Cytophaga hutchinsonii ATCC 33406 uid57651

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|110636520|ref|YP_676727.1| thioredoxin [Cytophaga hutchinsonii ATCC 33406]
    MGKAVEITDANFEEIINTDQPVLVDFWAEWCGPCKMIGPVVEELAGDYAGKAVIAKLNVDENPVVSAKFGIRSIPTLLVL
    KKGEIVDKQVGVVPKSVLAQKIDAQL

    >gi|110636560|ref|YP_676767.1| thiol-disulfide isomerase [Cytophaga hutchinsonii ATCC 33406]
    MNSIKTPLLFLLIAFSSIFQSFSAGKPLGYEIKATIKGVKQADTVYLARYYADKRFYQDTAIADAKGFVSFSDTTHLKEG
    MYFLLLPGQKVFDFILNPSTLSFSIDTTNLIKSAHFKNSPDNTAFYDYQRFFMNQKTKADSINNLMKSAAATQKTVLTKQ
    LSDIDSTMLAYIQNFLKTNPNSLFTAILKTTKDVDVPPAPKKADGSIDSSWQFHYYKKHYFDNVNFSDDRLIRTPVLVNK
    VDGYFKNLVVQRPDSIIKEIDMIISKCNPKGDLFEYYVREYTYKYETSQVMGMDAVFVHLGKEYYMKGKCFWATPETVKK
    IKERVDLLDPLLLGKKAPNLYMTDTTGTYRYLYDVQAKYTILFFWDSQ
    CGHCQQETPKLYDWWLKNRAKGIQVYAANIER
    KDEEWLKFIRSKKIGGWLNVRDSKNHTDFKITYDIYATPVLYVLDKNKVIIAKRIGYENLDDFLVQYEKSLKTK

    >gi|110636670|ref|YP_676877.1| thiamine biosynthesis protein (HesA/MoeB/ThiF family protein) [Cytophaga hutchinsonii ATCC 33406]
    MSRYSRQTILPEVGIEGQQKLTNASVLVVGAGGLGCPVLLYLAAAGVGRLGIIDADKVDITNLQRQVLYVTEDEGKSKAE
    TAAKRLSALNPEINIDVYPVWLSKENALEIFSSYDIIVDGSDNFATRYLVSDACVILNKPLVFGSIFKFEGQVSVFNYKG
    GPTYRCLFPEPPAAGEVPN
    CSEIGVIGVLPGIIGTLQANEVIKIILKKGDVMSGVLYMYDALSNMVQQLKVFRDPVASVV
    TELGTYEEVCETSPDIDKRTFDVWKEKNVVYQLIDVREPHEFENKNIGGELIPMNTVKDNLNRIREDIPVIVH
    CQMGGRS
    RKIVDFLYEKGFKNVYNLKGGLREF

    >gi|110636985|ref|YP_677192.1| bacterioferritin comigratory protein [Cytophaga hutchinsonii ATCC 33406]
    MFFISSSVYAQTQLKAGDKAPAFSAKDQNGKIVSLTSFKGRKLVLYFYPKDNTPGCTKEACNLRDYKDTLAAQGYTILGV
    STDDAFSHQQFIKQYNLPYDLLVDSDAAINKAYGVWVQKEREGKVFYGTARTTFIINESGVITKVIDAVKVDAHAEQILT
    K

    >gi|110637174|ref|YP_677381.1| methionine sulfoxide reductase B [Cytophaga hutchinsonii ATCC 33406]
    MKNKLTSIFLTAGLLMSLTACSQQKAQPIKKTDTIQATSNMPLMPIKDQSNYNPLTPEEKYVIINKGTERPFTGKYYNFK
    EPGTYICKQCNAPLYRSSDKFDSHCGWPSFDDEIPGAVTRVPDADGRRVEIICTNCKAHLGHVFEGERMTDKNVRH
    CVNS
    ISIEFVPVK

    >gi|110637182|ref|YP_677389.1| Fe-S cluster formation protein [Cytophaga hutchinsonii ATCC 33406]
    MPAFHQSILPLSITQLALNQIAFIKATKNIPEGYGLRVGVRGSGCSGTSFVLGFDQKKDGDNEYLVEGLPVYIEKKHVLY
    VAGVELDYEDSEEVTGFIFNTDAPA

    >gi|110637413|ref|YP_677620.1| hypothetical protein CHU_1003 [Cytophaga hutchinsonii ATCC 33406]
    MLYLTINVYFMKFINTITVLLFSLLVSICTHAQNHKEIGHLEFSDTLYNFGPVNESQGVLSHKFSFVNLGPEYFVIEDVN
    PS
    CGCITPDYPTDTIHAGEKGEVVIYVDLVNHPGVFKQKVVIKGNASKEPINLYVSGYVTPSPQPLADWERTSSFKYNTI
    YLQKNYANFGVVSNKSIVSMEIPVYNSGTQSVNIQLDKLKLPSYAKVNLLPVKIESNQRGVLKIFFNPKEAGMLGYFAGQ
    VEVVFLSGSTVTKVPVVVTATIKEVFTPAEQASVVGPRIQLDKGEIDFGTIKTDDKHTRDITVVNIGKSDLLLNSIRTS
    C
    SCVEAFADKTILKPGASTVIKVVFDTQDRTGAENKIVSVFTNDAANSIVTVKVRAVVTEDVPAPAGGQ

