Cupriavidus taiwanensis

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|188590821|ref|YP_001795421.1| putative glutathione peroxydase [Cupriavidus taiwanensis]
    MSRRPLPFRLSVPLAAALTLAAASGALLPAPLRAADKPATSTVPAAAGACPASLNFTFPRLQDDAPQNLCQYAGKVVLVV
    NTASY
    CGFTPQYEGLEALYAKYNARGLVVLGFPSNDFSQEPGSQKEIADFCYNTYGVKFPMLGKSHVRGSEANPMYALLA
    KQTGTAPKWNFYKYLIGRDGKVVASYGSRTTPDDKELVAKIESLLAAPR

    >gi|188590899|ref|YP_001795499.1| periplasmic protein disulfide isomerase I [Cupriavidus taiwanensis]
    MKKLAALFAMFAAVGGLLMSAPSQAAPTEGKEYQVLKTPQPVAAGKIEVTEFFWYGCPHCYDFEPDLEAWVKKQGGNVVF
    KRVPVAFRDDLLPHTKIFYALEAIGKLDAMHMKVFNAIHVDRKRLTDTNEIADFMAKNGVDRKAFLDAYNSFTVTTNSQR
    ANKIADAYKIDGVPTVVVQGKYVTSPSIAGNKQGAVQTMDYLVEQIKAKKM

    >gi|188590901|ref|YP_001795501.1| putative periplasmic metal binding protein [Cupriavidus taiwanensis]
    MWTDAIGQQHAAASGEVRIASLVPSVTELLFALGLESQLVARTGFCIHPEPAVRAVPKVGGTKDVRVARLRELAPTHVVV
    NIDENRRETVDEIRAFVPNVIVTHP
    CAPDDNLPLYRLLGGIFGRHAEAESLCAALQAELDAIRARAWPARHVLYAIWQDP
    WMTVSRDTYISRMLALANWQTWPGGAGAVQACEGGDCSRPNAPGERYPTFRWSDALVRELDLVLLSTEPYRFTEDHADAL
    ERQLGKPVLLVDGEMLSWYGSRAVDGVRYLAALAAAN

    >gi|188591040|ref|YP_001795640.1| conserved hypothetical protein; putative TRANSMEMBRANE PROTEIN [Cupriavidus taiwanensis]
    MTTSPASKTSRKPWPIVAAVVVLALLGWFGYRALSPSGTAPAATFTLLSGEKVSTADLKGKVYLVNFWATSCATCIKEMP
    DMVKTYEQFKGKGLEFVAVAMNYDPPMYVMNFAKTRGLPFKVAMDSDGSAAKAFGNVGLTPTTFVIDKEGRILKRYVGEP
    EWDALHKLLDGALAKSA

    >gi|188591060|ref|YP_001795660.1| selenophosphate synthetase [Cupriavidus taiwanensis]
    MTSPIRLTQYSHGAGCGCKISPKVLDVILAGSGAQHLDPRLWVGNASRDDAAVYALDGAEGQRGVVSTTDFFMPIVDDPF
    DFGRIAATNAISDIYAMGGDPLMAIAILGWPVNVLPPEVAREVVAGGRRACDDAGIPLAGGHSIDAPEPIFGLAVTGLVE
    RAHMKRNDTATPGCRLYLTKPLGIGVLTTAEKKGLLRDDNRHLARDWMCVLNKPGSAFGRLPGVRAMTDVTGFGLLGHLV
    EMADGSGLTARLDYAAVPVLDDVADYIGQGCVPGGTQRNFDSYGHRIAPLTEAQRALLCDPQTSGGLLVAVEPAGEAGFL
    AECQRLGLALAPIGEMVARAALAVEIR

    >gi|188591066|ref|YP_001795666.1| molybdopterin synthase sulfurylase [Cupriavidus taiwanensis]
    MSDAIQDDTSDGLDDEQLLRYSRHILLDELGIEGQRRLLAGHAVVIGAGGLGAAALPFLASAGVGRITVVDNDEVDLTNL
    QRQIIHTTANVGRPKVDSAREGMLRINPGLDIVTVPARVGDAELDQLVASASVVLDCCDNFATRQAVNRACVRHKVPLVS
    GAALRFDGQISVFDRRQPDAPCYACLFPPAEPAPEVA
    CATMGVFAPLVGMVGTVQAAEALKLLANVGDSLAGRLLMVNAL
    SMEWTTMRLARTPDCPVCGGH

    >gi|188591069|ref|YP_001795669.1| putative rhodanese-related sulfurtransferase; putative membrane protein [Cupriavidus taiwanensis]
    MNFFADYNNLALIALAVVSGGLLAWPAISRSAGGKSVNTATATQLINKRGAVVVDIREPAEYAKGHLPQAKSAPLADLAS
    RAAGLAKDKAAPIIVV
    CQTGQRSGKAQAALKEAGYSEIYALEGGIAAWQQAGLPLVK

    >gi|188591070|ref|YP_001795670.1| glutaredoxin [Cupriavidus taiwanensis]
    MARVVMYSTVVCPYCVMAERLLKSRGVETIEKILIDREPGKREEMMSRTGRRTVPQIYIDDTHVGGFDDLSALDRQGGLV
    PLLAA

    >gi|188591090|ref|YP_001795690.1| putative cytochrome c oxidase assembly factor, scoC [Cupriavidus taiwanensis]
    MPRLSSASGLFAAFRRFSLLAALALAVAACGQQKASFRNVDITGAADFGKDFSLTDHTGKVRTLADYKGKAVVMFFGYTH
    CPDVCPTTMAELKAVMEKLGPDADRVQVLFVTVDPERDTQALLAQYVPAFDPRFVGLRPADEASLQKLAKDFKVFYAKVP
    GSSPNNYTVDHSAGSYVFDPNGKLRLFIRHGQGPEPIAHDLKQLLS

    >gi|188591225|ref|YP_001795825.1| conserved hypothetical protein; Predicted redox protein, regulator of disulfide bond formation; osmC-like motif [Cupriavidus taiwanensis]
    MECKVTWMGADGMSFVAQTGSGHIVAMDGAPEGGGHNLAPRPMEMVLLGTGGCTAYDVVLILKRGRQDVTGCSVQLQAER
    AGEDPKVFTRIKFHFVVTGKNLNPATVERAIKLSHEKYCSASIMLAKTAEITHTLEIVEG

    >gi|188591229|ref|YP_001795829.1| iron-sulfur cluster insertion protein ErpA [Cupriavidus taiwanensis]
    MNAVAEAPVTEDVPAPFVFTDSAADKVKQLIEEEGNAELKLRVFVQGGGCSGFQYGFTFDEEVNEDDTTMVKNGVTLLID
    SMSYQYLVGAEIDYKEDINGAQFVIKNPNASTTCGCGSSFSV

