Cupriavidus metallidurans CH34 uid57815

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|94152395|ref|YP_581802.1| alkylhydroperoxidase AhpD [Cupriavidus metallidurans CH34]
    MSQIDIDPALGLLAEFGKLTGNTTRHIKQMRQEAIFKDGALPARVKALSAMLWAISARCEPCFKFYVQQAVKLGATEMEM
    GEVLAVASTMGGCVGEMWALKAFKAYKDFTSGEAVPETEPSCCQ

    >gi|94152393|ref|YP_581800.1| mercury transporter MerT [Cupriavidus metallidurans CH34]
    MAQLTGKGSLIAGVLAALGASVCCVGPLVLLALGVSGTWIGNLTAMEPYRPLFIGLTVVFFGAAFRKLYLMPQVCAAGTP
    CADPRTRSRQRLTFWIVAVLVLGLLAVPWLAPLFY

    >gi|94152349|ref|YP_581756.1| Pb(II) resistance ATPase PbrA [Cupriavidus metallidurans CH34]
    MSECGSKGCGCASVATRNPEPSTVGAGLKQARYRIENMDCPTEEALIRDKLAKLPGVGGLEFNLMQRTLAVSHQMASPGP
    IEEALSAIGMRAVRMDEATPLQNTVLAIHQMD
    CPTEEALIRSKLAGIPGVASLEFNLVQRTLHVWHAADTLSHVLTALKS
    LGFDAEVRSAGAPAAAEAPGPARTNWWPLAVSGVAATLAEVVYWLHGGNHWGVVALALAAIFTGGLTTYKRGWIALRNRN
    LNMNALMSIAVTGAMLIGHWPEAAMVMVLFALAEVIEAKSLDRARNAIRGLMDLAPDTALIQQADGSWAEVDAKAVAVGS
    RIRVKPGERIALDGQVIEGRSTVNQAPITGESLPVEKIEGDPVFAGTINESGSFEFRVTAAANASTLARIIHAVEAAQGS
    RAPTQRFVDQFARLYTPVVFAVALAVAVLPPLVFGGPWLDWIYKALVLLVIACPCALVISTPVSIVSGLAAAARHGILIK
    GGVYLEEGRKLKWLALDKTGTITHGKPALTDFVVWGDANPATSRLLAASLAARSDHPVSLAVARAAEGEGLIPCDVADFA
    ALPGRGVRGSVDDHSYHLGNHRLVEELGVCSPELESRLAALEAEGKTVVMLVGPEGVQALFAVADTVKENSRQAIADLHT
    LGVKTMMLTGDNPHTATAIAGQVGIDRSRGNLLPEDKLREVEQLSTDGKTGMVGDGINDAPALARADIGFAMGAAGTDTA
    IETADVALMDDDLRKLPTFVRLSRATASVLKQNIALALGIKAVFLVLTFTGQATMWMAVFADMGASLLVVGNGLRLLRR

    >gi|94152576|ref|YP_581983.1| putative mercuric reductase [Cupriavidus metallidurans CH34]
    MTHLKITGMTCDSCAAHVKEALEKVPGVQSALVSYPKGTAQLAIVPGTSPDALTAAVAGLGYKATLADAPLADNRVGLLD
    KVRGWMAAAEKHSGNEPPVQVAVIGSGGAAMAAALKAVEQGAQVTLIERGTIGGT
    CVNVGCVPSKIMIRAAHIAHLRRES
    PFDGGIAATVPTIDRSKLLAQQQARVDELRHAKYEGILGGNPAITVVHGEARFKDDQSLTVRLNEGGERVVMFDRCLVAA
    GASPAVPPIPGLKESPYWTSTEALASDTIPERLAVIGSSVVALELAQAFARLGSKVTVLARNTLFFREDPAIGEAVTAAF
    RAEGIEVLEHTQASQVAHMDGEFVLTTTHGELRADKLLVATGRTPNTRSLALDAAGVTVNAQGAIVIDQGMRTSNPNIYA
    AGDCTDQPQFVYVAAAAGTRAAINMTGGDAALDLTAMPAVVFTDPQVATVGYSEAEAHHDGIETDSRTLTLDNVPRALAN
    FDTRGFIKLVIEEGSHRLIGVQAVAPEAGELIQTAALAIRNRMTVQELADQLFPYLTMVEGLKLAAQTFNKDVKQLSC
    CA
    G

    >gi|94152575|ref|YP_581982.1| Hg(II) resistance protein MerP [Cupriavidus metallidurans CH34]
    MKKLFASLALAAVVAPVWAATQTVTLSVPGMTCSACPITVKKAISKVEGVSKVDVTFETRQAVVTFDDAKTSVQKLTKAT
    ADAGYPSSVKQ

    >gi|94152574|ref|YP_581981.1| Hg(II) transport/resistance protein MerT [Cupriavidus metallidurans CH34]
    MSEPKTGRGALFTGGLAAILASACCLGPLVLIALGFSGAWIGNLAVLDPYRPIFIGVALVALFFAWRRIYRQAAACKPGE
    VCAIPQVRATYKLIFWIVAALVLVALGFPYVMPFFY

    >gi|94152571|ref|YP_581978.1| thiol-disulfide isomerase [Cupriavidus metallidurans CH34]
    MKKIAAALAFAAMSIAAHASPETDSVMATLKIKYPNTNFTSVEATPIPGIYELTMGKNIAYTDKEGHYFLFGSMYDMEKR
    QDLTASKREAANKIDVSKLPIQDAIVRVKGKGTRKLYLFSDPD
    CPYCKQLEAQAFPQLDDVTIYTFMFPLDSLHPQASAK
    SESIWCLPAAQRAAAWDKLVTQNVPAPAAKCDNPIKRIAALGDGLGVRGTPTLFSADGRILPGAADAARIDAWLNGAK

    >gi|291434887|ref|YP_003518268.1| mercuric ion transport protein MerT [Cupriavidus metallidurans CH34]
    MSEPKTGRGALFTGGLAAILASACCLGPLVLIALGFSGAWIGNLAVLDPYRPIFIGVALVALFFAWRRIYRQAAACKPGE
    VCAIPQVRATYKLIFWIVAALVLVALGFPYVMPFFY

    >gi|291434888|ref|YP_003518269.1| Hg(II) resistance protein MerP [Cupriavidus metallidurans CH34]
    MKKLFASLALAAVVAPVWAATQTVTLSVPGMTCSACPITVKKAISKVEGVSKVDVTFETRQAVVTFDDAKTSVQKLTKAT
    ADAGYPSSVKQ

    >gi|94152590|ref|YP_581992.1| putative mercuric reductase [Cupriavidus metallidurans CH34]
    MTHLKITGMTCDSCAAHVKEALEKVPGVQSALVSYPKGTAQLAIVPGTSPDALTAAVAGLGYKATLADAPLADNRVGLLD
    KVRGWMAAAEKHSGNEPPVQVAVIGSGGAAMAAALKAVEQGAQVTLIERGTIGGT
    CVNVGCVPSKIMIRAAHIAHLRRES
    PFDGGIAATVPTIDRSKLLAQQQARVDELRHAKYEGILGGNPAITVVHGEARFKDDQSLTVRLNEGGERVVMFDRCLVAT
    GASPAVPPIPGLKESPYWTSTEALASDTIPERLAVIGSSVVALELAQAFARLGSKVTVLARNTLFFREDPAIGEAVTAAF
    RAEGIEVLEHTQASQVAHMDGEFVLTTTHGELRADKLLVATGRTPNTRSLALDAAGVTVNAQGAIAIDQGMRTSNPNIYA
    AGDCTDQPQFVYVAAAAGTRAAINMTGGDAALDLTAMPAVVFTDPQVATVGYSEAEAHHDGIETDSRTLTLDNVPRALAN
    FDTRGFIKLVIEEGSHRLIGVQAVAPEAGELIQTAALAIRNRMTVQELADQLFPYLTMVEGLKLAAQTFNKDVKQLSC
    CA
    G

    >gi|94152607|ref|YP_582009.1| rhodanese-like protein [Cupriavidus metallidurans CH34]
    MPNATSSLELAAALHGLNAPQLIDVRRKPAFDASEQMIAGAAWRNPDELGNWIATLDANRPVTVYCVHGHQVSQDCAALL
    EAVGFDATYLVGGFEDWIAGNHPTIRKPLRIEP

    >gi|94308963|ref|YP_582173.1| glutathione peroxidase [Cupriavidus metallidurans CH34]
    MSRQRTLESVQRTALAGALTLAAAVAVMLPPPAHAAEKAVPAAAQPAGNCPASLNFRFPRLQDESPQNLCQYAGKVVLVV
    NTASY
    CGFTPQYEGLEALYAKYRERGLVVLGFPSNDFSQEPGSSKDIADFCYNTYGVKFPMLGKSHVRGSDANPMYALLA
    QETGTAPKWNFYKYLIDRKGQVIGSYNSMVKPDDKQFVSKIEELLNAR

    >gi|94309043|ref|YP_582253.1| DSBA oxidoreductase [Cupriavidus metallidurans CH34]
    MKKIAALLATVAAVSGLLMTAPAAMAAPTEGKDYTVLKSPQPVPAGKIEVTEFFWYGCPHCYDFEPELEAWVKKQGKDVV
    FKRVPVAFRDDLLPHTKIFYALEAMGKLDAMHTKVFDAIHKQRKRLLTTDEIADFMAQNGIDKKQWLDTYNSFSVTTNSQ
    RANKIADAYKIDGVPTVVVQGKYETSPSIAGTKPGAIQAMDFLVTGVRDKKL

