cyanobacterium UCYN A uid43697

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|284928609|ref|YP_003421131.1| glutaredoxin-related protein [cyanobacterium UCYN-A]
    MTPEIKNRIEELVNSNTIFIFIKGNKLMPQCGFSNNVVQIFNTLGATFETFDVLSDPEIREGIKEYSDWPTIPQVYINGE
    FAGGSDLMIEMYQNGELQQQVEIALAS

    >gi|284928688|ref|YP_003421210.1| Rhodanese-related sulfurtransferase [cyanobacterium UCYN-A]
    MHQNQSIPTITVKKLAEYLIKDNSELQLIDVREPEEVKIAHIEKFKVFSLSKFPEWSQTIINDLDFDKETLVLCHHGVRS
    AQVCFWLLKNGFINVKNIEGGIAAYSLIIDNSIPQY

    >gi|284928733|ref|YP_003421255.1| thioredoxin [cyanobacterium UCYN-A]
    MSATAQVTDSSFKTDVLESEVPVLVDFWAPWCGPCRMVAPVVDEIAEQYAGQIKVVKLNTDENPNTASQYGIRSIPTLMI
    FKGGQRVDMVVGAVPKTTLASTLEKYL

    >gi|284928879|ref|YP_003421401.1| 1-Cys peroxiredoxin [cyanobacterium UCYN-A]
    MTLQLGDIAPDFSQDSSEGIISFHEWAGDKWVVLFSHPADYTPVCTTELGMVSKLKSEFEKRNVKVLALSVDGVSSHKGW
    INDINETQNTTVNYPIIADSDSKVANLYGMIHPKSLNKLTVRSVFIIDPNKKVRLILTYPASTGRNFDEILRVIDSLQLT
    DYHQVATPANWKDGNDCVVVPSISTEEAKQKFPKGVTEVKPYLRMTPQPNK

    >gi|284928927|ref|YP_003421449.1| NADPH-glutathione reductase [cyanobacterium UCYN-A]
    MKYDFDLFVIGAGSGGIATARRAAGYGARVGLAEYDRLGGTCVNRGCIPKKLMVYTSHFPESFVESQGYGWSNVSSVLDW
    PKMITSIQNETKRLNGIYQKMLDTSKVKIFQGRGKFIDNHTIEVGKDKVTADKILIAVGGYPVKPNIPGIEHTITSDDIF
    NLPKQPKRIVIWGGGYIGVEFACIMRGLGSEVIQIIRRDKILRGFDDDLRLAIQQSMENNNIQILKNSEVTSIEKTPQGL
    KISTKGNKNNEIVLADTIGLAATGRKPNLDNLGLENINIEINKGAIVVDQYNCTNQPNIYAVGDCTNRINLTPVAINEGR
    LFADSHFGKSTRIMNYENVPSAIFSNPEAATVGLTEFEASEQYGENGIKVYKSQFRPMYYVLPEKEEKTLMKLIVHKDSD
    RVIGAHMVGNYASEIIQGIAIAINAGATKAIFDATVGIHPTSAEEFVTMR

    >gi|284928997|ref|YP_003421519.1| dihydrolipoamide dehydrogenase [cyanobacterium UCYN-A]
    MNKKEFDYDLVIIGGGVGGHGAAVHAVKCGLKTALIEMRDMGGTCVNRGCIPSKALLAAAKKVRELQNSNHLEELGIKVG
    ELKFDKEKISNHAINLVNKIRQDLTNSLKHLKVEVIYGQGKVINNQTINVLTDNGEQKITAENIILSPGSSPFVPPGIKI
    DNDTVFTSDEAVKLKELPKWIAIIGSGYIGLEFSDIYTALGCEVTIVEALDNLIPGFDSEISKFAQRKLIESRDIETYSG
    VFASKVIPGKPVVIELTNVKTKQLVDVLEVDACLVATGRIPETSNLGLNNLGIELQKGFIPINDKMQVISNGQVVPHIWS
    IGDATGKMMLAHVASGQGVIAVENICGRNIEIDYRSIPAATFTHPEISYVGLTESAAKELSKLENFEFSSVKAYFKGNSK
    ALAEGDADGFVKIIFRKDSGELLGVHIIGSHASDLIQEAANSIGQHQTIYNLALNIHTHPTLSEVLDDAYKKALVTLNKT
    EKN