    >gi|194288693|ref|YP_002004600.1| putative METHYLATED-DNA--PROTEIN-CYSTEINE METHYLTRANSFERASE [Cupriavidus taiwanensis]
    MPATYDAILSAPFGKIGVRTDGARIRAIVYLPGHVEGLAPADALTQRLAEQLAAYYDDPDAVFDVPLAAAGSAFQQRVWQ
    AICAVPRGATTTYGTIADTIGAMPRAVGQACGQNPFPILVP
    CHRVVSARGIGGFSHHAEDGFYLDVKRWLLRHEGAMLI

    >gi|194288874|ref|YP_002004781.1| thioredoxin reductase, FAD/NAD(P)-binding [Cupriavidus taiwanensis]
    MAKHAKVLILGSGPAGYTAAVYAARANLEPVLITGLAQGGQLMTTTDVENWPGDAKGVQGPELMQRLLAHAEEFKTEIIF
    DHIHTAKLVDEHGKPARPFTLIGDAGEYTCDALIIATGASAQYLGLPSEESFMGRGVSA
    CATCDGFFYKNQEVAVVGGGN
    TAVEEALYLSHIASKVTVIHRRDSFRAEPILVDRLLQREKEGRVVIRYDSVLDEVLGDESGVTGIRVRGTKTGQTEELKL
    AGVFIAIGHKPNTDLFTGQLAMENGYLVTKSGLQGDATATSVPGVFAAGDVQDHVYRQAITSAGTGCMAALDAQRFVEAL
    K

    >gi|194288951|ref|YP_002004858.1| conserved hypothetical protein; putative peroxidase-related enzyme [Cupriavidus taiwanensis]
    MSDTAFPISRYAIPPLADLPDDIRARILEVQEKAGFVPNVFLALAHRPDEFRAFFAYHDALMLKDGGLTKGEREMIVVAT
    SAANQCLY
    CVVAHGAILRIYEKKPLVADQVAVNYLKADIPPRQRAMLDFAMKVCTASHEVGEADFDALRAHGFSDEDAWD
    IAAITAFFGLSNRMANTIGMRPNDEFYLMGRVPKAK

    >gi|194289213|ref|YP_002005120.1| putative Glutathione transferase [Cupriavidus taiwanensis]
    MLKLCGFAASNYYNKVKLALLEKNVPFEEVLAWIGETDPAATPAGKVPYIITESGPLCESEAIAEYVEATYPQTPLLPAD
    PYQAAKVREIIVFLELYLELTARELYPEAFFGGKVSDGVKERQHKLLTRYIPAFASLAKFSPYIAGDRFTLADCAAAVHL
    PLVSSCTKIIYGTDMLAELPVKDYLKTLSQRESVQKVNADRKANTELMMSRRK

    >gi|194289243|ref|YP_002005150.1| putative THIOREDOXIN PROTEIN [Cupriavidus taiwanensis]
    MSTELQAGAPDPSAAPHLDHRAFDALAMREVDDATIDGAIAAAGDALVCVFFWGVDCFNCEMAKKAMLANPGPLRALELH
    WLHANVYAHPQLGRRFGLHGIPVFMFFQNGKKLGRATGWHGHGQFAAAVANARLKASGKPLAG

    >gi|194289265|ref|YP_002005172.1| Fe-S cluster assembly and activation factor [Cupriavidus taiwanensis]
    MITMTEKAAKHVARYLERRGKGVGLRLGVKTTGCSGLAYKLEYVDELLPEDNVFESHGIKVIVDAKSLPYIDGTELDYAR
    EGLNEGFRFNNPNVKDECGCGESFTV

    >gi|194289416|ref|YP_002005323.1| dihydrolipoamide dehydrogenase, FAD/NAD(P)-binding, component of the 2-oxoglutarate dehydrogenase and the pyruvate d
    MSVIEVKVPDIGDFDAVEVIEVLVKAGDTVEVEQSLIVLESDKASMDVPSSAAGKVVDVKVKVGDKVGQGAVICTIEAQA
    AAAAAPAPAQAPAPAQAPAPAAAAPAPAPAAASHAGGADIQCEMLVLGAGPGGYSAAFRAADLGMNTVLVERYGTLGGV
    C
    LNVGCIPSKALLHNAAVIDEAKALAAHGILFGEAKIDLDGLRHYKNQVVGKLTGGLAGMAKARKVQVVRGVGNFLDPHHL
    EVELTEGEGKQTTGKKTVIRFEKAIIAAGSQAVKLPFIPEDPRIVDSTGALELPEVPNKMLVIGGGIIGLEMATVYSTLG
    ADIDIVEMLPGLMNGADRDLVKVWEKKNKDRFGKVMLNTKTVAVEAKPDGIYVRFEGEAAPAEPQRYDLVLVSVGRSPNG
    KRISAEKAGVAVTERGFIDVDKQMRTNVPHIYAIGDIVGQPMLAHKAVHEAHVAAEAAHGEKAFFDAKQIPSVAFTDPEV
    AWAGLTEDECKAQGIKYSKGVFPWAASGRAIANGRDEGFTKLIFDEETHRVIGGGIVGTHAGDLISEVCLAIEMGADAVD
    IGKTIHPHPTLGESIGMAAEIYEGTCTDVPPPRKR

    >gi|194289490|ref|YP_002005397.1| Peroxiredoxin, Antioxidant oxidoreductase [Cupriavidus taiwanensis]
    MKTVGDKLEAFHVVGVKPGFNNHEENGQSAFEDITEKSFEGKWKIIYFYPKDFTFVCPTEIVAFAKLNGDFADRDAIVLG
    GSTDNEFVKLAWRREHKDLNKLNQWQFADVTGSLIDQLGVRDHAAGVALRATFIVDPDNVIQHVSVNNLNVGRNPDEVLR
    ILDGLQTDELCPCNRAVGGATL

    >gi|194289518|ref|YP_002005425.1| conserved hypothetical protein; putative Alkylhydroperoxidase AhpD core [Cupriavidus taiwanensis]
    MTQRLNYFQQSPELSKKLMELNSLFQKTTIEQHIRELVEIRASQLNGCAFCVDMHIKMAKIHGERELRLHHVAIWRESTL
    FSARERAALAWTEALTQLPAQGVPDDVYERVRTQYSEKELSDLTFLVGTINTWNRLNVAFRMVPGSSDKAFGLDKANLE

    >gi|194289567|ref|YP_002005474.1| methionine sulfoxide reductase B [Cupriavidus taiwanensis]
    MTTTKTDAEWRAQLSDIEYRVTREAATERPFTGRYWDHWDQGIYHCVGCGTPLFESATKFDAGCGWPSYFRPINGEVIAE
    HVDHSHGMTRIEVRCKECGSHLGHVFEDGPAPTGLRY
    CINSAALKFDDRDPDQRAADDAHAGGAPKRDPQP