    >gi|94309178|ref|YP_582388.1| thioredoxin-like protein [Cupriavidus metallidurans CH34]
    MSNSATPATPSSKKRWPIAVAVVIVALLGFFGYRAMTPANTVPDATFTLLSGEKLSTGDLKGKVYLINFWATSCATCVKE
    MPQMVSTYKQFKDKGLDFVAVAMNYDPPMYVMNYAKTRELPFKVAMDADGAAAKAFGNVQLTPTTFVVDKNGKILKRYVG
    EPEWDALHKLLDGALANAA

    >gi|94309194|ref|YP_582404.1| UBA/THIF-type NAD/FAD binding fold-containing protein [Cupriavidus metallidurans CH34]
    MNDDQLLRYSRHILLDELGIEGQERLLAGHALVIGAGGLGAAALPYLASAGVGTITIVDDDDVDLTNLQRQILHTTANVG
    RPKVESAREGMLRINPDIDIRMVPMRVGDAELDGLVAQADVVLDCCDNFATRHAVNRACLRHRKPLVSGAALRFDGQVTV
    FDLRNPDAPCYACLFPPSEPAPEAA
    CATMGVFAPLVGMIGTVQAAEALKLLTDVGETLAGRLLMVDAMSMEWTTMRLVRT
    PGCEVCGGDH

    >gi|94309197|ref|YP_582407.1| glutaredoxin GrxC [Cupriavidus metallidurans CH34]
    MARVVMYSTVVCPYCQMAERLLKQRGVEAIEKILIDREPGKREEMMTRTGRRTVPQIYIDETHVGGFDDLSALDRQGGLV
    PLLAA

    >gi|94309216|ref|YP_582426.1| electron transport protein SCO1/SenC [Cupriavidus metallidurans CH34]
    MSTSSQGLWAAFRRFWLLALCTALLAACGQPKPSFRNVDISGATEFGKDFALLDPTGKTRTLADFKGKVVLMFFGYTHCP
    DVCPTTMVELKQVMEQMGPDADKVQVLFVTVDPDRDTAALMAQYVPAFDSRFLGLRPADEAALKKVTKDFKVYYAKVPGS
    SPDNYTMDHSAGSYVFDQNGQLRLFIRHGQGPEPIAHDLKQLMS

    >gi|94309274|ref|YP_582484.1| arsenate reductase [Cupriavidus metallidurans CH34]
    MTVTIYHNPACGTSRNTLAMIRNAGIEPIVVEYLNMPPDRQTLQSMIRAAGLSVREAIREKGTPYAELGLGDPALTDDQL
    LDAMLAHPILINRPFVITELGVRLCRPSEVVLDILPAPQQGAFTKEDGEAVIDTQGRRIR

    >gi|94309353|ref|YP_582563.1| OsmC-like protein [Cupriavidus metallidurans CH34]
    MECKVTWMGPEGMSFVAQTGSGHIVAMDGAPDGGGNNLAPRPMEMVLLGTGGCTAYDVVLILKRGRQDVRGCSVKLEAER
    AETDPKVFTKINFHFTVTGRNLDPGKVERAIELSHEKYCSASIMLAKTAEITHTTEIVEG

    >gi|94309359|ref|YP_582569.1| iron-sulfur cluster insertion protein ErpA [Cupriavidus metallidurans CH34]
    MNAVAEAPATEDVPAPFVFTDSAADKVKQLIEEEGNAELKLRVFVQGGGCSGFQYGFTFDEDVNEDDTTMVKNGVTLLID
    SMSYQYLVGAEIDYKEDINGAQFVIKNPNASTTCGCGSSFSV

    >gi|94309465|ref|YP_582675.1| methylated-DNA--protein-cysteine methyltransferase [Cupriavidus metallidurans CH34]
    MQHHFDAVLPAPFGKVGVRVDGTQVHEIVYLPDSFAEVPPTSALTKRVAEQLDAYYANADTVFDLPLARRGTDFQRKVWA
    AISAVPRGGLTTYGTIAKSLQSMPRAVGQACGQNWFPIVVP
    CHRVVAANGLGGFAHHGEEGFHLGVKRWLLRHEGAMLL

    >gi|94309629|ref|YP_582839.1| thioredoxin reductase [Cupriavidus metallidurans CH34]
    MSAKHAKVLILGSGPAGYTAAVYAARANLNPVLITGLAQGGQLMTTTDVENWPADPNGVQGPDLMQRFLAHAERFNTEII
    FDHIHTAKLTEKPIRLIGDSGEYTCDALIIATGASAQYLGLPSEEAFMGRGVSA
    CATCDGFFYKNQEVAVIGGGNTAVEE
    ALYLSHIASKVTLIHRRDKFRAEPILVDRLMQRVEEGRIDLRYDSTLDEVLGDESGVTGLRIRDTKDAAKTEDLKLAGVF
    VAIGHKPNTDLFEGQLEMKNGYIVTKSGLSGDATATNIPGVFAAGDVQDHVYRQAITSAGTGCMAALDAQRYVEALK

    >gi|94309698|ref|YP_582908.1| rhodanese superfamily protein [Cupriavidus metallidurans CH34]
    MQIVNISAYKFVTLEDIETLRPVMRERCDAAGLKGTILLAPEGINMFLAGTREQIDEFMAWLHADARFADIAPKESLSEN
    QPFKRMLVRAKKEIITMKMPLIRPEAGRAPSVRPVDLKRWLDQGHDDDGRPVVMLDTRNAFEVAVGTFDKAVEYGIDKFS
    EFPPAVAENKAEFEGKTIVSF
    CTGGIRCEKAAIHMQEVGIDHVYQLEGGILKYFEEVGGSHYNGDCFVFDYRTALNPNLE
    PAGPVQCFACRAVVTPEEQQHPKYVVGKSCPHCVDTATQAAA

    >gi|94309703|ref|YP_582913.1| hypothetical protein Rmet_0758 [Cupriavidus metallidurans CH34]
    MTQPISRYPVPAIENLPDDIRQRVLEVQEKAGFVPNVFLALAHRPDECRAFFAYHDALMLKETGSLTKGDREMIVVATSG
    VNQCLY
    CVVAHGAILRIYEKKPLVADQVAVNYLKADITPRQRAMLDFAMKVCTDSHTIGEADFEALRAHGFDDEDAWDIA
    GITAFFGLSNRMANTIGMRPNEQFFLMGRVPKAK

    >gi|94309950|ref|YP_583160.1| putative thioredoxin protein [Cupriavidus metallidurans CH34]
    MSEENQPHLDHRAFEALDMAEVDGENIDAAIANAGDDLVCVFFWGVDCFNCEMAKKAILANPEPIRALDLRWLHANVYAH
    PELGRRFGLHGIPVFMFFHKGKKLGRATGWHGHGQFSAAVGNARLKASGKPLAG

    >gi|94309972|ref|YP_583182.1| iron-sulfur cluster assembly protein IscA [Cupriavidus metallidurans CH34]
    MFDSKAKMISMTEKAAKHVARYLERRGKGVGLRVGVKTTGCSGLAYKLEYVDEVLPEDQVFETHGIKVIVDPKSLPYIDG
    TELDFAREGLNEGFKFNNPNVKDECGCGESFRV

    >gi|94310008|ref|YP_583218.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Cupriavidus metallidurans CH34]
    MSTTPTSAPETTQTDVLIVGAGPVGLFAAFQAGVLGLKCEIVDVLDRAGGQCTELYPEKPIYDIPAVPGCLAQDLVDRLL
    EQCAPFAFPMHFSQRAESVSDTTCTNGHPRLLVTTDAGKRFDVAAVLICAGAGAFAPQRVSLPEAAALEDRHLHYAVRDL
    SRFAGKRVIVAGGGDSALDWAMALRKTAARVTLLHRREGFRAADHTVKAMRDAVAAGEMDFVVGMLGGLQTNGDGALTGA
    VVKSRDGEQTIPADDLVALYGLVSEPGPIAQWDMDMRAGRIAVDTTTYESSRRGIFAAGDIAFYPNKQKLILSGFHEAAL
    ALRKAYHYAFPEKSLVHVHTSNNAALKERLTHG

    >gi|94310114|ref|YP_583324.1| peptide methionine sulfoxide reductase [Cupriavidus metallidurans CH34]
    MDAMTTLQRWTRPTALKLASLAVLMVAAAMWELPAISAEAAVKIPAPAVDEKAGTSHTETAVFAGGCFWGVQGVFQHVRG
    VTRVTSGYSGGSASNAQYEMVGTGMTGHAESVEIRYDPTQISYGKLLQIFFSVAHNPTQLNYQGPDHGTQYRSAIFPRSP
    VQRSIAEAYITQLDTSKAYRAPIVTRVEDYKGFFPAENYHQDFLVKNPSYPYIVINDLPKIGNLKTMFPDVYRNDAVLVS
    KGG

    >gi|94310115|ref|YP_583325.1| cytochrome c biogenesis protein, transmembrane region [Cupriavidus metallidurans CH34]
    MLLLILSYLGGALTILSPCILPVLPFVFARADQPFARSGLPLLAGMGLTFAGVATLAAVGGGWVAQANQYGRWLAIALLA
    VFGLTLLLPRLAERLMRPLVNAGSRLSNFAQADGKPASPASSFLLGIATGLLWAPCAGPILGLVLTGAALQGASLGTTLL
    LLAYAAGAATSLAVALLIGGRVFTAMKRSLDAGEWVRRGIGVAMLAGVAAIALGLDTGILTRVSTVATGGLEQRLVDALG
    HKDRSGGAMMAATSLPAEGGAMMMRAVDRPATLPVEGQFPGLNGAVEWLNSPPLTAEALRGRVVLVDFWTYS
    CINCLRTL
    PYVKAWAEKYRDQGLVVIGVHAPEFAFERNIDNVRKATKDLGVTYPVAIDNNYAIWRAFNNNYWPAHYFIDAQGRVRFHH
    FGEGEYEKSEAVIRQLLAEAGHADVTKVAMTADNAMHGVEMPADASTLRSQETYVGYARAENFASPGGARPDQSKDYAAP
    AHPTLNEWGLAGNWKVGEEQATLEQASGKIVYRFHARDLHLVLGPAADGKPVRFRVTIDGKVPGASHGTDVAADGSGTVT
    GQRLYQLVRQQGDVADRTFAIEFLDPGVQAYAFTFG