    >gi|110637438|ref|YP_677645.1| hypothetical protein CHU_1028 [Cytophaga hutchinsonii ATCC 33406]
    MLDFISQPWPWYVSGPLLGLMVPLLLFISNKQFGVSSNFRHICAMFAPKSIPFFNYDWKKESWNLVLILGTVAGAWVAHA
    YLNPTVNVSDDTYALLNQQGVHQFDGFAPADIFSWEGLLSLRGFIMIVIGGFLVGFGTRYANG
    CTSGHAIMGLSLLSVNS
    LIAVVGFFIGGLVMTYLILPYVLAL

    >gi|110637492|ref|YP_677699.1| OsmC-like family protein [Cytophaga hutchinsonii ATCC 33406]
    MNKINNSMAKVYSRIQKEKYKIEIKSPSGNVLIADEPAEKGGNDLGFSPVELLASSLAACTSATLKMYADHKGWDLAEAH
    IEVELGRNEDLNKTFINRMISFSGNLDEKQRARLLQVANSCPVHKILSNPIEINTQLLENN

    >gi|110637496|ref|YP_677703.1| dihydrolipoyl dehydrogenase (dihydrolipoamide dehydrogenase) [Cytophaga hutchinsonii ATCC 33406]
    MSTKFDVIVIGSGPGGYVAAIRASQLGKKVAVVEKAELGGICLNWGCIPTKALLKSAQVYEYIKHAKEYGINVGNAEADF
    TAVVKRSRDVAAGMSKGVQFLMKKNKIEIIAGFGKLVKGKQVEVTDDKGNKSLYGADHIILATGGRARELPNVKIDNNKI
    IGYRKAMVLESKPESMVIMGSGAIGVEFAYFYATMGTKVTIVEYLPNIVPVEDEEISKQLEKEYKKMGINIMTGAAVESV
    DTAGKGCKVTVKKGDATEVIECDIVLSAVGVATNLEGIGLEDVGVATDKGRVLVDDYYKTNIPGVYAIGDIVKGPALAHV
    ASHEGIICVEKIAGLNPEPMDYGNIPGCTYCTPEIASVGLTEKAAKEKGYELKVGKFPFSASGKASAAGAKEGFVKVIYD
    AKYGELLGVHMIGANVTEMIAEAVVARKLEATGHEIINAVHPHPTMSEAIMEATAAAYGEVIHL

    >gi|110637541|ref|YP_677748.1| Cu(I)-translocating P-type ATPase [Cytophaga hutchinsonii ATCC 33406]
    MELTVVTESILCTHCGQACEDHSIHINEQYFCCSGCKTVYEILNEHDLCTYYELDTSAGIKVRSSIGDAYAYLDQADIAD
    SLVDFKNDSTVVIHFFIPSIH
    CSSCLWLLEKLYTIEPGIIRSDVSFTKKEISITYNSSVVNLRRIVELMDSLGYAPHIQL
    NKTTEKETPETNRSVFYKLVVAGFCASNSMLMSFPEYLGLDREIEGMYAEVFGYISIALGLPVLFYSASDFYIAAWKGIK
    NKMINLDMPITIGMTALFSRSVYEILTHTSAGYIDSFTGLVFFLLIGKWYQSKVYQSMSFDRDYQSYFPVAVNRVEADGL
    KPAAISTLRAGEEIVIRSQEIIPADATLISESAYIDYSFVTGESLPVKKHKGELIYAGGRQTKESIHLRIEKEVSQSHLL
    QLWNNQVFDKSKGGNSVSQLADRFGRNFTIALLILSAITFGYWYTINIAAAFNALTAVLIVACPCALALSIPFAYGNAIR
    ILAKKGLFLRSTEVVEKLAHIDTIVFDKTGTITQSDQSAVTFYGNKLTMEQLGCIYAVVQHSTHPLSMKLAAYLKPHALH
    YVVSDFEEISGKGLQASIAGNNYKIGSAAFTQRREAGTLAGAYVGISVNDVFYGYYIFRNKYRMHMDTLIQQLKGTYRLY
    VLSGDNDTEKKQLEAIFPEAENIIFNQSPEDKLAFISGLQQQGKQVLMLGDGLNDAGALKQSNVGISVSEEVYNFSPSCD
    GIMDALYISSLSRMLNFSRGTVKAVKATLLFSILYNIVVITLAVQGLFSPLVAAVIMPVSSVTVVLMVVLTTNVLARKM

    >gi|110637758|ref|YP_677965.1| thioredoxin C-2 [Cytophaga hutchinsonii ATCC 33406]
    MASFKELINSDKPVLVDFHATWCGPCKQLAPVIEKVAGTFNERLKVVKVDVDKNTAAAQAYQVKGVPTMILFKQGKIVWR
    SSGYMDEGKLSKTLQAFI