    >gi|194289568|ref|YP_002005475.1| hypothetical protein RALTA_A1459 [Cupriavidus taiwanensis]
    MPDTPPLHATQPGPRAAAPATAMPATLPAPFPTAPGFADLGPQFFTRLLPTPLPSPYLVSVAPAAAALLGWDASIGGRQD
    FVETFIGNQVPDWADPLATVYSGHQFGVWAGQLGDGRAIRLAQAQTDTGPWEIQLKGAGLTPYSRMADGRAVLRSSIREY
    LCSEAMAALGVPTTRALSIMGSDAPVRRETIETAAVVTRLSPTFIRFGHFEHFAAHDDVAALRKLADFVIDNFMPACRDD
    SQPYQALLREVSLRTADLIAHWQAVGFCHGVMNTDNMSILGLTIDYGPFGFLDAFDANHICNHSDTQGRYAYSQQPQVAF
    WNLHCLAQALLPLWLPPAQADQESARDAAVEAARAALDPFRDRYAAAFFRHYRAKLGLRPPVGGDDKADEPLLTSLFQLL
    HSQRVDYTLFWRRLCRISSTDASRDGPVRDLFLDRAAFDAWVADYRVRLRTEQSHDAARELEMLAVNPKYVLRNHLAETA
    IRQARGKDFSEVERLLAVLSRPFDEQPEAEHYAALPPDWAAGLEVS
    CSS

    >gi|194289619|ref|YP_002005526.1| conserved hypothetical protein, COG2128 [Cupriavidus taiwanensis]
    MSEIIQSHGFTNEVLDWKAWLDVVDLDQATPEQIAVLEESHPKAKVQDYYRFLVHQPEILRQRSTAFNAIMYAPGGMPRA
    ERELSTTVVSRINGCVY
    CASVHAQRFEQLAKRNDVIRQVFDDPYTAGTTERERAIAKFSAELTERPAEVTAEQLRPLREA
    GVTDAEILDLIHSIAIFAWANRLMLNLGEPVFPEQTGA

    >gi|194289805|ref|YP_002005712.1| putative oxidoreductase, Ars family [Cupriavidus taiwanensis]
    MTVLLYGIPNCDTVKKARTWLDANGVAYTFHDFKKQGVDEAMLRGWLRHVPLATLLNRKGTTWRALSDADKARADEETGA
    IALMQQSPSLIKRPVLAHDGKVMVGFSADQYASQF

    >gi|194289832|ref|YP_002005739.1| disulfide bond formation protein B [Cupriavidus taiwanensis]
    MQANSRAYFLLIAIVSFALVGVALYLQIEKGYQPCPLCVMQRFAFIGIGLFSLLAAVAQNTRSLWQGLGMLSGIAGIAVA
    VYHVSLLLNPKAS
    CGIDPLENWVNALPTAKVLPQLFYSDGLCTAPLPPVLGLSVPAWSLIWLFILTLTLAVGLIRREKNF
    R

    >gi|194289913|ref|YP_002005820.1| Putative peroxiredoxin [Cupriavidus taiwanensis]
    MTVSLNKAIPDFSAPMTGDATFRLADYRGKTVVLYFYPKDNTPGCTTEAMNFRDQYEDFEKAGVQVFGISRDSLRSHENF
    KAKLELPFELISDADENVCTLFDVIKMKKLYGKEHRGIERSTFVIDGKGILRHELRGIKVPNHVDEVLEIVRGL

    >gi|194289967|ref|YP_002005874.1| dihydrolipoamide dehydrogenase [Cupriavidus taiwanensis]
    MSKQFDVLVIGAGPGGYIAAIRAGQLGLNVACCEGNPYDDPKGEARLGGTCLNVGCIPSKALLASSEEFENAQHHLGDHG
    ITVGDVKVDVAKMLKRKDDIVGKMTKGIEFLFRKNKVTLLKGYGKFVGKTAEGFQVEIAGEVVTAKQVIIATGSKARHLP
    GIKVDNDLVSDNEGALKFPAVPKKLGVIGAGVIGLELGSVWRRLGADVTVLEALPAFLGAADEGVAKEAQKQLTKQGLKF
    SLGVKVDEVTTAKNGVTVKYTDKDGKAQTLEVDRLIVSVGRVPNTDNLGLDAVGLAVDQRGFIEVDDHCATKVPGLWAIG
    DVVRGPMLAHKAEDEGVAVAERIAGQKPHIDYNCIPWVIYTFPEIAWVGKTEAQLKAEGREYKAGQFPFMANGRALGMGH
    ADGFVKMLADAKTDEILGVHIVAANASDLIAEAVVAMEFKAASEDIGRVCHPHPSMSEVMREAALAVDKRQLNM

    >gi|194290037|ref|YP_002005944.1| thioredoxin 1 [Cupriavidus taiwanensis]
    MSEQIKYVSDASFDADVLQSDKPVLLDFWAEWCGPCKMIAPILDEVAKDYGDKLQIAKINVDENQQVPAKFGIRGIPTLI
    LFKNGAVAAQKVGALSKSQLTAFLDGNL

    >gi|194290156|ref|YP_002006063.1| hypothetical protein RALTA_A2060 [Cupriavidus taiwanensis]
    MAATPALTLLGRAYCHLCEDMKVALEPLRRDFSFTLHEVDVDADAALEARFGELVPVLMPGKPADLRADSSANAAPLCHY
    FLDEAATRVWLAAHGATRTAR

    >gi|194290187|ref|YP_002006094.1| putative THIOREDOXIN REDUCTASE; class-II pyridine nucleotide-disulfide oxidoreductase family. [Cupriavidus taiwanensis]
    MDLSIPNPVADATRQVEGGSPAGGQPLEIDALIVGAGPVGLFQVFELGLLEIKAHVIDSLKVVGGQCVELYPDKPIYDIP
    AVPSCTGQELTDNLLKQIEPFEPTFHLGQEVSVVERRDDGRFFVETSLGTRFITKTIFIAAGVGSFQPRTLKVDGIDKFD
    GKQLFYRVKDPSRFHGRNLVIVGGGDSALDWTLDLVGKAESVVMIHRRDGFRAAPASVAKMKELCEQMEMQFLVGQISGY
    EEKDGVLTEIKVSGADGVTRRLPLDDLLVFFGLSPKLGPIAEWGLDLERKQIKVDTEKFQTNIPGIFAVGDINTYPGKKK
    LILSGFHEAALAAFGAAPYIFPEKKIHMQYTTTSPKLHKVLGVESPVFD

    >gi|194290247|ref|YP_002006154.1| putative Glutathione S transferase [Cupriavidus taiwanensis]
    MLRIWGRLSSINVQKVVWCARELHLDHERVDIGVTKGDLDTEAYVRLNPNRQIPVIEDFRGTDVGGEPFVLWESNAIVRY
    LCARYGEGTLWPEDVKARASADRWMDWQTTAFSPAMVTAFLNLVRKPEAERDPAAIEASCERTEPLAALLDKALAGREFI
    GGDRFTMADISLACAAHRWMGLPRQHQPRPELERWLSAMRARPAAGGILELPLR