    >gi|94310144|ref|YP_583354.1| dihydrolipoamide dehydrogenase [Cupriavidus metallidurans CH34]
    MSVIEVKVPDIGDFDAVEVIEVLVKAGDTVEEEQSLIVLESDKASMEVPSSAAGKVVDVKVKVGDKVAKGTLICTVEGGA
    AAAPAPAPAAAPKPAAAPAPAPAAAPAAATHAGGADIQCEMLVLGAGPGGYSAAFRSADLGMNTVLVERYGTLGGV
    CLNV
    GCIPSKALLHNAAVIDEAKALAAHGILFGEAKIDLDGLRHYKESVVGKLTGGLSGMAKARKVQVVRGIGTFLDPHHLEVQ
    ETEGDSKATNGKKTVIRFEKAIIAAGSQAVKLPFVPEDPRIFDSTGALELRDIPNKMLVIGGGIIGLEMATVYSTLGARL
    DVVEMLDGLMQGADRDLVKVWDKVNKHRFDNVMLKTKTVGVEAKPDGIYVKFEGESAPAEPQRYDAVLVSVGRSPNGKKI
    GAEKAGVAVTDRGFIDVDKQMRTNVPHIYAIGDIVGQPMLAHKAVHEAHVAAEAAHGEKAYFDAKQIPSVAFTDPEVAWA
    GKTEDQCKAEGIKYSKGVFPWAASGRAIANGRDEGFTKLIFDEETHRIIGGGIVGTHAGDLISEVCLAIEMGADAVDIGK
    TIHPHPTLGESIGMAAEIYEGVCTDVPPPRKR

    >gi|94310345|ref|YP_583555.1| disulfide bond formation protein B [Cupriavidus metallidurans CH34]
    MQANSRTYFLLIAIVSFAMVGAALYMQYAENLQPCPLCIMQRFAFIGIGIFSLLAVIAQNTRTLWQGLGMLSGVGGIAVA
    GYQVALLMNPKAS
    CGIDPLENWVNSLPTAKLLPQVFYSDGLCTAPTPPILGLSIPAWSLIWLLILTLTLAVGLIRREKHF
    R

    >gi|94310363|ref|YP_583573.1| hypothetical protein Rmet_1421 [Cupriavidus metallidurans CH34]
    MTTLLYGIPNCDTVKRARTWLESNGVDYTFHDFKKQGVDEKMLRAWLKHVPLTTLLNKKGTTYRALSDADKTRAESEAGA
    IALMQTSPSLIKRPVLDRDGKVSVGFSADGYAALF

    >gi|94310545|ref|YP_583755.1| alkylhydroperoxidase AhpD core [Cupriavidus metallidurans CH34]
    MTTRLHTIAVQDATGQTAELFGALRGAIGKVPNAYATIGSNAPAVLAQALQTNAALKKGNLSARELEAINLSVSEHSGCD
    Y
    CVAAHTLTGKMAGYTGDQMCQLRRGSYPEDAKIDALTRFAVELVSTRGTVPAASLEAIRAAGYSDGQIVEAIQAISAIL
    FTNMINRVNDTTLDFPAVA

    >gi|94310694|ref|YP_583904.1| L-carnitine dehydratase/bile acid-inducible protein F [Cupriavidus metallidurans CH34]
    MKQENMASLPLAGVRVLDLSRVLAGPMCAMALADLGADVIKVEHPARGDDTRDWGVRIGTRNTSYFNSANRNKRSVTLDL
    QSEAGLALARQLAAQCDVVIQNFKVGGAEKLGLGYEQLSEINPRLVY
    CSISGYARFTPEAERPGYDLVVQGESGVMATNG
    EAGQGPLKFGVAAVDMFTGMYSAQAILAALFARQSTGRGRHVQMALYDCGVMITSYYGMEALLKAGDPPKFGNAHPSIVP
    YGVFEAADGPLVITVGNNGQFQRFCREVIDCPEWADDERFATNTARSAHRDVLLVEVRERLQRFTRAELLQRLTAAQIPC
    GEVLGMLDALQSERTTQAGLLHRFEDSEAGAQAVLAPPYALDGQRLPVRMPPPHMGEHTHEVFKELLKLDDSAIADLQSR
    GVI

    >gi|94310802|ref|YP_584012.1| hypothetical protein Rmet_1864 [Cupriavidus metallidurans CH34]
    MCTHTGHSAAPSLSGLIDAEPCHFWLPLMPNEPTDVLPPTSFNVPFGTRPGIAALGERFFTRLSPTPLPSPYLVSVAPAA
    AALLGWNETDLQDAVKDPAFIDSFVGNAVPDWADPLATVYSGHQFGVWAGQLGDGRAIRLAEAQTPGGPWEIQLKGGGLT
    PYSRMADGRAVLRSSIREYLCSEAMYALGVPTTRALSIIGSDAPVRRETIETSAVVTRLAPSFIRFGHFEHFAAREDHAS
    LRQLADFVIDNFYPACRNAANPYQALLRDVSLLTADMVAHWQAVGFCHGVMNTDNMSILGLTIDYGPFGFLDAFDANHIC
    NHSDQQGRYAYSQQPQVAFWNLHCLAQALLPLWRDANAADPEAEKAAAVEAAREALDPFRDRYAEAFFRHYRAKLGLRSE
    QEQDETLMTNLFRVLHENRVDYTSFWRNLSRVSSLDNSHDAAVRDLFLDRAAWDAWAAEYRARLQSEQSDDAARTTAMLA
    TNPKYVLRNHMAETAIRAARDKDFSEVDRLMAVLSKPFDEQPEAESYAKLPPDWASGLEVS
    CSS

    >gi|94310803|ref|YP_584013.1| methionine sulfoxide reductase B [Cupriavidus metallidurans CH34]
    MTTTKTDAEWRSQLSDIEYRVTREAATERPFTGQYWDHWNQGIYHCVGCGTPLFESATKFDAGCGWPSYFRPINGEVIAE
    HTDHSHGMTRVEVRCKECGSHLGHVFEDGPAPTGLRY
    CINSAALKFDDRDPEDRG

    >gi|94310855|ref|YP_584065.1| DSBA oxidoreductase [Cupriavidus metallidurans CH34]
    MTPIDIIITYDFICPWCWIGHQSLKAGIEQAGMAGRFRSQYQPYELNPDMPKPSSNRKAYRSRKFGSWERSQVLDAEVAA
    AGKRVGLAFNYDRILVTPNTRLAHRLMRYVLDQDAARADDLFSAVMEAYFTRGQDIGSLDVLVDIAVSIGFDAAGVREYL
    NGSAGETSVVAQELQAQFDGVRSVPTYRVGNQRITDGQPPQHFARVLQAAAGEVENM

    >gi|94310861|ref|YP_584071.1| OsmC-like protein [Cupriavidus metallidurans CH34]
    MTFGTAQIGSTSRYRTSIMVSGHAITADEPRALGGQGVGPAPYDLLLASLGACTAITLRMYAERKGWHLESLEVSMRLVG
    TDALRIERTLVMKGLEESQRMRMAEIAERTPVTKTLRSGLPIDTRLA

    >gi|94310888|ref|YP_584098.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Cupriavidus metallidurans CH34]
    MKTVGDKLEAFHVVGVKPGFNNHEENGQSAFEDITEKSFEGKWKVIYFYPKDFTFVCPTEIVAFAKLNGDFADRDAIVLG
    GSTDNEFVKLAWRREHKDLNKLNQWQFADVTGSLVDQLGVRDQAAGVALRATFIVDPDNTIQHVSVNNLNVGRNPEEVLR
    ILDGLQTDELCPCNRAVGGATL

    >gi|94310907|ref|YP_584117.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Cupriavidus metallidurans CH34]
    MTVSLNKAIPDFQAPATGGDFRLADQRGKTTVLYFYPKDNTPGCTTEAMNFRDQYDDFEKAGAAVYGISRDSMKSHENFK
    AKLELPFELISDADEAICQLFDVIKMKKMYGKDVRGIERSTFILDAKGVLRHEMRGIKVPNHVDEVLEIVKGM

    >gi|94310984|ref|YP_584194.1| heavy metal translocating P-type ATPase [Cupriavidus metallidurans CH34]
    MPSLHASPLAPDGTSVPSNPSAQLGSAAALASGTRLGSASLSTSTTHCFHCGQPLGRDVTPLVADIGGQRRTFCCGGCQA
    LAQTLYSAGFGHLYSDVTRFARPIDAQARREAEPVWAAYDTPELRNQFVRELGDGRAEITLAPENIR
    CAACAWLIEQHLG
    QLDGVESAVANVATRRVVVRWQENKQGVAGLLSTLADIGYQAWPFEVSRGDQHDRRERRGLLMRMAVAMLGMMQVMMYAW
    PLYTHEATIDPGQLQLMRWASFALTIPVVLYSASPIFAGAWRSLRQRHMGMDVPVAIGVLAGFFASAVATVRGVGEVYFD
    SVTMFVAFLLLARYLELRVRQASRSGAEMLARQLPATCERLVETSGVGERIPVARLNAGDRIRVKAGEIMPADGVVVAGV
    SEIDESMLTGEARPVKRAIGDTVLAGCFNAASPLEVSVRRIGAQTRLAEIVAVLDRALADKPRLAQLADRVAGWFVATLL
    ILAAITGLVWAIWIDPSRALLVTVAVLVVSCPCALSLATPAALAAAGAALSRRGVLLTRAHTLEALSGVTDIMLDKTGTL
    TEGRFALVSTEIAGNLDAPTCQSLAAAMERGGEHPIARALVEAAADHAERLVAELHNTPGQGLQANVDGRLMRLGRREFV
    AELAPAAADIRRSGDRFPGATEVWLGDANGPLACFQLADVERPQTAELLASLTRLGVRCHLVSGDQPAAVRWWADRFGIE
    TAVGAVTPEGKRDYVANLQQQGAVVLAVGDGINDAPVLAQAQVSIAIGSGAPLAQAGADAVLTHGGVGEIANAIAVARKT
    RRVVRQNLGWAFFYNVVAIPLAATGLVTAWMAGIGMSVSSLLVVGNAWRLLRAAAAPARES