    >gi|110637759|ref|YP_677966.1| metallo-beta-lactamase superfamily protein [Cytophaga hutchinsonii ATCC 33406]
    MKIEQLYTGCLAEAAYYIESEGEAIIIDPLRDIQTYVQKIERNNVTLKYIFETHFHADFVSGHLDLAEATGATIVYGPKA
    ETTFNSHIAYDGEKISIGKITLQVLHTPGHTQESSCYLLYDEDGNKHALFTGDTLFIGDVGRPDLAIKSDLTKEDLAGML
    YDSLEEKIKPLPDAITIYPAHGAGSACGKNLSKETFDTLGSQKQKNYALKAADKETFIKQVLDDLQPAPSYFNMNALLNK
    EGPGSVSELIKQGSIAFDVQSFENLQRQTYAVLLDTRDAKEFKKGFIPGSINIGLNGQLAPWAGTLLTNSDKPILIITDP
    GKEEETIIRLARVGVDQVIGYLKDGYNSWQKANKPEENIETISAAELVEKLDENINILDVRKADEYEKGHLNAAQHLPLD
    YINDWITTLDKNKTYYVH
    CAGGYRSVITESILKSRNISNVIDVSGGYGAIKAAMEPTKKRWLNAFFSFMKVK

    >gi|110637852|ref|YP_678059.1| thioredoxin family protein [Cytophaga hutchinsonii ATCC 33406]
    MFMNLRSLFYISLAACSVIIFSCEEKKPLEAGSFNYSIQGKVLNTTSEYACLEEIRDKRWVTVDSAKIDDQSISFSGIKK
    EVDIYRIRIDKNSYLPVILTGDNITFTVDAKEPFETVVFSGSKDNEAYAAFNKKMLEFNKAQSNLSRMLDSIKNTSTPSV
    IATNYMNQIKEVEAEMKVYVRESITKHTASPIVFSMLSYADWENDFPFIETATTTIKQQQPDYKYTASLVTNVTQYKAYL
    EQKAAKDKGNPAAIGKEAPEFALPDVTGKMVRLSSFRGKYVLLDFWASW
    CGPCRQESPNVVRAYNTYKGKNFDILSVSLD
    DSKEKWLKAIEKDGLSWTHVGDLKSWQSSVVQLYQVEGIPATFLLDPKGVVIARDLRGDALDAKLEELLK

    >gi|110637918|ref|YP_678125.1| arsenite S-adenosylmethyltransferase [Cytophaga hutchinsonii ATCC 33406]
    MKNNNQDVKEMVQQKYSEIANQSKVQNETSCCGAGSCGTYTIMSEDYSGLDGYNPDADLGLGCGLPTEYAKIKKGDTVVD
    LGSGAGNDAFVARTLTGEEGEVIGIDMTEAMIQKAKGNTEKLGFTNVAFRLGDIEDIPLSSKRADVVVSNCVMNLVPDKA
    KAFSEVFRILKPLGHFSISDIVLKGDLPDAIKKEGEMYAG
    CVSGAIKKSEYLGILAEQGFVNITVQKEKEIIIPVEVLSQ
    YLSQEEINSYKEKGMGIYSITVYAERPDASCGCDPRATCC

    >gi|110637982|ref|YP_678189.1| glutathione peroxidase [Cytophaga hutchinsonii ATCC 33406]
    MATVDKTQSIYSIKVTTLDGQPFDLSTLKGKKILIVNTASKCGYTPQYEELQQLHALHGDSVAVLGFPCNDFGGQESGSE
    SEIGAFCTKNYGVTFQMFEKVHIKGNEQHPLYKWLTDPALNGWNKDAPTWNFCKYLINEKGELVNFFGSGVKPMSKTVLD
    AIRK

    >gi|110637991|ref|YP_678198.1| arsenate reductase (glutaredoxin) [Cytophaga hutchinsonii ATCC 33406]
    MIKIYHNPRCQKSRTALAYVEERDENIEVVEYLKNPPTAKELKEVLQLLKMKPMDIIRKKETLYIDSYKDKEFTDAQWIS
    ILAEHPVLIERPILINKNKAVIARDEATLKSF

    >gi|110638051|ref|YP_678260.1| peptide methionine sulfoxide reductase [Cytophaga hutchinsonii ATCC 33406]
    MCIYFHKFNMFLALWHHFFIPLIYLTTCNLSVHKSSIYHIKIIHMKAHLKELGTLAIGLFSIMACSSITKETKPIAHDIH
    MENQTGDTKQLDTATFGNG
    CFWCTEAVFQDIKGVVKVTSGYSGGTVTNPSYKQICTGTTGHAEVLQIVYNPSIVSYSELL
    QMFWYSHDPTTLNRQGNDVGTQYRSVVFYHNETQRKEAEFYKKKLDEEKIFEKPIVTEIVSFTKFYPAEDYHQNYYKEHG
    SEPYCMYIIRPKLEKFKKVFGEKFKQ

    >gi|110638178|ref|YP_678387.1| thioredoxin-disulfide reductase [Cytophaga hutchinsonii ATCC 33406]
    MSVEKVHCLIIGSGPAGYTAAIYASRAGLKPVMYQGAQPGGQLMITNDVENFPGYPDGVMGPEMMEHFKAQATRFGADIR
    YGTISSVDFTGPVHKVTVDEKVVLEADTIIISTGAGAKWLGIESETRLNGRGVSA
    CAVCDGFFFRGQEVAIVGAGDTACE
    EASYLSKLCKKVYMLVRKDKFVAASVIMQQRVLNTPNIEVLFSTETDEILGKEDVEGMRVRNNVTGETREIPVTGFFVAI
    GHKPNTDIFKGWIDMDENGYIKTIPGTSKTNVEGVFACGDAQDHVYRQAVTAAGTGCMAALDAERYLAAKEAVTA