    >gi|284929006|ref|YP_003421528.1| Iron-sulfur cluster assembly accessory protein [cyanobacterium UCYN-A]
    MTETNQNQSTGINLTEAALEHVLKLREKQNKDLCLRVGVRQGGCSGMSYIMEFESSENIEKQDKVFEYDGFQLVCDPKSF
    LYLYGLVLDYSDAMIGGGFEFTNPNANQTCGCGKSFGV

    >gi|284929048|ref|YP_003421570.1| peroxiredoxin [cyanobacterium UCYN-A]
    MGVIETVPSVVFKTRVRDESVPGPNPYRWQDLTTEEIFKGKKVVVFSLPGAFTPTCSSNHLPRYEELYNEFKASGVDTII
    CLSVNDAFVMFQWGKQQEAKNVFLLPDGSGEFTRKMGMLVDKSNLGFGMRSWRYSMLVDNCKVEKIFVESGFSDNCPSDP
    FEVSDADTMLAYLKGDKPSGVSKPVKAFIG

    >gi|284929165|ref|YP_003421687.1| nitrogenase-associated protein [cyanobacterium UCYN-A]
    MAQVLFYEKPGCRNNKKQKDFLIAAGHKLDIKNILTESWTIDKLYLFLKDFPITSWFNYSAPRVKSKEIIPENFMNSDKN
    DVLELMIADPLLIRRPLLQVDQTYKIGFEYNIIDTWIGLNPVNFSSEDLETCPRIHEKE

    >gi|284929183|ref|YP_003421705.1| Iron-sulfur cluster assembly accessory protein [cyanobacterium UCYN-A]
    MTVTLTEKATIRLQSFLKKQSNKVSGIRVGVKDGGCNGYEYTLNLVGKPNEKDVCFNQNNISIYVDPNNISLLEGVVIDF
    VDSLTKSGFIFTNPNATGTCDCGKSFSTANCGQSTPCS

    >gi|284929270|ref|YP_003421792.1| copper/silver-translocating P-type ATPase [cyanobacterium UCYN-A]
    MKKQDLQVEGMECSACTLAIEKAVKKISGIEECNINFALKRITILYYPYQTSVKEIISTIKNLGYGAYILDTQKNRLVNN
    GQLKKHYYLFSKVVLGSVVSLILVFISLPEMIGLPIHLIPDYLYNPKLQLILSSPVVFWCGESFYRGAFKSLSQATTNMN
    TLVTMGTGTAFFYSVFITFFPDILISHGLTTNVYYEVSVVIITLILLGKLLENNAREKTTETIKNLIGLQAKTARVIRNN
    ITQDIVIDDVLINDIVIVRPGEKIPVDGKVVEGKSTIDESMVTGESLPVEKIVGDQVIGATINKTGSFKFQAQKIGKDTV
    LSQIIELVEDAQSSKAPIQKIADIVISVFVPIVIGIGIITFSVWLIFFNNLSLAIVTTINVLIIACPCALGLATPTSIIV
    GTGKGAEHGILIKGADSLELAHKLQIIVLDKTGTITEGHPKVTDYIVSDDENSLNYLMLATAVEKYSEHPLSEAIINYAN
    SFEINYDLLNVENFEAVTGLGVQGEINQNLVQIGTQHWMEELEVNISNFSNQANILKKQAKTVVWIAINGKMKGLFAISD
    TIKPSSIEAIKYLKQLGLQIIMLSGDNLQTAEAVATEVSIYKTFAQVLPNEKVEKIRELQQSLKKVVGMVGDGINDAPAL
    AQADVGIAVGTGTDIAISASDITLISGDLRKIAVAIQLSRATMNNIRQNLFFAFIYNIIGIPIAAGILYPSYGILLNPMI
    AGAAMAFSSLSVVSNSLRLRNFRQKKFFI

    >gi|284929338|ref|YP_003421860.1| Peroxiredoxin [cyanobacterium UCYN-A]
    MTLSVKTIAPDFVAFDEEGKRVCLSEYKGKNIVLYFYPKDDTPGCTQEAQSFRDNYKKYEDKNIIIFGVSMDNQKSHKAF
    KEKLNLPFQLLVDEQGKLTDLYDVAGGDYSKRVTYIIDKEGVICHIDDKVITNTHAQDILEKMS