    >gi|194290330|ref|YP_002006237.1| 3-mercaptopyruvate sulfurtransferase [Cupriavidus taiwanensis]
    MQKPLISVTALQSLLAGPGRCVVIDCSFDLANPAAGREAYRTGHLPGAFYLHLDNELSGPKTGRNGRHPLPDADDLVARL
    QALGIDDDTPVVAYDAQGGMFAARLWWLLRWIGHDAVAVLDGGKDAWVRAGLPLEHDAAAEPEVPGTIRRGKSLVPTVDA
    DVLLGNLGQGRLLVVDARAPDRFRGENETLDPVGGHIPGAVNRFFKDNLDAEGRFKPAETLRAEFGAVLGTHAPAQAVMQ
    CGSGVTACHNLLALEAAGLGGAALYPGSWSEWCADPARPVATGPA

    >gi|194290375|ref|YP_002006282.1| putative THIOREDOXIN PROTEIN [Cupriavidus taiwanensis]
    MSDVTLQNFETEVIDASRQMPVLVDFWAPWCGPCRTLGPMLERLEAEADGQWKLAKVNVDENQELAAHFGVRSIPHVVAI
    ADGQAVDQFTGVLPESGLREFLARLAPGQGRSPLDDAMELAAAGNRDGAETLFADAIAADPESDAPRLAYIGFLLDGNAI
    DRARTEFAALSPRAEQADGYGALRTRIEAMENAAGLPDAATLAGRIDADPRDLAARMDLARLMIAQQQYEPALEQLLAIV
    RTDRGFEEDIGRRTMLSVFEMLADRPDVVSRWRRQLSTSLN

    >gi|194290385|ref|YP_002006292.1| methionine sulfoxide reductase A [Cupriavidus taiwanensis]
    MEHGLETATLGGGCFWCLEAVYQQVEGVVAVESGYTGGHVDHPTYQQVCAGDTGHVEVVRVSFDPSVINYREILEIFFAI
    HDPTTPDRQGNDVGPQYRSAIFTHSEAQRATAEYVMRELAAAKVFDAPIVTQVEPEQPYWRAEASHQNYYQDHPSQGYCA
    FVISPKLAKFRKQFGAKLRK

    >gi|194290398|ref|YP_002006305.1| putative ANTIOXIDANT OXIDOREDUCTASE; putative peroxidase, Peroxiredoxin [Cupriavidus taiwanensis]
    MALRLGDIAPDFEQDSSEGRIRFHAWLGDSWGVLFSHPADYTPVCTTELGLTARLKDEFARRGVKAIALSVDTVDSHRGW
    IADINETQSTEVNFPILADADRKVSQLYDMIHPNANETLTVRSLFIIDPNKKVRLIITYPASTGRNFNEVLRVIDSLQLT
    DSHSVATPGNWQDGDDVVIVPSLKDEAVLREKFPKGYQAVRPYLRLTPQPNK

    >gi|194290403|ref|YP_002006310.1| conserved hypothetical protein; putative TRANSMEMBRANE PROTEIN [Cupriavidus taiwanensis]
    MPEIDLAALSRSVLLSTFVLTFLFGAVLQRTHFCTMGAVSDIVNMGDWSRMRMWALAIGVAMIGTGVLAWNGAIDPTKTI
    YAASKLAWLSALAGGLMFGFGMVLASG
    CGSKTLVRIGAGNLKSLVVFVFLGLSAYMTLRGLFGVVRVNTVDAVALALPTT
    QDLPSVLAQGSGTARGVLQLGLGLALGGVLAAWALAGRGFRTFDNLLGGIGVGLIIVAMWYVSGHLGYVAEDPNTLEELF
    VSTNSGRMESLSFVAPYAYTLDWLMMFSDKSKVLTIGIVSVFGVIAGAAAYALATRTFRWEGFGNAEDVANHMVGGILMG
    AGGVTALGCTVGQGLSGVSTLALGSFIALAGILAGAVLAFRYQMWRLERML

    >gi|194290447|ref|YP_002006354.1| conserved hypothetical protein, putative sulfurtransferase, Rhodanese family [Cupriavidus taiwanensis]
    MQVIQATELAQWLADASRARPVLLDVREGWEVQTCALPGITHIPMRDIPARAAELDEDADIVCICHHGARSMQVAAYLER
    QGYGKVYNLTGGVDAWASQVDPAMPKY

    >gi|194290662|ref|YP_002006569.1| Putative glutathione peroxidase [Cupriavidus taiwanensis]
    MSNVYQFEASSLAGQPVPLSQFQGKVMLVVNTASECGFTPQYEGLQKLYDEYHGRGLEVLGFPCNQFGKQEPGDAQQIGQ
    FCETRFAVRFPMFAKIDVNGPNAHPLYQWLTTEKRGVLGTQGIKWNFTKFLLRRDGTVFKRYAPTTKPEELRADIERLLS
    DPAA

    >gi|194290729|ref|YP_002006636.1| putative disulfide reductase, TlpA-like family; putative thiol-disulfide oxidoreductase [Cupriavidus taiwanensis]
    MTETVAPPARRSRLWLWIAVAVVACAAGALAGHFVFSPKPASDEAVETLFQSRLPDPAGAELDLGKLRGKTVVVNFWAPW
    CGPCVEEMPELTALHEELKHRQVEFVGIGIDSAANIQQFTKKVPVSYPLAVAGFAGTDLSRNFGNSAGGLPYTVVINPDG
    TVKYRKMGRVTADELRAVLPRA

    >gi|194290735|ref|YP_002006642.1| thiol peroxidase [Cupriavidus taiwanensis]
    MNSWPAAGPNPSLAAGLAPAPDCNRKLIRYQGVDMSNVTLGGNAIEVAGKFPQAGDKAPAFSLVGKDLKDVSLADFAGKR
    KVLNIVPSLDTPV
    CQASARKFNEAASGLANTVVLTISADLPFAMGRFCTAEGLANVVPLSTMRGAEFKGNYGVDIKTGPL
    AGVTARAVVVLDENDTVKYSQLVPEIKNEPDYDAALAALK

    >gi|194290807|ref|YP_002006714.1| putative peroxiredoxin [Cupriavidus taiwanensis]
    MITVGSRVPDATLYEFFETESNGCALGPNAFKVADLVRGRKIVVFGLPGAFTPTCSAKHVPGFVQHAEALRAAGVDEVWC
    VSVNDAFVMGAWGREQQVAGKVRMMADGSAEWTRALGLDQDLSARGLGVRAKRFAMVIEDGVVTRIDVEAPGEFRVSSAE
    AVLAALRG

    >gi|194290866|ref|YP_002006773.1| putative THIOL:DISULFIDE INTERCHANGE PROTEIN [Cupriavidus taiwanensis]
    MFPSLRRRPAVYATITAIAGGLAAAGFALHAMAAGEPGTDRIKESLQKMLGGRAEVKSVGKTPVPGLFEANIGGQVVYTD
    ATGRYILNGEMIDTRTGTNLTEERLAEINRIKWSDLPLARAIKWSKGDGSRQIAVFSDPN
    CGYCKRIEQTFQQMDNITVY
    TFLYPVLSPDSETKSKQVWCAADRTKAWRDWMLKQVALTGNGSCKTPLEENLALGHSMNVTGTPAVFFTDGTRIPGAADV
    ATLERKLASIKK