    >gi|94310986|ref|YP_584196.1| dihydrolipoamide dehydrogenase [Cupriavidus metallidurans CH34]
    MSKQFDVLVIGAGPGGYIAAIRAAQLGLNVACLEGNAYDDPKGEARLGGTCLNVGCIPSKALLASSEEFENASHHLADHG
    ITVGDVKVDVAKMLKRKDDIVSKMTKGIEFLFRKNKVTLFKGYGKFTGKAAEGFQVEVNGETLTAKQVIIATGSKARHLP
    GVAVDNNLISDNEGALKFGTVPKKLGVIGAGVIGLELGSVWRRLGAEVTVLEALPAFLGAADEGVAKEAQKLLTKQGLQF
    HLSVKVDEVKTGKDNVTVNYTDKDGKAQTLEVDRLIVSVGRVPNTDNLGLDAVGLGVDQRGFIEVDDHCQTKVPGIWAIG
    DVVRGPMLAHKAEDEGVAVAERIVGQKPHIDFNTVPWVIYTFPEIAWVGKTEQQLKAEGREYKSGQFPFMANGRALGMGA
    SDGFVKMLADARTDEILGVHIVAANASDLIAEAVVAMEFKAASEDIGRVCHPHPSMSEVMREAALAVDKRQLNM

    >gi|94311072|ref|YP_584282.1| thioredoxin [Cupriavidus metallidurans CH34]
    MSEQIKYVSDASFDADVLKSDKPVLLDFWAEWCGPCKMIAPILDEVAKDYGDKVQVAKINVDENQQVPAKFGIRGIPTLI
    LFKNGQVAAQKVGALSKSQLTAFLDSQL

    >gi|94311153|ref|YP_584363.1| rhodanese-like protein [Cupriavidus metallidurans CH34]
    MTEVQSFPTTTSLAVRQALLDRTEIALIDVREEDPYAQQHPLWAANFPLSKLELEAWARIPRRDTRIVVYGEHDGEDLAP
    GAAARLRELGYTDVSLLDGGLTAWIAAGGEVFRDVNVPSKSFGELVEAKRHTPSLGAPEVQALIDGKADVVIVDARRFDE
    YQTMSIPTATSLPGAELVLRIRELAPNPATQVIVN
    CAGRTRSIIGTQSLVNAGIPNPVAALRNGTIGWKLAGQELDHGAS
    RVAPVQVDAANHGKAREGAGAIAARAGVRRIGLGELASLHVPDRTVYQFDVRTPEEYAASHLPGFRSAPGGQLVQETDHQ
    APVRGARIVLADDDGVRANMSASWLAQMGWEVYVVDPVGEDKRSERGLAAANVPPSPEVVTVSPVALAAWLKEGDVAVID
    VTASANYVKRHIPGAWFAIRAQLAQAIKAIRPAKRYVLT
    CGSSLLARFAAVDLRALTSAEVFVLEGGTAAWVEAGLPVEQ
    GETRLAVPRTDRYRRPYEGTDNAAAAMQAYLDWEFGLIAQLDRDRTHFFEVV

    >gi|94311241|ref|YP_584451.1| heavy metal translocating P-type ATPase [Cupriavidus metallidurans CH34]
    MMASGENLVNEERSMNKEPSSPCACSGGNGQQTACASEQASTETTVFHVSNMDCRNEEALVRRTLEGMPGVERLLFDLPQ
    RLLTISHREVSADALEQALNSVGMKAQAVRDAAVSTTYRIENMDCPSEEKLIRSHLGAVEGIQDLDFDLAERTLSVKHLA
    QARAQMEQVLASIGMRAKEQTFGHTGPIEAAAVIPSSALQQQPTAAVSAPPIGERVTYRIENMD
    CPTEEALIRDRLGKLP
    GVTALDFNLMQRVLGVQHTLATSAPIEKALASIGMQAARQDMQTATTVLRIAKMD
    CPTEESLIRGKLQGMPGVQGMDFNL
    MQRTLTVRHTPDAIKPAVEAIESLGMEAEVQRTDEPRDAPVAAHKTNWWPMAVSGVAAVAAEGVYWVNDGNHWAVIVLAL
    VSIFTGGLSTYKKGWIALKNLNLNMNALMAIAVTGGMAIGHWPEAAMVMFLFALAEVIEAKSLDRARNAIRGLMDLAPET
    ATVRQADGSWTELPAKEVAKGAVVRVRPGERIALDGLITSGRSAINQAPITGESLPVEKAEGDQVFAGTINETGSFEYKV
    TAGASDSTLARIIHAVESAQGSRAPTQRFVDQFARVYTPAVFAVSVLVAVVPPLAFGGAWFDWVYKALVLLVIACPCALV
    ISTPVTIVSGLAAAARRGILIKGGVYLEGGRKLKALALDKTGTLTHGKPEQTDFVPLIGEAQEVAAWAASLAARSDHPVS
    QAIARKANRDGIALHEVDDFAALPGRGVRGRVAGRMLHMGNHRLAQELGLSEATLQARLETLERQGKTAILLMDDATVLG
    IFAVADTVKETSREAVADLQALGVRTLMLTGDNQHTAAAIAAQVGISEARGDQLPEDKLKTIESLVGGEGQVGMVGDGIN
    DSPALARADIGFAMGAAGTDTAIETADVALMDDDLRKIPAFIRLSRSTAAILTQNIVLALGIKAVFLALTFTGHATMWMA
    VFADMGASLLVVVNGLRLLKFKAA

    >gi|94311251|ref|YP_584461.1| putative mercuric transport protein [Cupriavidus metallidurans CH34]
    MSEPKNGCGALATGGVAAVLASACCLGPLVLVALGFSGAWIGNLTVLEPYRPIFIGAALIALFFAWRSIFRPAHACKPGD
    VCAVPQVRTAYKVIFWIVAALVLVALAFPYVLPLFY

    >gi|94311252|ref|YP_584462.1| mercuric transport protein periplasmic protein [Cupriavidus metallidurans CH34]
    MKKLTTLTTLIALAAALSAPAWAATKTVTLSVPGMTCAACPITVKTALSKVAGVEKAEVSFEKREAVVTFDEAKTNADAL
    TKATANAGYPSSVKQ

    >gi|94311303|ref|YP_584513.1| hypothetical protein Rmet_2367 [Cupriavidus metallidurans CH34]
    MHPPTRIPTVAVYHKDLAMQTTDFVATIFDGRSNPNKVTVTFIMALNALLKGHTATIILMVEAVELGQPGAAAGLDIGKP
    FEPVADLLEKFLEKGGRIAI
    CGSCMIHNGMTAAQMDPRFSVINAPDVVELLMGARGSLQVT

    >gi|94311304|ref|YP_584514.1| alkylhydroperoxidase AhpD core [Cupriavidus metallidurans CH34]
    MTTSYRQLTQDVVAHLAPLHKGVPQVMKSFGEMGKAAIADGALDAKTKELIALAIGVAARCDGCIGFHAKALVKLGATAA
    EVHEALGVAIYMGGGPSAMYASNAVAAFNEFAALSSIPGAPASAP

    >gi|94311307|ref|YP_584517.1| rhodanese-like protein [Cupriavidus metallidurans CH34]
    MSLKSISPQAASELMNQGAVLVDIRAADEHARERIAQARHVPMDRLRSGGLPLDGASAIIFHCRSGNRTRVNAPTLGACT
    ACEAYVLEGGLDAWKKAGLPVVADASQPLELQRQVQIVAGSLIVLGAVLGATISPWFHVLSGFVGAGLVFAGVSGFCGLA
    RVLMRMPWNRRALAG

    >gi|94311315|ref|YP_584525.1| heavy metal translocating P-type ATPase [Cupriavidus metallidurans CH34]
    MPRADRSSGGDFDYEQARVAGRMVFFVDGLWCVSCAMALQRVLQRVPGVVSATVNFTSGSALVTWVPESIDFPLLLRKAE
    GLGYALSPLKGSDELEAALQRQARKIRLQLTVAVVFGMWSMLGSWVLYLNADEAAALVIAWASVVASLPVVGYSAWDFYR
    AAARSLRAGIAGMDVFASVAVLGSLFVSVGSLAMGSVAIYTDAATMLITFLLIGRLIEIHARQESGLAVQALRSLAPETA
    TKLTSAGGEKAESTVLLAELAPGDTVLIRANERIAVDGIVVAGQSAVDLSLLQGESAPRSVQPGERVFAGSVNLRGPLTV
    HVTAGAGDRRLDVLGLRMLELFGARSSLSETAERFVRILLPVVVTASLLAFVHYLWNGSSADQALLGALSLLVAACPCAV
    GLAMPLAYAFTCREAARRGVLLRDSASVEALARARIMAFDKTGTLTCGQMRIVSIQTRHGGAEQDLIDLAARAEAGVAHP
    IAHAVVLAARQSGMSSACEPDGCQVTACAKGVTMHVPGGETVWVGERHWLLAAGVEGMPPEDGLPGLVHVANGRDWLGSL
    RLQDAPRDDARSSLQRLRAQGLKLWLLTGDSSAASERLTADLGIDFDRVEADCSPEEKADIVAKSPAPVAFVGDGANDGL
    VLAQAACGIAIPGSSSVAVSAAGVVIAHGSVGAVVETRELARKFDRIVRQNLAFSVVYNLAVIVVLFEAGVTPFAAALAM
    LASSASVLLNTCRLLQGRVVCDKSMQAKPAAS