    >gi|110638288|ref|YP_678497.1| thioredoxin family protein [Cytophaga hutchinsonii ATCC 33406]
    MKHILRLNVLFACALATIVFCAFKTDESAERPLAPDFTLESNEGKKVSLSDFKGKVVYIDFWATWCGPCVAEIPHSKKLK
    EKFAGNDSIVFMYVSVDNEDNVDGWKSFIRKKGLTGVQLISRDGGKEDRVGERYGLQYIPRFVLVDKSGKVAYGQAPAPS
    DASSEQLIKQLLAE

    >gi|110638292|ref|YP_678501.1| bacterioferritin comigratory protein [Cytophaga hutchinsonii ATCC 33406]
    MTLTAGDKAPVFKGTDQDGNTISLKDFAGKKVVLYFYPKDNTPGCTKQACDLRDNYNALLKAGYVVIGVSTDSEKSHQKF
    IKKFELPFPLIADEDKTIHEQYGVWGEKSMYGKTYMGTLRTTFVIDEKGKIEEVISKVKTDDHTAQILK

    >gi|110638374|ref|YP_678583.1| thioredoxin-like protein [Cytophaga hutchinsonii ATCC 33406]
    MYMLNRRSTMTYLYSLLIFLFSFNITDQASDAIEQITMEQLQAKTIHPENDTLYIVNFWATWCGPCVAELPYFELAAKEN
    ADQKVKILLISLDFISEKAKVEAFIKKKNILNQVYLFNAGDPNKWINQIDTSWDGAIPATVFYKAGKKVFFHEGDLTQTE
    LNEKIKTFKN

    >gi|110638375|ref|YP_678584.1| thiol-disulfide isomerase or thioredoxin [Cytophaga hutchinsonii ATCC 33406]
    MRKITAIISTALLFVFASFVTDGGYAVGDKARDFKLKNIDDKLFSLADKKDAKGFIVVFTCNHCPYAVKYEDRIVALNNK
    YAKSGYPVVAINPNDATAYPDDNFENMKKRAKSKSFTFPYLVDDTQEIAKAYGATKTPHVFVLKKENADLVVKYIGAIDD
    NTDDASAVTTKYVEQAVDALLAGKDVTTTSTKAIGCGIKWKK

    >gi|110638392|ref|YP_678601.1| hypothetical protein CHU_1993 [Cytophaga hutchinsonii ATCC 33406]
    MFKKISVLMVLAASTLSVSMAQVSNDFNFPVDKFDFGVITEGEKARHTFEFFNTGKDTILLKSENVRASCGCTTPSFSTE
    AILPGQKGVITAEFNSQGRPGTFQKTVTVYYKEQVAKMLNIKGIVEPATPEVAHSEAELKKAAKISVDKHQVNLGKVERG
    QQSSYSLKVTNPGKDTLFVTKAQAA
    CSCITYKLIKEKSTEEVNYILPGKSATMKLVYSPSADGYNRDILTLYTNDITTPR
    TAIVVEAEVVESLQQKSILQEGSGGAPFSK

    >gi|110638428|ref|YP_678637.1| hypothetical protein CHU_2029 [Cytophaga hutchinsonii ATCC 33406]
    MKSKISVFAALFLCVICAGFIFLPKENETASTTVEEVKWLTYDQAVALSKKNPKPIFIDVYTDWCGWCKTMDKNTFSNHK
    VAAYLNKRFYSVKLNPEKKDTVHYKGVAMTNGALAGKIFHATSYPTTVYLEGDETLLQPIPGYQAPNDLYRIIHYIGENH
    YKTTTWDDFSKSFNESAE

    >gi|110638543|ref|YP_678752.1| hypothetical protein CHU_2147 [Cytophaga hutchinsonii ATCC 33406]
    MEHLHRKQITNTFTETFPGDLSMNNTTRQTPGVLYCSVLPTPVHHPQLLAWSADVAEMLGLESPVPEDVLILGGNTVNPT
    MKPYASCYAGHQFGNWAGQLGDGRAISLGFCSGKDSMEYELQLKGAGPTPYSRNSDGRAVLRSSLREYLMSEAMHYLGVP
    TTRALSLVSTGDAVLRDMFYNGHAAYEPGAVVLRVAPSFIRFGNFEILAERNNRDLSQQLCDWVITRYYPEIRGEDRVVQ
    LFQAVAERTADMVVQWLRVGFVHGVMNTDNMSILGVTIDYGPYSFVDEYDARFTPNTTDLPGRRYAFGNQAAVAYWNLGR
    LANALAFLVPETDKLVAVLKNYQDVYETKYYTMMANKLGFDALREDDRLLIDSFEEMLRTVKPDMTMFYQLLIDLPADPG
    TAADVKQFFQSCFYTEADEALLHTCIAAYSKRIKTNTCSKEVSAEKMRAANPRFVLRNYILHEAIEKLEKGDDALLKKLE
    EYIKQPYSKNADEYFIKRPDWAAQKAG
    CSMLSCSS

    >gi|110638648|ref|YP_678857.1| osmotically inducible protein [Cytophaga hutchinsonii ATCC 33406]
    MIRKANAVWQGTGKEGSGTLTSPSTVLNNTPYSFKTRFENEDGKAGTNPEELIAAAHAGCFTMALSFQLSGANFTPTKLA
    TEASITMVQENGGFKFKSIHLHLEATVPNISEEQFKELADIAKKN
    CPVSQALSAVEITLSSNLVK