    >gi|194290879|ref|YP_002006786.1| conserved hypothetical protein; putative monothiol glutaredoxin [Cupriavidus taiwanensis]
    MSDVQQQIDQIVKGNPVVLFMKGTAQFPMCGFSGRAIQILKACGVDAPTTVNVLDDEGIRQGIKEYANWPTIPQLYVNGE
    FIGGSDIMMEMYQNGELQTLLKG

    >gi|194290933|ref|YP_002006840.1| stringent starvation protein A, regulator of transcription [Cupriavidus taiwanensis]
    MMVLYSGTTCPFSQRCRLVLFEKGMDFEIRDVDLFNKPEDISVMNPYGQVPILVERDLILYESNIINEYIDERFPHPQLM
    PADPVQRARARLFLFNFEKELFTHVYTLENEKGKAAEKNHERARAAIRDRLTQLAPIFVKNKYMLGEEFSMLDVAIAPLL
    WRLDHYGIELSKNAAPLLKYAERIFSRPAYIEALTPSEKVMRR

    >gi|194290994|ref|YP_002006901.1| thiol:disulfide interchange protein, cytochrome c-type biogenesis, N-terminal interacts with and activates DsbC [Cupriavidus taiwanensis]
    MNIGLARRAGTPGQMWARHIAAALLAALAWLCLAGSLHAATEDDFLPPEQAFRFAASQPDDKTIEVRFDVAPGYYMYRER
    FSFAAQPAGVKLGAPAYPQGKVKFDETFGKEMETYRDSVVIRIPVEAAPADGKWTLTVTSQGCADKGLCYPPMESVHKVG
    GSALADLFGKRGRSDAPAAERAPAPAAPAMPGAATTLRADDSDRIAGALASRNLGLIAALFFGLGLLLTFTPCVLPMVPI
    LSSIVVGEHVTRSRALLVSLAYVLGMAVVYTAVGVAAGLLGEGLSAALQKPWVLGAFAALMVALALSMFGLYELQLPQRW
    QTRLAESSNRRQGGQIAGAAAMGAISALIVGPCVTAPLAGALAYIAQSRDAVTGGAALFAMALGMGVPLVLVGVGAGNLL
    PRAGRWMEVTKRFFGFLLLGVALWMLGPVLPAWATMLLLAALLLVAAVFLGAFDGLGPDPRNLVRVGKGVGVLFAIAAAI
    VLIGVASGGRDPLQPLSHLSVARTVGENAGGAQTVRFERVRSVAELDARVAQAAAAGKPVLLDFYADW
    CVSCKEMERMTF
    VDPRVRARLSEIVLLQADVTANNADDKALLKRFGLFGPPGIILFGPDGRERPVRVIGYQSANRFLESLERAFGTRTRT

    >gi|194291092|ref|YP_002006999.1| putative disulfite reductase/thioredoxin, putative soxW homolog [Cupriavidus taiwanensis]
    MLLRALLAAGLVMAAAGAAALEVGDTVRLPEVRTLDGRTLSAAALAGKPLVVEYWATWCPFCAMQNPRLQKLYERTRGTP
    LQVLAISIDKDPREAADYMNKRGYTFPATMDSPALQAVFGKRKGLPELYVIDARGRVVQKEVGEMLEDDVAALERYAKP

    >gi|194291113|ref|YP_002007020.1| putative arsenate reductase with thioredoxin-like domain [Cupriavidus taiwanensis]
    MITIYHNPRCSKSRETLALVQAAAERLAEPVEIVEYLKDPPSLSTLRQLHTMLGVPVREMLRDNEAPYAELGLADPGLTD
    AELLAAVADNPILLQRPVVVRNRRAAIGRPPENVAPLLA

    >gi|194291197|ref|YP_002007104.1| copper transporting P-type ATPase [Cupriavidus taiwanensis]
    MPDSSAVLASQPVGTDLRPPADAMPEWRLPVEGMTCASCVGRVEKALAKVPGVRDVAVNLATEAATLRAASAAVLPAAAR
    AVADAGYAVPQDTIELNIADMT
    CASCVARVEKALRAVPGVVEATVNLATERASVTLLRGTADPAALAGAVARAGYGATPV
    VDAAQAGAVARPGQPGQATRPAFWDSPWPVAISAALSLPLVAPMVLEWFGVHWMLPAWVQWLLATPVQFVFGWRFYKAGW
    KAVRAGAGNMDLLVALGTTAAYGLSLWLMWRTPADAMPHLYFESAAVVITLVRLGKWLETRAKRQTADAIRALAALRPDT
    ARVRRGGVEQGVPLSAVVVGDEIVVRPGERIPVDAEVVEGTSHADESMLTGESLPVPKQPGDRITGGAINFEGLLVARTM
    AVGAETVLARIIRMVEHAQAAKAPIQRLVDRVSAVFVPVVLAIALVTVLGWGLFAGDWEAALLNAVAVLVIACPCALGLA
    TPTAIMAGTGAGARAGILIKDAEALEVAHRVGVVAFDKTGTLTVGKPEVVALHAADPADADGSALLAQLAALQAGSEHPL
    ARAVLAAAQARGIAVPQASGVQALPGRGIAGVVDGQSLQLGSERLRDSLGAPAGALAAVAQQLQSEGRTVSWLVQAAPPR
    VAGLVAFGDAIKPGAPAAIARLRAAGVRTVMLTGDNAGAAARVAQALGLDDVQAEVLPEDKAARVQALGRDGAVVAMVGD
    GINDAPALAAADVGIAMSTGTDVAMHAAGITLMRGDPALVADALAVSHRTVRKIRQNLFWAFIYNVVGIPLAAAGMLNPV
    VAGAAMAFSSVSVVGNALLLRRWRAQAGTAPAASTATQGGAR

    >gi|194291230|ref|YP_002007137.1| PUTATIVE THIOREDOXIN [Cupriavidus taiwanensis]
    MTVYFPERDAGAIADCLAARPQGRLVACLCAQWCGTCRDYLTALTALAARYPDDCFVWIDIETHADALGDIDIENFPTVL
    VQPAAGGAPQFYGTLLPHIEVLERMLARGAAMPAPTEDMPHVLDWLLDGGRGGA

    >gi|194291252|ref|YP_002007159.1| putative GLUTATHIONE REDUCTASE OXIDOREDUCTASE [Cupriavidus taiwanensis]
    MTKRQTPISTAPGASAPRRAREVSAAPPVQQVPRARSGRGRRNGRNDRAREADLVVIGGGSAGVACARRAAAHGARVILV
    ERDAIGGT
    CVNRGCVPKKMLSYGASWSAILSGCLSHTGGHEDWRDAIVRVNAEVARLNVGYTQRLTDSGVEVLRGEARLT
    GAEEVCVGDQVIHARRILIATGARPRTLDVPGGDLAASSDDVFTWQSLPASVAVIGGGYIGVEQASILSRYGVKVDLIVA
    GERLLPHFDHDIAAALADALTARGVRLHLNARVHLLSQANGAVEVCYQPTNDPSRAGQTESVRAQAALAAIGRVSNVQGL
    GLEALGVAFGERCGIRVDRQFRSSVRSVYALGDAIDGLHLTPVATAQGRWLADRLFGRRGDRADFDFVPTAVFCEPAIGA
    VGLTEAQAIEAAGKPERIRTVVKRFVSLEHRFAGTPHQSVFKLVLNARSGRVLGVHLMDNAAPEIVQALAVALRLGVREA
    HLQTTVQVHPTVAEELFG