    >gi|94311327|ref|YP_584537.1| periplasmic protein thiol [Cupriavidus metallidurans CH34]
    MNRFLWPLLGFLVLVSFLAVGLTLKPSEVPSPLINKPAPRFSLPQLQAPDLTFSSESMIGKVWVLNVWASWCAPCLEEHP
    VITELASRHAVSVVGMNYKDTPQNAIAWLRRNGNAFETTVSDAHGAVGIDFGVYGVPETYVIDKAGIIRYKHTGAIDAGE
    MRGELLPLVRELEK

    >gi|94311330|ref|YP_584540.1| cytochrome c biogenesis protein, transmembrane region [Cupriavidus metallidurans CH34]
    MAFYRRIVAIFLLCGCAVGSAWADGLFPSWGRSERQFLDVAEVLKLDAVQQQGDSFSAAGHVADGYYVYRHAIKLVDAQG
    HEVSLTLPAGTAKHDEFFGDTEIYTGDALNLRFPATAPGPLTLHWQGCAEAGICYPPQTMNVALPAVVAGTSPTGNDSVQ
    RSSALTSTNTVSLGGATEVAEDQAAAQRLAALGPVWGTLLFFGFGLLLAFTPCSLPMIPIVSTMVVGSQAKPRRAFFLSL
    SYVLAMAGTYAAVGVAAGLAGANLQATLQSPWLLGAFAALFLVLASSLFGLFELQMPSALINRVESAGRDRSGGSISGAA
    ALGFLSALLVGPCMTAPLAGALLYIGQTGSAVYGGMALFALGLGMGLPLLAIAVFGARVLPRPGAWMDRVRVAFGYVMVG
    MAVMMLTRFLPGTVSLVLWGAWVLSVAIGLIAWGQAVAAKHRLAWSLRSGAVFAGLWSILMLVGAASGGESALQPLAHLR
    GGSTSPAPAAGGVAYLQAKSVEDVDAHLAQAASRGQWTLIDFYADW
    CVSCHVIERNVFGDPAVASRLARMQVVRPDVTRN
    DATDQALLKHWGVMGPPTLILVGPDGTERRDLRVVGEIDARAFLVRLDKAGS

    >gi|94311331|ref|YP_584541.1| thioredoxin-like protein [Cupriavidus metallidurans CH34]
    MISVGPFSVQVVAVFLAVLLAWAVARMVAKRLPDSPYKAAGGMLLDAAFVGFVAARLGYIAQWWEEYAQSPMSMISIGDQ
    GFSWWVGVLAALALIWWRTRAVRALRRPVLAGVAVGLAAWFATGGVLALLQRSAPPLPALTLATLDEQPVVLNSYAGRPV
    VLNLWASW
    CPPCRREMPVFEQAQAQYPDIAFVMVNQGESAQQARAFLESERLHLKDVLLDPASQTMQAVASRGLPTTLFF
    DEQGRLVDTHLGELTMASLKHTVSRRFAPAQQIKTDKE

    >gi|94311332|ref|YP_584542.1| disulfide isomerase/thiol-disulfide oxidase [Cupriavidus metallidurans CH34]
    MFAQRSHISFLLAASFMVVTGCSKAETADKPAVLKALEGQGLTVTQEFKVGGGLRAFAAVAGDRPIAVYITSDGNAIVGT
    RLNAKGEPMDEADLEKLAAKPVSDKEWSQLQSSTWVLDGKADAPRVIYTFSDAN
    CPYCNAFWEAARPWVDSGKVQLRHIL
    VGIIKDDSPAKAAAILGAPDRSAALLTNERQFGQGGITPAKSVPADVRKILDDNLALMASTGFRGTPGIVVRGPNGILKK
    YNGMPRGAQLGEVLGPR

    >gi|94311334|ref|YP_584544.1| dihydrolipoamide dehydrogenase [Cupriavidus metallidurans CH34]
    MQTRKVDVAIIGAGTAGSTAFHALKATGKQVVLIDRGPLGTTCARVGCMPSKAALHAGMHWKVAKALAASATPSTQGPQA
    LWSHARQTRDALAGAAAERTRKAAGESLIMAEARFVAPGILQAGEQRIEASAFIVATGSRPVVPKALDGVASRILTTDTL
    FDLGVLPARMGILGLGAIGLELGLALSRLDVQVVAADQKDAIGGIQDPDVLERAIARFETELPMWLGAAVEVSLEGDQVR
    MRAGERDALVDRLLVVTGRQPNTEALDLAAAGISLDQAGRPSIDPATMQACGPSQVPIFFAGDVQPDRPLMHEAADEGQM
    AAQAALASLRGESWPGASRRVPITILFTDPDACAVGMTYEAAVQEGAVVGTAEGSGNGRSKILGAPENLLHIYADPGSGA
    LLGASMLLTQGEHLAHLIAWAIQAKQTVNDLLAMPYYHPSIEEMLQSALKSASQQMRP

    >gi|94311388|ref|YP_584598.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Cupriavidus metallidurans CH34]
    MDLSIPNPVADATHQAGGNPGGQPLEIDALIVGAGPVGLFQVFELGLLEIKAHIIDSLKVVGGQCVELYPDKPIYDIPAV
    PICTGQELTDNLLKQIEPFSPTFHLGQEVSVVERREDGRFFVETSLGTRFITKTIFIAAGVGSFQPRTLKVEGIDKFEGK
    QLFYRVKDPSRFHGRNLVVVGGGDSALDWTLDLVGKAESVVMIHRRDGFRAAPASVAKMRELCEQMEMQFMVGQIGGYEE
    KDGVLTEIKVTGADGVTRRMPVDDILVFFGLSPKLGPIAEWGLDLERKQIKVDTEKFETNIPGIFAVGDINTYPGKKKLI
    LSGFHEAALAAFGAAPYIFPDKKIHMQYTTTSPKLHKVLGVETPVFD

    >gi|94311556|ref|YP_584766.1| rhodanese-like protein [Cupriavidus metallidurans CH34]
    MPTPLITATELDQLRAAGKPRVVVFDCSFDLTNPAAGRDSYQQGHIPGAYYLHLDNELSGPKTGLSGRHPLPDAELFAAR
    LRVLGVDDDTLVVAYDGQGSMYAARLWWMLRWIGHAAALVLDGGRNAWVAAGLPLEHGATAEPEIGGNLMRRASLVKTVD
    ADALVANLSQPSLLVVDARAADRFRGENETLDPVGGHIPGAANRFFKDNLTADGYFKPADQLRADFGQVFTGKAPAQTVM
    Q
    CGSGVTACHNLLALEVAGLTGAALYPGSWSEWCADPKRPVATGS

    >gi|94311572|ref|YP_584782.1| thioredoxin [Cupriavidus metallidurans CH34]
    MSDVTLQNFEADVIEMSRQVPVLVDFWAPWCGPCRTLGPMLEKLEAESGGKWRLAKVNVDENQELAAHFGVRSIPHVVAF
    ADGQAVDQFIGVLPESQLREFLDRLTPNPGELALREAVELAAAGDREAAQASFQAALAYDPGADTARLTYIGFLLDGNKI
    ADAETEFGLLSPRAAQEDAYAALQTRLEAMKGVGDLPDGADLKARVAANPADLPARLDLAHVLIARREYEAALEQLLEIV
    RSDRWFEDDVGRKTMLSVFELMGDDPAVSRWRRQLATVLN

    >gi|94311581|ref|YP_584791.1| methionine sulfoxide reductase A [Cupriavidus metallidurans CH34]
    MDHGLEIATLGGGCFWCLEAVYQQVAGVRAVESGYTGGHVSQPTYHEVCAGDTGHAEVVRVTFDPSAINYREILEIFFSI
    HDPTQLNRQGNDVGTQYRSSIFTHSEAQRAVAEYVIGKLAAEHVYDAPIVTQVEPEQPYWPAEASHQNYYQEHPAQGYCA
    FVISPKLTKFRRDFSHRMRR

    >gi|94311588|ref|YP_584798.1| 1-Cys peroxiredoxin [Cupriavidus metallidurans CH34]
    MALRLGDIAPDFEQESSEGRIRFHDWLGDGWGVLFSHPADYTPVCTTELGLTARLKEEFAKRNVKAIALSVDSVESHHGW
    IQDINDTQSTTVNFPILADGDRKVSELYDMIHPNANETLTVRSLFVIDPKKKVRLIITYPASTGRNFNEILRVIDSLQLT
    DNHSVATPGNWQDGDDVVIVPSLKDEEVIRQKFPKGYKAVRPYLRLTPQPNK

    >gi|94311603|ref|YP_584813.1| hypothetical protein Rmet_2671 [Cupriavidus metallidurans CH34]
    MPDIDIPALMRTVLLSTFVLTFLFGAILQRTHFCTMGAVSDIVNIGDWSRMRMWIMAIGVAMIGTGVLAWAGLIDPTKTI
    YTSARLGWLSTAVGGLMFGFGMVLASG
    CGSKTLVRIGAGNLKSLVVFVFLGLSAYMTLRGLFGVVRVSTVDTVAVTLPAT
    QDLPSLIAHGTGLARGTLQLALGVVIGAVLVIWALLGNGFRTFDNLLGGLAVGLIIVGMWYVSGHIGYVSEDPNTLEELF
    VASNSGRMESLSFVAPYAYTLDWLMMFSDKSKVLTIGIVSVFGVIAGAAAYALVSRTFRWEGFGNAEDVANHMVGGILMG
    AGGVTALGCTVGQGLSGVSTLAVGSFIAFAAIIVGAVLAFKYQIWRLERMA