    >gi|110638832|ref|YP_679041.1| hypothetical protein CHU_2444 [Cytophaga hutchinsonii ATCC 33406]
    MKRIVTYAFLLSAAFAVVSCSNNEEKKSEEAAVTQSPALVQELKTTAITFKEPEHAFGDVKEGEMAKHEFVFQNTGSEPL
    YVRDAKAS
    CGCTTPEWTKDTIAPGAEGKILVQFNSEGRPGDFTKTVTVLANTDPEATVITIKGHVIGKQKEITGPYLKDA
    N

    >gi|110638880|ref|YP_679089.1| dithiol-disulfide isomerase [Cytophaga hutchinsonii ATCC 33406]
    MEATNKMKVEVWSDIMCPFCYIGKRNYEAGLKQFADSNNIEIIWKSFQLDPNIPQDTAVTENVYQYLAERKGMSYEQSVQ
    MHDSVVATAKKAGLDYNFDKAVIANSFNAHRMIQLAKTKDLGDAAEERLFYAYFTEGKNVGNSYVLIELGKDIGLTEAEV
    QTALTDDTYAYKVRQDVEEAQHLGVRGVPFFVFDRKYAVSGAQPPQAFLETLEKSFSEWRKEHPASPFEVSEGPSCSVDG
    CD

    >gi|110638909|ref|YP_679118.1| scaffold protein for iron-sulphur cluster assembly [Cytophaga hutchinsonii ATCC 33406]
    MISITDKAKNHVADLRAREGYTEEYNIRVSVKGGGCSGLMYDLDFDNKIDEADQVFEDKGVKILVDKKSLLYLLGTTLDF
    TDGLNGKGFHFVNPNASRTCGCGESFSV

    >gi|110638958|ref|YP_679167.1| alkyl hydroperoxide reductase, F52a subunit [Cytophaga hutchinsonii ATCC 33406]
    MAHKNRFDVIIIGGSYSGLSAAMSLARSLRKVLIIDSGKPCNRQTPHSHNFITHDGHTPKQISEAAKQQVLSYDTITFYN
    GLAVNGEKTDTGFMVKTENGDSFTSKKLVIATGVRDLMPAYKGFADCWGISVLH
    CPYCHGYEVHGKTIGLLGNGNIGFEF
    CKLISNWTKDLILFTDGKSTLTYEQTRKVQEHNIKIVEKEIAEFIHENGYVKYVLFKDGTQHAVTALFARIPFEQHCAVP
    AQLGCTLNEDGLIKTDEFNKTSVPGVYAAGDNSSPMRAVAAAVAAGSKAGAVLNREMIEEAF

    >gi|110638981|ref|YP_679190.1| hypothetical protein CHU_2595 [Cytophaga hutchinsonii ATCC 33406]
    MKSYTKHTHTNRLASESSPYLLQHAHNPVEWFPWGEEALQKAKAEDKPILVSIGYSACHWCHVMEHECFEKEEVAAVMND
    LFINIKIDREERPDLDQIYMDAVSAMGLRGGWPLNVFLTPDAKPFYGGTYFPQDHWLNLLGQISNAYLNHREDILKSAES
    FTESLNQSDVFKYGLVDDAETFHKDELDLAYDRISQQFDTDMGGMNKAPKFPMPSIYLYLLRDYALTGRQGSLQHVELTL
    DKMAMGGIYDTIGGGFARYSVDGAWFAPHFEKMLYDNGQLLSLYSEAYTVTKKPLYKEVIEETYTWLKREMLSPEGGFYS
    ALDADSEGVEGKFYCWQYEELAQLIQEDFALFCAYYAITENGNWEHGMNILYKRMSDEAFAAAHSISAEALRESVSRWKN
    ILFSERDPREHPGLDDKILASWNGIMLKGLCDAYRILGDAAILNTALMNAEFILTKLYDGKTLFHSYKNKKATIPGFLED
    YTHVIDGYLALYEVSLDEQWLRQAITLVNHVIDHFYDDDEGLFFYTSRTSEKLIARKKEIFDNVIPASNSSLARNLYHLG
    KLLNNNDWIEHGRKTGSRFKKAFLADPSYLSNWGCLITSLMSPTAEIVISGKDALKIRKEINTVYYPNKVICGSVVSSTL
    PLLTDRKPVDDKTLIYLCFDKTCQLPTASVSELFDQLNRIN

    >gi|110639019|ref|YP_679228.1| NADH oxidase/rhodanese-related sulfurtransferase [Cytophaga hutchinsonii ATCC 33406]
    MKEISVSELKALIDSKADIQLIDVREPAEFESAQIGGELIPLGTIPQNVDKISKDKQVIIHCRSGKRSANAIMFLESNHG
    YTNLYNLEGGILAWRDEIDEDLDVM

    >gi|110639023|ref|YP_679232.1| hypothetical protein CHU_2638 [Cytophaga hutchinsonii ATCC 33406]
    MEIELNLLNKAYHFEAKNEQGNAISIDASPAIGGENNGPRPMELLIMGLGGCSGIDVLSILRKQKIEPEAFQIKLHADRE
    KDAIPSLFTDIIVEFIFKGDIDPVKAERAVKLSMDKYCSVAKTLEKSANITYKITVN