    >gi|188591824|ref|YP_001796423.1| arsenate reductase [Cupriavidus taiwanensis]
    MSVTIYHNPACGTSRNALAMIRNAGVEPNVIEYLNTPPDRQTLQQMIRLAGLTVRQAIREKGTPYAELGLSDPALTDDQL
    LDAMLAQPILINRPFVITELGVRLCRPSEVVLDILPSPQQAAFTKEDGEVVIDEQGRRVP

    >gi|188591965|ref|YP_001796563.1| Organic hydroperoxide resistance protein, osmC family [Cupriavidus taiwanensis]
    MTRIEKVLYTGKVHITAGGRDGEARSDDGRLNLQLSSPGSRGAGTNPEQLLAAGWSACFIGAIGLAAGKRQVKLPSDLSV
    DAEVDLGTAGDAYLLQARLNVSIPGIERELAQALVDTAHQT
    CPYSKALRGNIHVETRLV

    >gi|188591981|ref|YP_001796579.1| putative sulfurtransferase, DedA and GlpE domains [Cupriavidus taiwanensis]
    MGELQALLENHGLMLVFLNVLVEQAGLPVPAYPMLFVAGALGVQETGPSIGAVLAAVIAACVIADTGWYFAGRRLGQPML
    RTICKVSISPDSCIRQTQSLYLRVGPRSLVVAKLLPGAGALSTAMAGMTGTPLPVFLFYDAIGALVWAGSGLLIGVVFSD
    FIDAILEGFSTYGHMAVVAVVGAFLLFLAWRSWRRFRLLRITRRVPRMSVDELESRRLAGTLPVVIDVRAHGDLPMERIP
    GSMVLDMQGALDSLDALGVAPAEADIVVYCA
    CPNEMSAALLAERLRLAGYARTWALAGGFDEWKRRHGATVPPAVTHPGP
    GQATAR

    >gi|188592000|ref|YP_001796598.1| acetoin catabolism operon, putative enzyme involved in degradation of aromatic compounds [Cupriavidus taiwanensis]
    MSTELKTRLAQINKQFAALAQVQPAAMSAFQGLMKAATQEGSLPASVKELVAVALAVQKGCDDCVLFHTAQALCHGAARE
    QLAEVLALNIEMGGGPGAMYASKALAYFDALNG

    >gi|188592004|ref|YP_001796602.1| putative hydroperoxide resistance protein, OsmC-like protein [Cupriavidus taiwanensis]
    MMRWGRSMTIQATWKPSQGNSICQLTNGTAAWQADLDASAGGDTRYPNPHDLLDSALAACTTLTLQLYAKRKGYPITEVH
    VSVGHEEANGTYTMQREVKVSGDLSPQILEDLLRVANRCPVHKTLSGQFSIQTSLA

    >gi|188592006|ref|YP_001796604.1| Organic hydroperoxide resistance protein ohrB, osmC family [Cupriavidus taiwanensis]
    MKLEKVVYTAHATATGGRDGRATTSDGQLDAKLAVPKEMGGAGNGLNPEQLFAAGYSACFLGAMRYVASQQKINVPADAS
    IQGAVGIGPIPQGFGIQVELKISLPGFEREAAEKLIEQAHQV
    CPYSNATRGNIDVTLTLV

    >gi|188592267|ref|YP_001796865.1| glutathione S-transferase [Cupriavidus taiwanensis]
    MKLYYAPGACSLAAHIALIEAGLPFSTERVDLRAQPHKTESGADYKTVNAKGYVPTLALDSGDQLSEAAVVVQYIADQAP
    EKKLAPACNTLERYHLQEWLNFISSELHKGFGPFWKPDTPQDQKEATWARLSQRFDWLAPQLADKDYLMGQFSVADAYLF
    TILRWPDHFKLSLERWPALQAYRARVGARPAVKQALQDEGIG

    >gi|188592298|ref|YP_001796896.1| putative thioredoxin, DSBA oxidoreductase family [Cupriavidus taiwanensis]
    MIRSQRMQCPDNSPHPDNGSRRQSFALDQPATLSVEAYFDLICPWCLIGKRHLETAIDWLGRERPDVVVQVAWRSYPLIP
    TTPPAGLPYREFYLARLGSPEAVAMRQAQVRAAARDAGLTLALERIETFPNTLLAHRLVRHARQQAGADVAGLLIEELFQ
    RYFIRGENIGDPRLLRQAAASCGIALPEHADSTGAHDLDWLPSVHGPLDPPARAGLGVPCFMFNGTHSVSGARPPEVLLQ
    TMHQALARAKRRATLAAG

    >gi|194291413|ref|YP_002007320.1| periplasmic thioredoxin, cytochrome c-type biogenesis [Cupriavidus taiwanensis]
    MTRFLLPLAAFLALAVALAAGLRHDPRELPSPLVGRSAPAFRLPLLAPEGRTLDSADLRGKVWLLNVWASWCAACRTEHP
    LLVDFAARAPVPLYGLNYKDEAVAARDWLRRLGNPYTASLVDADGRVGIDYGVYGVPETFVIDQHGVVRYRQVGPVTREV
    LERKLIPLIEQLQRQGGGHA

    >gi|194291617|ref|YP_002007524.1| Organic hydroperoxide resistance protein ohrAB (General stress protein 17o) (Gsp17o); osmC family [Cupriavidus taiwanensis]
    MANKGLQAPPLSLLDKYRGPGFDPLYTTTVTVTGGETGHGRASGVARSDDGNLVLDLRLPAALGGPGHGTNPEQLFAAGY
    AACFHGALYLLARRARLRIDNASVEVKVALGRDPVDGAYALVADVRVRMPGVARALAEELVRNTERF
    CPYVKMARQGIAS
    VVAVVE

    >gi|194291679|ref|YP_002007586.1| O6-methylguanine-DNA methyltransferase; transcriptional regulator of DNA repair (AraC/Xyl family) (N-terminal); bifunctional [Cupriavidus taiwanensis]
    MSRSIRRPAQPSEATLAEQDPRWARVLARDPGADRDFVYAVRTTGVYCLPSSPSRLPHPANVEFFDNAAAAEAAGYRPSR
    RATGPALATRHAAMVAEACRRIEAADAVPTLPELARAAGVSPYHFHRLFKTATGLTPRAYAAAHRARKLRGQLGISDTVT
    EAIYDAGFGSNSRFYETSDAVLGMTPSRYRAGGADMDIRFAIGQCSLGAILVAQSARGVCAILLGDDPQALLQDLQDQFP
    RANLIGGDAQFEQLVAQVVGLIEAPSIGLALPLDVRGTAFQQRVWQALREIPAGSTASYAEIAARIGAPRAVRAVAQACA
    ANHLAVAIP
    CHRVVRSDGNLSGYRWGVARKRELLEREAQG