    >gi|94311642|ref|YP_584852.1| rhodanese-like protein [Cupriavidus metallidurans CH34]
    MQVITAPELAQWLADAGRAKPVLLDVREDIEIRTAAMPDITHIPMGQIPGRLNELDEDAEIVCICHHGARSMQVANFLER
    QGYAKVYNLTGGIHAWSTQVDPSVPQY

    >gi|94311866|ref|YP_585076.1| glutathione peroxidase [Cupriavidus metallidurans CH34]
    MSNVYQFEANSLSGQPQPLADYRGKVLLIVNTASECGFTPQYAGLQTLQASYQARGFDVLGFPCNQFGKQEPGDAEQIGA
    FCESRFHVTFPMFEKIDVNGADAHPLYKWLTSEKRGFLGTQAIKWNFTKFLLRRDGTVFKRYASTTKPEEIRADIESLLA
    EQPA

    >gi|94311993|ref|YP_585203.1| thioredoxin-like protein [Cupriavidus metallidurans CH34]
    MTASAPTRRSPFVLWIIIAIVAAAAGALVAHFALAPKAVSDQAVETLFHTKMPDPAGAEVDLSKFRGKTLVVNFWAPWCG
    P
    CVEEMPELTALHGEYAPRNVEFVGIGIDSASNIQDFLKKVPVAYPLTVAGFAGTELSRTFGNTQGGLPFTVVITPDGTV
    KYRKMGRVHADELRAVLPGA

    >gi|94311997|ref|YP_585207.1| ribosomal protein L11 methyltransferase [Cupriavidus metallidurans CH34]
    MAFQECVIEIAQEQAEAWSDALFDLGALSVSVEDADADTPDEQPLFGEPGLEPTRLAWNRSRVVALFDEETDPALVVTAA
    ANALKVDPVPPYALRGVEDQDWVRLTQSQFEPIRIGEKIWVVPSWHDAPDPDAVILELDPGLAFGTGSHPTTRLCMQWLE
    ANVRAGETVLDYGCGSGILAIVAKKLGAGDTVGIDIDPNAVDASRYNAERNRVEASFALPESVSEATYDLVVANILSNPL
    KLMAAMLSARVRPGGRLILSGVLERQAEEVAAAYAPWIPMSVWRSEEGWV
    CLHGTRPAAPADRS

    >gi|94311999|ref|YP_585209.1| thiol peroxidase [Cupriavidus metallidurans CH34]
    MSNVTLGGNAIEVGGKFPHSGDKAPAFSLVGKDLKDVSLADFAGKRKVLNIVPSLDTPVCQASARKFNEAAGNLNNTVVL
    TISADLPFAMGRFCTTEGLANVVTLSTMRGAEFKNAYGVDIKTGPLAGVCARAVVVVDENDTVKYSELVSEIKQEPNYDA
    ALAALK

    >gi|94312053|ref|YP_585263.1| peptidase S8/S53 subtilisin kexin sedolisin [Cupriavidus metallidurans CH34]
    MIAIGQRVPDATLYEFFETESEGCVLGPNAFSVAELVKGRKIVVFGLPGAFTPTCSAKHVPSYLKEYDALRAAGVDEIWC
    HSVNDAFVMGAWGREQKATGKVRMMGDGAAQWARALGLDQDLSQRGLGVRAKRYAMVVDDGVVTHLFIEEPGEFKVSSAE
    WVLQALRA

    >gi|94312121|ref|YP_585331.1| putative thiol:disulfide interchange protein [Cupriavidus metallidurans CH34]
    MFQMFRRRSARFAAIAALASGVGAAGYALHALAADEPGTDRIKASIQKILGGRAEVKSVTKAPVPGLYEVNVSGQLVYTD
    ATGRYIINGELIDTKTNTNLTEERLAELNKIKWSDLPLSRAIKWTKGDGSRTVAVFSDPN
    CGYCKKIEQTFQQMDNITVY
    TFLYPVLSPDSTVKAKQVWCSADRTKVWRDWMLNHVALTGNGSCKTPVDENLELGHNLNITGTPAVFFSDGTRIPGAADA
    ATLERKLASLKK

    >gi|94312135|ref|YP_585345.1| glutaredoxin-like protein [Cupriavidus metallidurans CH34]
    MPAWRRAQPERISIMSDVQQKIDQIVKGSPVVLFMKGTAQFPMCGFSGRAIQILKACGVDAPTTVNVLEDEGIRQGIKEY
    ANWPTIPQLYVNGEFIGGSDIMMEMYQNGELQSLLKA

    >gi|94312158|ref|YP_585368.1| glutathione S-transferase-like protein [Cupriavidus metallidurans CH34]
    MMVLYSGTTCPFSQRCRLVLFEKGMDFEIRDVDLFNKPEDISVMNPYGQVPILVERDLILYESNIINEYIDERFPHPQLM
    PADPVQRARARLFLFNFEKELFTHVYVLENEKGKAAEKNHERARAAIRDRLTQLAPIFVKNKYMLGEEFSMLDVAIAPLL
    WRLDHYGIELSKNAAPLLKYAERIFSRPAYIEALTPSEKVMRR

    >gi|94312219|ref|YP_585429.1| cytochrome c biogenesis protein, transmembrane region [Cupriavidus metallidurans CH34]
    MRHIAALWLTVFACLFFWNVAHAATEDDFLPPEQAFRFAARQVDQKTVEVRFDVADGYYLYRERFSFAAQPADVKLGKPE
    MPAGKVHFDETFGKDMETYRGAVVIKVPVEQAPADGRWSLVVTSQGCADKGLCYPPMESVYKVGGSALGNLFGDRGAAAQ
    STPEAQAPAAVQPAPDRAAPTRPSKVVDDTDRIANALASRNLALIGALFFGLGILLTFTPCVLPMVPILSSIVVGEHVTR
    GRAFLVSLSYVLGMAVVYTTVGVAAGLAGEGLAAALQTPWVLGAFAALMVALAMSMFGMYELQMPQRWQARLTESSNRRQ
    SGQFVGAALMGAISALIVGPCVTAPLAGALAYIAQTGDAITGGAALMAMALGMGVPLMLVGMGAGNLLPRAGKWMEATKR
    FFGFLLLGVAIWMVTPVLPAWVVMLAWAALLLVAAVYLGAFDALGPDPRGVMRLGKGLGLLAALVGAIQIVGVASGGRNP
    LQPLSHLSLSAATLPPHAAEIRFERVRNIAELDARIAQASAAGRPVLLDFYADW
    CVSCKEMEKLTFPDAKVRAQLADVVL
    LQADVTANNADDRALLKRFGLFGPPGIILFGKDGQERPVRVIGYQSASRFLESLERALGPRSQT

    >gi|94312349|ref|YP_585559.1| thioredoxin-like protein [Cupriavidus metallidurans CH34]
    MRARRGVVAWMLALVAAFGAAAQLAQAAEVGDVIHLPDVKLLDGRTVPASQWAGKPLVVEIWASWCPFCALQNPRLQALY
    DKTRGTPLQVLTISIDKHPHEAVAYLKQRGYTFPATMDSDALRHAFGKRKGLPELYVLDGQGRVVQKEVGEMLDDDVAAL
    ARYGKR

    >gi|94312357|ref|YP_585567.1| sulfide dehydrogenase (flavocytochrome), flavoprotein subunit [Cupriavidus metallidurans CH34]
    MQRRSVLQAALAGVAATTLGMLTPRQARAATAAKVVVVGGGFGGATAARYLRTWSHGAVDVTLIEPDEAFVSCPLSNLVV
    AGYRQMADITLPYDTLVSRHGVKHVRDTVTAIDPAARTVRVAGGGTLPYDRLILSPGVEMQSSAIPGLARPGGDQIVHAW
    KAGPQTDVLRRQLAAMPDGGTFAITIPLAPYRCPPGPYERACLVADYLKQHKPRSKVLVLDANPDITSKGALFRKVWETR
    YKGMIEYRPQFETVDVDPATRTIRFDVQDDERADVINLLPPQRAGAIAVASGLATANGRWCEVDFLTMASTVAPDIHVLG
    DAVQIAPLMPKSGTMANQHGKVAAAAILRLLAGQDPDPEPVYTNTCYSFTSSNEAIHVASVHRYDAGEKTMLTVPGSGGL
    SVAPSRREGEYGLAWAHSIWADMLGA

    >gi|94312367|ref|YP_585577.1| arsenate reductase [Cupriavidus metallidurans CH34]
    MITIYHNPRCSKSRETLALVESAAQRLGEPVEIVEYLKTPPSLATLRQLHTMLGVPVRAMIRDGESAYKELDLADPGLTD
    AELLAAVADNPILLQRPVVVRNRRAAIGRPPENVAQLLG

    >gi|94312371|ref|YP_585581.1| alkylhydroperoxidase AhpD core [Cupriavidus metallidurans CH34]
    MDFQTFTKSASDVYAALSGVSKAVEAAGMDKALTELLKLRVSQINGCAFCLQFHLNIARKLDIDPRKFDLLAGWRDAGIY
    TAREAAALGWAEALTSMNDPAARDVAFATARTVFSEQELMLLAAAIASINAWNRIAVGLHFAPPPASPGGRP