    >gi|110639048|ref|YP_679257.1| hypothetical protein CHU_2663 [Cytophaga hutchinsonii ATCC 33406]
    MKKFILVALSIVFSTLLIAKIVVNGPVMTFEKKSHDFGDVKQGGKVTHVFKYKNTGNDTLRIDNVISSCGCTVPNNYEKV
    VAPGASGSIAVSFNSEGKMGVVNKTLTILSNAVTGAEEPAEYLTIRVNVIP

    >gi|110639107|ref|YP_679316.1| alkyl hydroperoxide reductase, subunit C [Cytophaga hutchinsonii ATCC 33406]
    MSLVGKKAPSFVAPAVLNGYEVVEAFSLDQYLGKKYVVFYFYPKDFTFVCPTEILAFQEKLAAFEAKDTVVVGCSTDTEN
    SHFAWLSMPKNKGGIQGVKYPLVADTAKTIATNYGVLGGNFDIDDNGQMIFVGAPIAYRGTFLIDKEGIVRHETVNDFPL
    GRNIDETLRMVEALQHVEKFGEVCPANWGEGKEAMKATVEGVSDYLAKN

    >gi|110639202|ref|YP_679411.1| hypothetical protein CHU_2821 [Cytophaga hutchinsonii ATCC 33406]
    MHEKKKENVPEWQHFDAAIFNKAKKEHKLVLLHLGANWCHWCHVMEEQTYTDPFVLELLNKSYIACKEDHDERQDLTSLY
    AAYGWPATIVFDADGNELLKEAGFISSDRFIALLKKLVKNPTPMPTDSVQIEPAVASDSSTQQALNTLKKKFYSSLDIEG
    GGFNYAQKYIDFETFEYAFNHSENDSILTKWLYNSVVNSAGLNDNVWGGVFQYSTHSDWNHLHYEKLLSIQARYIKMYCW
    YYKRFNDADALSHAESAAKYVQRFLDDPKGGFYNSQDADVTPGEKATEYFKLNNADRIKKGIPAIDKNSYTSDNAEMIEA
    CIILSAATGNNTYLEKAVRCFDFIKKNNKTNNAYAHGSNYTNSISLKDNIAIVKSALLLYRATQDAAYKSEALRIIQEVA
    GTFYSKKGYMISFIGNSPIKGSYNITENIEACRLLNYCSHVFNEPKYKILAQTIFGFLTNENLVKTMSTEPGILSAYEEL
    NTEPLKAVLMIKNGTELKTDFLNSSLSFPAFYFDNTIYTSTTIPSDKYELFDSFDKNFIVACTASYCSSPMFSKDGFEKF
    IYRRAFSTK

    >gi|110639355|ref|YP_679564.1| hypothetical protein CHU_2981 [Cytophaga hutchinsonii ATCC 33406]
    MNRVYLVFFLLIGFAFVSNAQADFTFKVSAHDFGKINPGKDTLWYNFTFTNTGNEPLQIQDVKTSCDCTLAEWPKTTIQP
    GKTGVVKGGFKIENKSGPFEKNIIIIANTSPATTFLTIKGEILTAGSSAQ

    >gi|110639417|ref|YP_679626.1| thioredoxin family protein [Cytophaga hutchinsonii ATCC 33406]
    MLSAVTAKPISIKGKFTKTETGYSTIYLYKYLGNAVYVFDSTKYVNGAFEFKFNDVIPTGFYKIGFDKADAITLVAGYES
    IVITGNPDIERSMTITGSKENDLFHEYQKINKTQNAQNAILNQQAQQLQQRPGMTEELFNIEIAGLRKKSDSLNTAYSAQ
    MTKLAAEHSGLFMTKVISMFLFDNKTAETFFTPAEFTDKEYAAGDMLPSKVQAYFQYYVTQDLYSWKAAAEKLINTCPAG
    SDNRQVFYASVIPLFTQNDLDYAKGLTNTFLKEYPKSAEAKQLKASMPKGALSIGEEVPDITLTDINGKRLSLSSLKGKV
    VLIDFWASW
    CGPCRGENPNVVNAYNKYKEKGFTVFSVSLDTNKDQWQAAINKDGLAWPNHVSDLKGWSSDPAKLYNVKGI
    PATFLIDQQGKLIAMNLRGEDLQAKLAELLNKP

    >gi|110639560|ref|YP_679770.1| hypothetical protein CHU_3187 [Cytophaga hutchinsonii ATCC 33406]
    MYQMTAEYLGGLRTTGTHLKSGNTVITDAPTDNNGRGEAYSPTDLVSAALCSCMMTIMGIVAARENIVFEGITATIEKIM
    TKEPPRKIAGIHIAFTLPDPQQLTPKQAEILKRAAHT
    CPVALSLHPDIVQEVSFNF

    >gi|110639600|ref|YP_679810.1| redoxin family protein [Cytophaga hutchinsonii ATCC 33406]
    MKHLIAIWLLLFCFFFSSAENTQTQLAIGDKAPDFTVQDQSGKPLSLSSLRGKIVLINFWTASCEPCRLNHPDLYRIYNT
    YKSYGFEVLSVSLDTKKETWVNALKMDRINWPNNGIDLQGWNSKVVSLYGLKSTPGSFLISEEGNILQINQDKIALEQTL
    HYLIFDQPRFYPVVANTTIYFNVISKYNIVDSKGYSVLKGRAKEVSVAALPPGEYTLTYENKTEKFLKVQPEQTPITFYP
    TRVEDEITLSREADYYIYNQRGKLEFKGNGTTIDVKKLPLGVYYLCVEGTIHSFFKK