    >gi|284929346|ref|YP_003421868.1| Peroxiredoxin [cyanobacterium UCYN-A]
    MENLLSIGDPAPDFKINNQDGKEFCLGSISNKWLIVYFYPKDNTSGCTKEAKEFTELMPQFESFGAKIIGISPDSEKSHI
    KFINKHDLTIELLSDHNHEVAKKYDVWKLKKFMGREYMGIVRSTFLINLSKSISFIWFNVKVKNHGEIVLEKLQELSVK

    >gi|284929381|ref|YP_003421903.1| dinucleotide-utilizing enzyme possibly involved in molybdopterin or thiamin biosynthesis [cyanobacterium UCYN-A]
    MINPNLETITLNKEEIERYSRHIILPEVGLEGQKKLKAASVICVGTGGLGSPLLLYLAAAGIGNIGIVDFDIVESSNLQR
    QIIHGASWVGKLKIESAKNRILEINPTCQVDLYKNRLSSENAIQILKPYDVVVDGTDNFPTRYLTNDACFLLNKPNIYGS
    IFRFEGQTTVFNYQGGPNYRDLFPEPPPPGMVPS
    CAEGGVLGVLPGIIGTIQATETIKVILGSNNTLSGRLLLYNAWDMT
    FKELKLRSNPNRPVINQLIDYEEFCNVSNVSTFKNKDNSTMISEIAVQELKKLIDSNSESFVLIDVRNVNERQIAHISGS
    VLVPLASIEDGTGIPQIRSLIENKRLIVH
    CKMGGRSIKALEILEKFGIVGTNLKGGINAWSQQIDVSIPQY

    >gi|284929503|ref|YP_003422025.1| Glutaredoxin, GrxC family [cyanobacterium UCYN-A]
    MTNIEIYTWSSCPFCIRAKALLNQKNLKFVEYCIDGDEAARAKMTERTNGKSSVPQIFINNKFIGGCDELHSMEATGGLD
    KLLEE

    >gi|284929543|ref|YP_003422065.1| copper/silver-translocating P-type ATPase [cyanobacterium UCYN-A]
    MASPLQESKKTTSSSLFKTITFDVAGMKCASCVKAIEEKLSEQPGVISAQANLITQVAVVIYNPESTEPSVLTNKLTAVG
    FPSSIRDSQNLTVQQRKSKSDQSKQTEEIHQKINLFIAAILIFISSLGHLTYIGGPDFFVLNDLRFHWVLATIAIAIPGF
    DIFLDGWRGLVNGMANMNTLVGLGTFSAYSISCIALIFPELGWECFFDEPVMLLGFILLGRILEKRAKNRASSALKSLIE
    LQPTFARLSSDPYSENQSSIEIPVEQVRLGEYIKILPGDKIPVDGEIITGETTIDESLVTGESMPVAKKIGDEVSVGTLN
    HSGLIIIKTIRIGNDTTLSQIIFSVENAQMLKPPIQKLTDTIAGYFAYGIISLSILVFIFWFAIGTNWYPQVLNANYNNT
    SFLLSLKLAISVLVVACPCALGLATPMAILVGTGIGAKKGILIKNGDVLEKVSQLYAVVFDKTGTLTTGHPVVTGCKSFG
    VLSSQYLLQLAATVENGTNHPLALAIMEEAKRENLSLLKAKNFCTKIGSGVTAEVEEKEIWLGNKNWLLNNGFNFNSNSY
    YLESLTQKGETIIYVGINKSIEGFLTLKDTLRPEAQETILELKKKGLEIILLTGDNPKVAAAIATELGINKFFAQVNPSN
    KASVIKDLQKQGKIAMVGDGINDAPALVQADIGVSLQGSTQIALESSDIVLMSGSILDILTAINLSLATFTKIRQNLLWA
    FGYNTLSIPLAGGILLPSLGLTISPVIAAALMASSSIIVVINSLSLRYQFR

    >gi|284929686|ref|YP_003422208.1| thiol-disulfide isomerase-like thioredoxin [cyanobacterium UCYN-A]
    MLGSINIHRIKNLLISIIAVILGITIFFGFQTQIHSSSLESQSKQAISMDEAMTNGKPTVLEFYSTWCASCKAMGPNLAK
    LKEEYAETINFTMLNVDNNKWLPDILHYQINGIPTFIFMSHTNEVVAKSIGEQPFEIMKANLEALIKDKKLPYSYMTGKT
    SNFSSTIQKSSDSPLNHSYKSLN