAFGVLLLATAVWLVSPVMPPVVSMLAWSMLL
    IIPAIYLHALDPLPPHAKGWSRFWKGIGIVMLLTGAALLIGALSGSRNPLQPLAGLRGQAMAAEEKRLPFERIASLQVLE
    EKLKAAGQPVMLDFYADW
    CVSCKEMEQLTFTDPAVQAKLAGFKLLQADVTANSEDDKALLARFGLFGPPGIIFFDANGQE
    SRKVRIVGFQDAAQFLKSVQQAASAG

    >gi|71909799|ref|YP_287386.1| putative thioredoxin [Dechloromonas aromatica RCB]
    MAYTPIYAVDVPERAEIDALPGALLIEFGTGWCGHCQGVQALIEAALRRHPDLPHLKIEDGPGRRLGRSFRVKLWPTLVV
    LKDGQEIGRLVRPTGDKEINELLAGLTAC

    >gi|71906288|ref|YP_283875.1| OsmC-like protein [Dechloromonas aromatica RCB]
    MECTVRWMGNDAGMSFVAETGSGHAVVMDGAPEAGGRNIGLRPMEMVLAGTGGCSAFDVVLILKKGRQQVSGCDVSLKAE
    RAESDPKVFTSIHFHYRVKGKQLKPESVARAIELSKDKYCSASIMIGKTAEITYDFEIIEEA