    >gi|110639729|ref|YP_679939.1| dihydrolipoyl dehydrogenanse [Cytophaga hutchinsonii ATCC 33406]
    MYDVVVIGSGPGGYVAAIRCAQLGMKTALIEKYSTLGGTCLNVGCIPSKALLDSSEHYYNATHTFKEHGIDVKDVKVNLK
    QMIDRKAGVVKQT
    CDGINYLMKKNKVDVHTGIGSFVDKNTIKVTAADGSVKELKTAKTIIATGSKPTSLPNVAIDKKRII
    TSTEALELTEVPKHLIVIGGGVIGMELGSVYARLGAKVSVVEFMDTLIPTMDKALGKELIKVSKNHLGFDFYFSHKVTGA
    TAKGKEVTVTAEDKDGKVLELKGDYVLVATGRRPYTEGLGLEAAGVKLDERGRVAVDGHLQTNVPGIYAIGDVVVGAMLA
    HKAEEEGVFVAESIAGQKPHINYNLIPGVVYTWPEVAAVGYTEEQLKKDGKAYKVGNFPFKASGRARASMDLDGFVKVLA
    DKETDEILGVHMIGPRVADMIAEAVVAMEFRASAEDISRMSHAHPTFTESFKEACLAATDNRALHI

    >gi|110639833|ref|YP_680043.1| peroxiredoxin [Cytophaga hutchinsonii ATCC 33406]
    MSLRLGDIAPDFKADTTEGPISFHEWLGDKWGVLFSHPADYTPVCTTELGATAKLKSEFEKRNVKVAALSVDGLESHKGW
    IKDINETQNTTVNFPIIADEDRKVAELYDMIHPNASEKFTVRSLFIIGNDKKIKLIITYPASTGRNFTEILRVIDSLQLT
    ANYSVATPANWKDGEDVVITPAVKDEDIAAKFPKGYTRVKPYLRTTPQPNK

    >gi|110639841|ref|YP_680051.1| thiol:disulfide interchange protein [Cytophaga hutchinsonii ATCC 33406]
    MKVSIVFLFAFLFLTVQVQAGKNVSIPETELQKLAQHVDNLVKRDSVNEAIIKLLKDSLDGKGHTVAKAQTPKVSTVKIT
    VKERGGITQDTSLFLFAIFAFAAGFVSIITPCVFPMVPMTVSFFTNTSSSKKESVRKAIIYGLSIVTIYTLIGVVIAKIN
    GPEFANFLSTHWFPNVLFTLIFLVFALSFFGLFEITLPNNFINKVDKQSDKGGYVGIFFMAFTIVLVSFSCTGPIVSTIL
    LSAAGGEIVKPIIGMVAYSSAFALPFTLFALFPNWLKSLPKSGGWLNTVKVSLGFIELALALKFLSIADQVMHWNILNRN
    TFLLIWILIFFSLGLYLLGVIKFSEHDKGSIGWPRRSLAILSILFAGYLGTGIAGSPLKKLSGYLPPLEDYTTATDRICG
    TPKYADFLHLPLGLQGYFDYKEALACAKQQGKPLFIDFTGHG
    CVNCREMERNVWADPAVLKHLNEDFVMVALYVDDRTEL
    PENEWYTSKKDGKVKKSIGKQNHDFQNTRFNFLAQPFYVILDPNTEMELAQPITYEPSIEAYIDFLEEGKANYKKLYK

    >gi|110639903|ref|YP_680113.1| thiol peroxidase (atypical 2-Cys peroxiredoxin) [Cytophaga hutchinsonii ATCC 33406]
    MTKVTLKGNATTIKGDLPSIGNTAPDFTFVKTDLSEGTLYGEGKVVKVIIAVPSLDTSVCALETRQFNQKLAASTGVKGL
    VISKDLPFAMKRFCETEGIANVTSGSDFRGSEFVQKYNTEILEGPLKGLSARAIIVVDQDNVVRYTELVPEIASEPDYEH
    VLKAIESLK

    >gi|110639925|ref|YP_680135.1| thioredoxin [Cytophaga hutchinsonii ATCC 33406]
    MVSCSNQQTQTKAITVSDTTLLSAEEFSQKIKKEPNALILDVRTPEEFSEAHIANATNVNWKDNFASGITEVNKNQPVLV
    Y
    CLSGGRSASASDYLRKNGYTQVYELQGGLLKWQASNFEVVADTVTAAQDSGMTLQQFEALLVTDKYVLIDFYATWCGPC
    KMMEPALEDIAATMSDKVIVVRIDVDKNEELSKHFEVESLPTVQIYKNKKLVWEDIGYKTKKQLVSQLK

    >gi|110639940|ref|YP_680150.1| thiol-disulfide isomerase/thioredoxin [Cytophaga hutchinsonii ATCC 33406]
    MKQLKKITLCVLLLFAVSILFIASIERETIKVGEKAPAFTVAALNGVDSISLSDYKGKIVIVHLWSPTCPHCRETNKVLP
    GIIGPYSKKANLAYIMIAIDMDTLTLRPVIEEDKLNFAIHGYDPFDGSAKTMMDYEAPGTPCINIVDEKGNLVGVNVTDD
    QLKKYLKKRFSRNS