    >gi|94312455|ref|YP_585665.1| heavy metal translocating P-type ATPase [Cupriavidus metallidurans CH34]
    MTHPAASLQPSEWRLPVEGMTCASCVRRVETALAKVPGVHDVAVNLATEQATLQADSPEVLNAAAKAVADAGYDVPRAEI
    ELNIADMT
    CASCVGRVERALRAVPGVVDAQVNLATERATVTVLRGAADVATLAAAVERAGYGATPVVEAAAAAVGTAEAG
    PGFWAGPWPVVISAALSLPLVMPMVFEWFGIHAMLPGWVQWALATPVQFVFGWRFYKAGWKAVRAGAGNMDLLVALGTSA
    AYFLSIWQMAEAGDAMPHLYFESAAVVITLVRLGKWLETRAKRQTADAIRALAALRPDTAQVRRNGVEQTVPLASVRVGD
    EIVVRPGERIPVDADVVEGSSHADESMLTGESVPVPKQPGDRLTGGSINYDGLLVARTAAVGAETVLAKIIRMVEHAQAA
    KAPIQRMVDQVSAVFVPIVLVIALATLLGWGLVVGDWTTALLNAVAVLVIACPCALGLATPTAIMAGTGAGARAGILIKD
    AEALEVAHRVSVVAFDKTGTLTVGKPEVVALHAADGDEPALLAKLAALQAGSEHPLARAVTTLATERGITVPAVTDVRAL
    PGRGIAGIVAWQALQLGSDGLRASLQADAGALQTEAERLRGEGRTVSWLIDTDQRRVLGLVAFGDALKPGAAAAIARLRE
    AGIRTVMLTGDNAGAAARVGKQLGLDEVQAEVMPEDKAARVVALKRGGEAVVAMVGDGINDAPALAAADVGIAMSTGTDV
    AMHAAGITLMRGDPALVADALAVSHRTVRKIRQNLFWAFIYNVIGIPLAAAGLLNPVVAGAAMAFSSVSVVSNALLLRRW
    HPLAGSGHKEVTQ

    >gi|94312485|ref|YP_585695.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Cupriavidus metallidurans CH34]
    MTKRQASTATTTKTTAKARRRASEVSAEPVVERVPRRKRSVRPTTREADFVVIGAGSGGVAAARRAASHGARVILVERDA
    IGGT
    CVNRGCVPKKMLSYGANWASILSTCLSHTGGKEDWRDASVRVNAEVARLNASYAQRLNEAGVEILHGDARLSGADE
    VVVGNEIIRTRKTLIATGAHPLALPVPGGELASSSDDVFTWQTVPASIAVIGGGYIAVEMASILSRYGVKVDLLVRGDRL
    LPKFDHDIAAALAEALAAKGVRLHFRADVTMLSQANGATEVCYTQQNNPGRTQTVRAQAVLAAIGRRPSIAELGLDALGV
    QLGERGGICVDRQFRTTVRSIHAIGDCMDRNLHLTPVAIAQGRWLADRLFGKRGDIADFDFVPTAVFSEPAIGAVGLTEA
    QAIEAAGGRADRVRTEIKRFVSLENRFGGVAQPSVFKLVFNARSGRVLGAHLMDNAAPEIIQTFAVALRLGVKDAHLKTT
    MPLHPTVAEELFG

    >gi|94312499|ref|YP_585709.1| hypothetical protein Rmet_3568 [Cupriavidus metallidurans CH34]
    MTVYFPERDLAAIRQALAARPGGRLVACLCADWCGTCKEYVSGFAALAARYPDDCFVWVDIETHADRLGEDIDIENFPTV
    LIQPIAGGAPHFYGTVLPHLEVLDRMLVRGSAMPATASEIPQVLDWLLG

    >gi|94314832|ref|YP_588041.1| methylated-DNA-(protein)-cysteine S-methyltransferase [Cupriavidus metallidurans CH34]
    MSSHHIIDSPLGDMLLRADGGALTGVFFAGQKYYPGLARPTPVSAMPAADARVLEQAAMELGAYFDGALHGFSVPFRLVG
    SAFQQRIWQALCDIEFGETSTYGQLGAGLGLPPSHSRAVGGAVGRNPLSIIVP
    CHRVLGASGDLTGYAGGVDRKRALLTL
    EGVLYPGQLQATALGQAALALD

    >gi|94314857|ref|YP_588066.1| hypothetical protein Rmet_5938 [Cupriavidus metallidurans CH34]
    MGDLQSLLDGHGLMLVFLNVLAEQAGLPIPAYPMLFVAGALSMQPNGPSIGTVLFAVIAACLIADTAWYFAGKRLGQPML
    RTICRVSISPDTCIRQTQSLYLRVGPRSLIFAKLLPGAGALSTSMAGMTATPFLTFIFYDALGALVWAGAALVAGMVFSD
    FVDTILAAFSAFGHIALMVVLGAFALFIAWRFWMRWRLLRRSGLIPRMTVMEFEQRRAAGDKPVVVIDVRAHGAAPIERI
    PGSIVMEIKGPFDTLSGHDASSDFVVY
    CACPHEMSAAVLAERLRTAGYPNTWALAGGFDEWKRLQGTSGLPTATPDAPQQ
    IIAH

    >gi|94312548|ref|YP_585757.1| osmotically inducible protein [Cupriavidus metallidurans CH34]
    MTIEATWLANSGASLCDLSNGTAHWKADLDAPAGDATLPNPHDLLDSALAACTTLTLQIYAKRRNYDLQEVRVTVSHEEA
    PGTYKLVRRLELQGNLDEKAREDLLRVANK
    CPVHKVLSSQISIDTTLAG

    >gi|94312550|ref|YP_585759.1| organic hydroperoxide resistance protein OhrB [Cupriavidus metallidurans CH34]
    MKLEKVLYTAHASATGGRDGRAESSDGQLNVKLAVPKEMGGSGNGMNPEQLFAAGYSACFLGAIRFVAGQQKIAISPDAK
    IEGAVGIGQIPQGFGIQAELKISLPGLDKEAAQKLVEAAHQV
    CPYSNATRGNIDVTLIVV

    >gi|94312695|ref|YP_585904.1| bifunctional DNA-binding transcriptional dual regulator/O6-methylguanine-DNA methyltransferase [Cupriavidus metallidurans CH34]
    MKTTIAYETEDDRWTAVQARDAGADGHFVYAVRTTGVYCQPSSSARLPKRENVEFFDSAEIAEAAGYRCSRRAHGDQTSA
    AAERAALVARACRMIEASETPPQLDDLATAIGMSPFHFHRLFKAETGLTPKAYSSAYRARKLREELSSPEASITNAIYDS
    GFNSNSRFYEASDQLLGMRARDYRSGGVGAVIRFAVGQCSLGAILVAQSQRGICAILLGDDPDQLVRDLQDQFRKAEIVG
    CDGEFEQLIAQVVGFIEAPAMGLHLPLDVQGTAFQERVWRALREIPPGTTVSYAEIAERIGSPKAVRAVAQACATNHIAV
    AIP
    CHRVVRRDGDLAGYRWGVDRKRELLRRETQV

    >gi|94312697|ref|YP_585906.1| O-6-alkylguanine-DNA:cysteine-protein methyltransferase [Cupriavidus metallidurans CH34]
    MFLSQLDSPLGAMLLVTDARRVVRALDFADHKSRLYRGLREHYGEVELTEIPAPAEIADALARYFHGELEALKVLRTATS
    GSALQRRVWAALRRIPVGTTTTYGKLAKALGFDDPRAAVEIGAANGANPIAIVVP
    CHRVIASNGDLKGYAWGLHRKRWLL
    EHENAMVAKKMQPETQTAMLPGF

    >gi|94312771|ref|YP_585980.1| putative peroxidase [Cupriavidus metallidurans CH34]
    MSSSPTQGDETMTARLDPFAAAPVQMKSWMGTSIAIAGSLEPSLVSLVEVRASQINGCANCINMHTTQARERGETEQRLY
    LLSAWREAPCYTDRERAALGWTEAMTRLSEGHALDRASATLREHFTEEEQVKLTLMINVINGWNRLAVGFGLWVDPAAAK
    AAAKAAA

    >gi|94312788|ref|YP_585997.1| selenophosphate synthase [Cupriavidus metallidurans CH34]
    MNTNTPQVEATPPLRLTSFSHGGGCGCKIAPGVLSQILRSSAALPVPKELLVGIETSDDAAVYQLNETQALIATTDFFMP
    IVDDPFDFGRIAATNAISDIYAMGGRPIMALALVAMPVNQLPLEVIGRVIEGGQSVCQAAGIPIAGGHTIDSVEPIYGLV
    VMGLAHPKKIRRNRDARAGDVLVLGKPLGVGVMSAALKKEKLDDAGYARLIDTTTKLNTPGIALAELDDVHAITDVTGFG
    IAGHTLELARGAGLRAVLEWPRIPLLPNVMSLAEQGFITGASRRNWEGYGSEVELAAGLPELAQPLVTDPQTSGGLLISC
    APDAVGKVLAVFREQGFTEATVVGRMEAGEPGLTVTP

    >gi|94312983|ref|YP_586192.1| periplasmic thioredoxin of cytochrome c-type biogenesis [Cupriavidus metallidurans CH34]
    MMRFLLPLGVFLAIVIALAAGLRHDPRELPSSLVDKPAPAFVLPVLETSANANAQKFDPASLRGKVWVLNVWASWCTACR
    AEHPVLLGMAGQTQVPLYGLNYKDTRGAALEWLQRMGDPYKASAVDADGRVGIDLGVYGVPETFIIDAAGVVRYRQVGPV
    TQQVLEQKLLPLLKSLENGGSRA

    >gi|94313058|ref|YP_586267.1| 1-cysteine peroxiredoxin [Cupriavidus metallidurans CH34]
    MAIRLGEEAPDFTADTTEGKIHFHEWIGDSWAILFSHPKDFTPVCTTELGYMAKLKPEFDKRNTKIIGLSIDPVGDHSRW
    VKDIEETQGATVNYPMIGDHDLKVAKLYDMIHPEASGGPRTAADNATIRAVFMIGPDKKVKAMLVYPMSAGRNFDEVLRL
    LDSLQLNAKHTVATPVNWKPGDDVIIPTSVSDDDAKKKYPQGFKTLKPYLRTVAQPK