    >gi|194291683|ref|YP_002007590.1| peroxiredoxin/glutaredoxin, Thioredoxin reductase [Cupriavidus taiwanensis]
    MLQSREGQRVPNVAFRIREDNEWKTVTTAELFDGKTVVVFSLPGAFTPTCSSTHLPRYNELAPVFARHGVDDILCVSVND
    TFVMNEWAKDQESGNITMIPDGNGEFTEGMGMLVDKADLGFGKRSWRYAMLVKDGVVQKMFIEPEEPGDPFKVSDADTML
    AYIAPGARKPDQVVVFSKVG
    CSFCAKAKQLLDDNGFDYVDVPLDNKVRGKVLGAVSGEMTAPQVFINGKLIGGAEALQQY
    LAA

    >gi|194291684|ref|YP_002007591.1| dihydrolipoamide dehydrogenase [Cupriavidus taiwanensis]
    MTQPDASEHKGTTAMTTIQTDVAVIGAGTAGLAAYRAAIAAGKRAVIIEGGPYGTTCARVGCMPSKLLIAAAEAAHELRH
    TAPFGVHVDGHIRIDGREVMARVRSERDRFVGFVVRGVENIAPADRIRGYARFIDTTTLDVDGHTTVRASRVVIATGSTP
    VLPAPFQVFGDRLIVNDDVFSWQDLPGSVVVFGPGVIGLELGQALSRLGVRVRVFGVSGSLGPLTDPVVRAEAARTFNQE
    FYLDPDARITDMGRDGDQVVVTYLDREGRSVTERFDYALAATGRAPNVRGLGLENTGLALDARGVPLFDANTLQCGNAPV
    FIAGDANNILPLLHEAADEGKAAGENAANYPQVQPLARRAPIAVVFTDPQIAMVGQRYAELAARGEDSFVTGEVSFEDQG
    RSRVMLKNRGLMHVYADKATGRFLGAEWTGPRAENIAHLLAWSYQQGLTIAQMLTMPFYHPVVEEGLRTALRDAAAKLEG


    >gi|194291923|ref|YP_002007830.1| putative thiol-disulfide isomerase/thioredoxin [Cupriavidus taiwanensis]
    MTQHYAATEPTRTEVDTLSGATVLEFGAPWCGYCQRAQPALAEAFAVHPDLRHLKIEDGSGRPLGRSFRIKLWPTLVFLR
    DGQEVARLVRPTEAQPIREAMRRIA

    >gi|194292021|ref|YP_002007928.1| putative Thiol-disulfide oxidoreductase [Cupriavidus taiwanensis]
    MPRILRTLFAAAAFAVAPLAIQSAAAAPAAPTDYGKAPEFTGIGKWLNSEPLTVAGLRGKVVLVDFWTYSCINCINTLPH
    VRKWYDKYRDQGLVVVGVHTPEYAFERSTGNVQAALKRFDIRYPVAQDNAYATWNAWRNQYWPALYLVDADGNVVYKHFG
    EGQYAETEAAIQKALSQRR

    >gi|194292132|ref|YP_002008039.1| hypothetical protein RALTA_B1386 [Cupriavidus taiwanensis]
    MARIHDIDPDALQGEARTTFERVEREYGAFGNMLRVLGHRPPAVAHLFGLLLDSARDALITRRHLEIVLVTASRLNACHY
    CISHHVPRLEALGVTPETVERILEPDVPGLDAVERLVRDYTVQVTTQRVTDTVVARLREHFTEAQVVELTLRAALCAFFA
    RFNEALEIQVEPELLAAEIHAT

    >gi|194292290|ref|YP_002008197.1| putative enzyme [Cupriavidus taiwanensis]
    MPDPHASMTFESFTRAAPAVYAALRALGTAVDDSGLDKRLTELVKVRVSQLNGCAFCLQFHLNLARRHGVDARKLDLVAV
    WREAGVHSAREQAALGWAEALTVLGASAGAGAEHARQQALARVREHFSESEIPFLAASIAAIQAWNRIAAGLQFPPPPAE
    PARSAA

    >gi|194292303|ref|YP_002008210.1| putative Thiosulfate sulfurtransferase Rhodanese-like [Cupriavidus taiwanensis]
    MSTVPATPAAPAFPTVSPEAVRNALRNREEIALIDVREEDPFAQAHPLWAANFPLSRLELDAWARIPRRDTLVVVYGEHA
    GTDLAPRAAAVLQGLGYTRVHLLEGGLRAWIDGGGEVFRDVNVPSKSFGEVVEAARHTPSLAAEEVQALIDSRADVVIVD
    ARRFDEYQTMSIPTATSVPGAELVLRVRELAPDPRTRVIVN
    CAGRTRSIIGTQSLVNAGIPNPVAALRNGTIGWTLAGQQ
    LDHGASRRAPAAVSDANRDSARRGAREIADRAGVRRIALAQLDTLQAPGRTVYRFDVRTPEEFADGHLPGFANAPGGQLV
    QETDHSAPVRGARIVLADDDDVRAGMTGSWLAQMGWEVWVLEPVAASARSETGAVSAQGPAPAPVASVGTAQLAAWLDAG
    DGSTAVLDFTTSANYVKRHIPGAYFVIRAQLADALARIPRPRRYVLTCGTSLLARFAAADLRRLTDAEVLVLEGGTQAWI
    GAGLPLESGETRLASDRTDRYRRPYEGTDNPREAMQGYLDWEFGLIAQLERDGTHGFRVV

    >gi|194292637|ref|YP_002008544.1| conserved hypothetical protein; 4 Rhodanese-like domains; contains extra N_term COG5553 domain (modular protein) [Cupriavidus taiwanensis]
    MPGSDVASRRHAAVAAFIAEARQLLERAEPADRETLQTVARALERLGAQRDLFPSAQFPVSADNPARVYRLSEYLDGRYA
    LYVSAGLPGKAQPPHDHTTWAIIAGITGNERNVFYRREATDDPARDRLTETGRSDVVSGSSVTLLPDDVHTIELVGNEPG
    LHLHFYGLALDRLSGRVVFEGAAGGSYRHFGPPRHIAHAAIDAAALKTALADGDEIALLDVRETGVFVRGHLLLAASAPL
    WRLELLADRLVPRRDTRIVLTDGGEGGDSLAHQAAAKLLRLGWRNVSVLTGGTQAWAAAGFEIFSGSNVPSKAFGEVIEH
    QKHTPWISADELQQRIERGDDLVVVDSRTTEEFADFSLPFAHSLPGAELVYRIGELAPRPETLVVVN
    CAGRTRSIVGAQT
    LIDAGVPNPVVSLKDGTMAWLLNGRTLAHGRHTPLPEPERATREAARARAEAVASRAGVRRLDDAGLARLEREAGQHTLY
    RFDVRTRAEYEAGHLPGWRWAPGGQLVQATDEYAATRHARIVLADWDGVRALTTGAWLAQLGAHEVYVYAPPADAAVDTG
    AEPLRVLSSRPAAQPLSALQVDALLQAGRARVFDVERRAAYERRHVAGAQFAVPDRLEALVADSPADETVLVTSSDGVLA
    RVVAAELAARSGRDVRYLAGGTQAWTAAGLATGSGAHGVLTGEDDYWYSPYHHADVAQRDAGFRAYLDWEVGLVAQLERE
    GDIGIRLLAH