    >gi|110639960|ref|YP_680170.1| arsenate reductase [Cytophaga hutchinsonii ATCC 33406]
    MPNITLFGIKNCDTMQKAFHWLDSKHIAYTFHDFKKGNLTQEDVSFWLKDLTIEEVINKKGTTWKKLSEDEKNAVSNENA
    AIELILKNPSLVKRPLVQMGKKHVVGFNPEQWDILFS

    >gi|110640006|ref|YP_680216.1| protein-disulfide isomerase [Cytophaga hutchinsonii ATCC 33406]
    MNNIKFYIILLAILFTGSGSTCVQKQKDSEKMKLLYVYDPLCGWCYGFGPVVEKIEKNYKGTVDVEIISGGMVMGNRIAP
    IGNMSEYILDAIPRLQRMTGIEFGQPYITLLKEGSYVTSSEKPSIALCVYKSFTAERAVEYGHAIQTSFYKEGKDLNQDV
    LYADLATSYGIDRAAFLKRMKDSVYFNQAHEEFKRAAALGVTGFPTLLLKQENGYTALTEGYATYESIEKQLQKHVKAAG
    TK

    >gi|110640126|ref|YP_680336.1| peroxiredoxin [Cytophaga hutchinsonii ATCC 33406]
    MQNRILSVGSAFPAFKKTAVVSIEKGKEFTEISSENLVNEDNQWTVMFWWPKDFTFVCPTEIAEFNNAFGDFRDRDTTLI
    GASTDSEFVHAAWRRDHEDLRGLKFPMLADTSKSLAEELGILEAAEKVALRATFIIDPQGIIRWVSVNDLNVGRNVKEVI
    RVLDALQTDELCPCNWEKGQETIHA

    >gi|110640164|ref|YP_680374.1| transcriptional regulator Ada / DNA-O6-methylguanine--protein-cysteine S-methyltransferase [Cytophaga hutchinsonii ATCC 33406]
    MNEQEQTNYSRIAEAIEYIRAHYKEQPGLDEVAEKVHLSPFHFQRIFTEWAGISPKKFLQYISIQHAKELLNQSQPTLFD
    IADTVGLSSTSRLHDLFIKIEGMTPGEYKNSGENLSIQYSFSDTPFGKILVASTSSGICQLTFIESEQDGLTRLQSVFSN
    ASYTHAVNEMHENALRIFSMDWSKLKQIKLHLKGTDFQLKVWEALLKIPVGTLTTYGDIASKIYKPSASRAVGTAIGSNP
    IAFLIP
    CHRVIQTSGNIGGYMWGPTRKTAIIGWEAAKIEGTK

    >gi|110636982|ref|YP_677189.1| phytoene dehydrogenase [Cytophaga hutchinsonii ATCC 33406]
    MSNIYDAVVVGSGPNGLAAAITLQRKGFAVLVLEAKDTIGGGLRTKELTLPGFKHDVCSAIHPMAVASPFFADIPLDKFG
    LRFTHAPIAAAHPFDHGGAAILSRSLKDTIALLGKDADNYKRLIEPVIESWPDIAADAMGPLRFPKHPLKMAAFGLNAIR
    SADCISKRFETEEAKGLWAGMAAHSIQPLTNWASAAIGLVLSAVGHLHGWPIPIGGSQAIADALGSYFISLGGTIQTNVE
    VTSLNQLPAARAVLFDVTPKQLLKITGDEFSGLYKKQLTNYRYGMGVFKVDWALSEPVPFTSDHCRQAGTVHLGNTFNEI
    ALSEQETSSGKHPEKPFVLFAQQSKFDITRAPQGKHTAWAYCHVPNGSATDMTAAIENQLERFAPGFKDTILAKNTMNTV
    EIQAYNPNYIGGDINGGIIDIRQLYTRPAVKISPYRTPKKGIYICSSSTPPGGGVHGMCGFHAAQAVIQDLKKQYK

    >gi|110639076|ref|YP_679285.1| hypothetical protein CHU_2691 [Cytophaga hutchinsonii ATCC 33406]
    MKDYQILLYYCYTHIADPDAYREEHHLKCLELGLLGRIIIASEGLNGTVSGTEEGCRQYMEYVKADPRFEALEFKIEAHE
    GHAFQKLYVRVKPEIVHSSLKHVDPTKRTGKHLEPAEFKAMKDRDDVVVLDVRSNYEHQVGRFKNAVTIDMENFRDFPEK
    IKELDHLKGKKVLTY
    CTGGIKCEKASAFLLEQGFEDVYQLHGGIIKYGIEQGGEDFEGKCYVFDGRVIADVNKVNPSIIS
    TCYVCGTLSDRMVNCSNPVCNRHEPMCEACGEKMQGACSEECKCHPEKRPYDGTGAYPKELNGYDPYLHVKR

    >gi|110640125|ref|YP_680335.1| alkylhydroperoxidase [Cytophaga hutchinsonii ATCC 33406]
    MQILDHADSRYIRDLKVNVSNALVTAHISEKESALLALSIAANQKNNILISGFQKLSAEKGATIEEQNEAISCASLLAGN
    NVFYRFRHFQQKESYNTMQAKIKMNIMMKPVLGKEFFELISLAVSAVNGCEM
    CVNAHEHSVREMGATEERVWDAIRLAAV
    ITSLDKVMS