    >gi|194292639|ref|YP_002008546.1| conserved hypothetical protein, putative transferase, 4 Rhodanese-like domains [Cupriavidus taiwanensis]
    MTDMTHTIDASTLRKWLNDGQSLALFDVREHGQYGEGHPFFAVPLPYSRLELEVGRLAPRRTERIVLFDDGAGDVATRAA
    RRLAALGYADVTLLDGGAPAWAAAGYTLFKGANVPSKTFGEWVEHIQHTPHLSADALVARRAAGEPFVLVDGRTNEEHRK
    MTIPGALGCPNGELALRLPALLVNPSTPVVVH
    CAGRTRSIIGAQTLRNLGLPNPVLALENGTQGWYLAGHALEHGSERFA
    DAVPCAPLLQAARDRSARLLRRFGLPSLSTAQAQQWLDDEHRTTYLFDIRTAEEFTRRSIAGAVHAPGGQLIQATDRYIG
    VRGSRVIVFDDDGVRAPVIASWLHQLGFDSAVLADGVDSGVTVPVRPQPDVGAGPRVLGVGELRTLHDESAALAVVDLRE
    SAAFNQGHAQGSVWSTRPRLLQALQSLGTTPDHPVVLLASEAEVAALAWKDLLEAGYANVFRTEGGYQTWLSAGLAQAAE
    GEPLPPAARIDYLFFVHDRHEGNQEAARAYLAWETGLIAQCEEDELQGFRVPADTRDASSEARRTQRA

    >gi|194292740|ref|YP_002008647.1| putative Peroxidase; ANTIOXIDANT OXIDOREDUCTASE [Cupriavidus taiwanensis]
    MAIRLGEQAPDFTADTTEGRISFHEWIGDGWAILFSHPKDFTPVCTTELGYMARLKPEFDKRNTKIIGLSIDPVDDHQRW
    VKDIEETQGCTVNYPMIGDADLKVAKLYDMIHPEASGSGPRTAVDNATIRSVFIIGPDKKVKAMLVYPMSAGRNFDEVLR
    LLDSLQLNAKHTVATPVNWKPGEDVIIPTSVSDEEASKKYPQGFKTLKPYLRTVAQPK

    >gi|194292808|ref|YP_002008715.1| putative oxidoreductase, DSBA-like thioredoxin domain [Cupriavidus taiwanensis]
    MPQPLKIDFVSDIACPWCAIGLSSLQLALQRMGDAVDAEIIVHPFELNPGMRPEGEAIVDYLGRKYGRTPAQVAETQAMI
    RERGAAVGFAFGPRTHVYNTFDAHRLLHWAGLEGKQLPLKQALLRAYHADGKDPSNHDVLVDAAQSVGLDAATARKVLAG
    DDYADAVRAEIGEYQRMGIQSVPSIIFNDRYLVTGGQPVEAFEQAIRDIAAEAQQAQG

    >gi|194292996|ref|YP_002008903.1| Conserved hypothetical protein, transmembrane domains [Cupriavidus taiwanensis]
    MHIDFHQFTPWLSLAGGLVIGLAAALMILALGRIAGISGIVGGLLRLPQGDTAWRIAFVIGLLLSPWLAIAFDAMPAARI
    DAGWTEVLVAGLLVGLGTRYAGG
    CTSGHGVCGLSRGSVRSLAATVTFMAAGFLTVLVQRHVLGG

    >gi|194293003|ref|YP_002008910.1| Methylated-DNA--protein-cysteine methyltransferase [Cupriavidus taiwanensis]
    MTSYRHIDSPLGTVLLRVRDGHLTGLFFAGQKYHPAGIADSRDVPPADAVVLDRAAAELAEYFAGRRDTFTVPVRFAGSP
    FQQRVWQALLEIPCGATASYGELARTLGLPPTHARAVGGAVGRNPLSVIVP
    CHRVLGSAGALTGYAGGIERKRALLRREG
    IAAEKG

    >gi|194290591|ref|YP_002006498.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Cupriavidus taiwanensis]
    MPDLTPVPDAEILMAQPRGFCAGVDRAIEIVERALERFGAPIYVRHEIVHNAYVVADLRRKGAVFVGELDEVPAGATVIF
    SAHGVSREVREDAARRGLHVFDAT
    CPLVTKVHVEVSKLRAQGCEIVMIGHRGHPEVEGTMGQANGGMVLVESVDDVQALQ
    IADPSRLAYVTQTTLSVDETSEIVAALKARFPEIREPKKQDICYATQNRQDAVKFMAPQVEVVIVVGSPNSSNSNRLREL
    AERLGVPAYMVDAPEQVRPEWIAGKRRIGLTAGASAPEALAQSIVERLRELGARQVRPLDGIQENMAFPLPRGLLPTSAA
    A

    >gi|194291269|ref|YP_002007176.1| Cyclohexanone monooxygenase, Flavin-containing monooxygenase (FMO) [Cupriavidus taiwanensis]
    MNAPAELPAALSPQWPPQAPPAPEHTDIAIIGSGFAGLGMAIQLRERGEHDFLVFEKAGSVGGTWRDNHYPGCACDVQSH
    LYSFSFAPNPDWSRMFSTQPEIRAYLEDCTDRFGLRPHLRLHHELRHAAWDESAQLWRLQMADGKVVRARVLVSGMGGLS
    RPSYPDIPGLDTFEGE
    CFHSQHWNHAYALRGKRVAVIGTGASAIQFVPQIAPQVAHLDLYQRTPPWIMPKPDREVSAAER
    WLFRRLPFTQTLVRTGIYWMLESRVLGFVLHPKIMKVVERVARRHLARQVRDPALRATLTPDYTIGCKRVLISNDYYPAL
    TRDNVDVVTAGIARVERDAVVLRDGTRRPADCIILGTGFHATDPLLRGVIAGIGGVDLVDAWRDGAQAYLGTTVSGFPNL
    FFVVGPNTGLGHSSMVFMIESQVAYIADALRQMRRDGVQAVDVREPVQRRFNERLQARLGHAIWSAGGCASWYIDPRSGR
    NTTLWPGFTWQFRRATASFRMTDYDLYPVRRAVPDEATRQPAADIASAAGA