    >gi|94313143|ref|YP_586352.1| dihydrolipoamide dehydrogenase [Cupriavidus metallidurans CH34]
    MAAIEVKVPQLSESVSEATLMQWKKQAGEAVKRDEILVELETDKVTLEVPSPADGVLAKIVQPDGATVHTDDVIAVVDTE
    GKAVAAASPVAAAAPASAPAPAPAPAPVAAVASGGAGAPASAKADFDVIVIGSGPGGYIAAIRAAQLGKTVACIEEWKDD
    AGKPRLGGT
    CLNVGCIPSKALLASSEYFEQAKHGLAEHGVQVKGVTLDLAQMIQRKAAIVDKFTGGVEFLFRKNKVTWIK
    GHGKFKGRAADGVITVEASNGGETTSHTARNVIIATGSKARHLSGVPVDNKIVSDNEGALSFDSVPKKLAVIGAGVIGLE
    LGSVWRRLGSEVTLLEALPTFLGALDEAVAREAAKQFGKQGLTIHLGVDIGNIEATAKGVSIAYKDKDGAEQKLVADRLI
    VSIGRVPNTDNLGLDAVGLAADARGFIPVDDQCRTPVAGIYAIGDVVRGPMLAHKAEDEGVMAAEVIDGQKPHIDYNCIP
    WVIYTEPEIAWVGKSEAQLKAEGREFRSGQFPMMANGRALGIGHPDGFIKMIADAKTDEILGVHIISANASDLIAEAVVA
    MEFKAASEDIGMICHPHPSLSEVMREAALAVRKRALNM

    >gi|94313479|ref|YP_586688.1| methionine sulfoxide reductase A [Cupriavidus metallidurans CH34]
    MTTQIETAILAGGCFWGMQDLLRRYPGVLSTRVGYTGGDVPNATYRHHGTHAEGIEIAFDPSQISYRQILEFFFQIHDPT
    TKNRQGNDVGTSYRSAIFYLNDEQKQTAEDTVADVNASGLWPGKVVTEIAPAGPFWDAEPEHQDYLERYPNGYTCHFIRP
    GWKLPKRG

    >gi|94313516|ref|YP_586725.1| ZntA, P-type ATPase involved in Zn(II), Cd(II), Tl(I) and Pb(II) resistance [Cupriavidus metallidurans CH34]
    MEFDMARTTPDNVLPSSSAAHGRGHDHDHPHSRDHSHDHSHEHGHGHKHDHDHAHEAAPEAAQPNACCGSACGASVSVST
    PVAAPAGTRAAAYRIEAMD
    CPTEETLIRNKIGGMAGVAALDFNLMQRVLTVHHTLDSLDPVVKAIDSLGMKAEPLSDSGA
    KAAIAEPGKPWWPLAAAGALAVGAEVAEWFQIATPYLPAVLALATVLFAGLGVYRKGWIAVRNGNLNINALMSIAVTGAM
    LIGQWPEAAMVMVLFALAERIEAASLDRARNAVRGLMAMAPEQATVRQADGSWQPVDARQVPLGATVRLRPGERVALDGR
    VLKGQSALDQAPITGESVPVDKSVGDSLFAGSINQSGELEYEVTAPADDSTLARIIHAVEAAQGSRAPTQRFVDQFARIY
    TPVVFAIALAVAVIPPLFMGEAWLAWIYKALVLLVIACPCALVISTPVTIVSGLAAAARRGILIKGGVYLEQGRQLSWLA
    LDKTGTLTHGKPAQTDMAQLVDDVPEARAIAASIAARSDHPVSLAVARAAETDGVARFEVQDFAALPGQGVRGTVNGVAY
    CLGNHRLIHDLGACSPALEARLEAIERQGKTIVLLAAMDTAVPRALMLFGVADTVRETSRQAIEQLHELGVKTLMLSGDN
    PHTAQTIGALVGIDEVRGNQLPQDKADAIAALTDQAHTHAGRVGMVGDGINDAPALARADIGFAMGAAGTDTAIETADVA
    LMDDDLRKIPAFVRLSRQTSTILKQNITLALGIKAVFLVLTLMGMGTMWMAVFADMGASLLVVFNGLRLTRKAV

    >gi|94313652|ref|YP_586861.1| putative alkylhydroperoxidase-like protein, AhpD family [Cupriavidus metallidurans CH34]
    MNWYVSWTYGIRSCCARRHSGAHGRHGPSGSQYHSTYHPERSFIMTARVPLVDQRTAPAASVTAIEQIQTAFGVVPNMFR
    AVANSPAALQSMWGSFGALGGGTISAQLGEKIAVAVADRNRCEY
    CLAAHTALGRKAGASAEEMAAAQAGLSDEPKTAAAL
    AFAVKVVEARGQISETEVASLRQVGFGDEEIVEILAHVALNLFTNYVNVVFNVPVDFPGVKLIAR

    >gi|94313744|ref|YP_586953.1| hypothetical protein Rmet_4822 [Cupriavidus metallidurans CH34]
    MEIKVDFLDKLRLEAKFDDFTVIADQPIRYKGDGSAPGPFDYFLASSALCAAYFVKVYCVARNIPTDNIRLSQNNIVDPE
    NRYQQIFKIQVELPADISAKDRQGILRSIDRCTVKKVVQTGPEFVIEEVENLDADAQSLLTLKPASGASTYISGKDLPLE
    QTIANMSGILAGLGMKIEIASWRNIVPNVWSLHIRDAHSSMCFTNGKGATKESALASALGEFIERLNCNHFYAGTFWGED
    LANAAFVHYPNERWFKPGRKDALPVEILDEYCLPIYNPDGELRGSHLYETNSGNVQRGICSLPFVRQSDGEVVYFPSNLV
    ENLYASNGMSAGNTLAEAQVQCLSEIFERAVKREILEGEMALPDVPQEVLAKYPGIMAGIQVLEEQGFPILVKDASLGGI
    YPVMCVTLMNPRTGGVFASFGAHPSFEVALERSLTELLQGRSFEGLNDLPRPSFVSNAVTEPNNFVEHFIDSSGVVSWRF
    FSAKSDFDFVEWDFSGQGKNSNTEEAATLLSILEGMGKEVYMAVYDQLGSVACRILVPGYSEVYPVEDLIWDNTNKALSF
    RADILNLHRLDDESLEALLERLDNSELDEYADIATLIGIEFDENTDWGQLTVLELKLLIHLALQQFEAAHELVGAFLQYN
    DNTLERGLFYQALDVVLEVLLDDDLDLEDYKVNFRRMYGNARMDAVLGSVDGSVRFFGLTPTSMKLEGLDRHHRLIDSYK
    KLHAARANAAAAAS

    >gi|94313810|ref|YP_587019.1| dihydrolipoamide dehydrogenase [Cupriavidus metallidurans CH34]
    MNTNQNAQTAQTVQTVQTDVAIIGAGTAGLAAYRAAIAAGKRAVIIEGGAYGTTCARVGCMPSKLLIAAAEAAHEARHTA
    AFGVHVDGPVRIDGREVMQRVRSERDRFVGFVVRGVESIPQDDRLIGRARFIDNTILQVDDHTVVRASRVVIATGSRPAV
    PPSFGVFGDRLIVNDDVFSWEDLPQSVAVFGPGVIGLELGQALSRLGVRVRVFGVGGGVGPLSDPEIRAYAAKSFNQEFS
    LLADARVLEMRREGDDAVITFEDADGQTVTERFAYVLAATGRRPNVDTLALGNTALELDGRGVPTFDPVTLQCGESPIFI
    AGDANNVLPLLHEAADEGKIAGENAALWPKVGPLTRRAPIAVVFSDPQIAMVGKRFAELTPGSFVTGEVSFEDQGRSRVM
    LKNRGLMHVYADRATGRFIGAEWIGPRAENIAHLLAWSYQQGLTIAAMLAMPFYHPVVEEGLRTALRDAQAKLAQLQEAA


    >gi|94313811|ref|YP_587020.1| thioredoxin reductase [Cupriavidus metallidurans CH34]
    MLQSREGQRVPNVTFRVRANNEWKDVTTAELFDGKTVVLFSLPGAFTPTCSSTHLPRYNELAPVFAKQGVDAILCVSVND
    TFVMNEWAKDQESENIVMIPDGNGEFTDGMGMLVDKADLGFGKRSWRYSMLVKDGVVDKMFIEPEEPGDPFKVSDADTML
    NYIAPTAKQPDQVVVFSKIG
    CSHCAKAKQLLSDNGFEYIDVPLENKIRGKVLGAVSGEMTAPQVFINGKLVGGAEALEQY
    LAR

    >gi|94313845|ref|YP_587054.1| putative thiol-disulfide isomerase/thioredoxin [Cupriavidus metallidurans CH34]
    MSMTRSFAATEPTRDEIDALPGATLLEFGAPWCGYCMRAQPLIEEAFGGYPAIHHVKVEDGSGRPLGRSFRVKLWPTLVF
    LRDGREVARLVRPESAKDIAAAMRRILP

    >gi|94313933|ref|YP_587142.1| pyridine nucleotide-disulfide oxidoreductase [Cupriavidus metallidurans CH34]
    MAQRFDAIIIGTGQAGPALAARLAGAGMKLAVIERGRFGGTCVNTGCIPTKALIASAYAAQLARRAAEYGVTIGGPVAVD
    MRQVKARKDEISGRSSQGVEQWMRGLDNVTVHQGHARFEHARGVRVNGELLEADQIFINVGGRALIPPMPGLDQVSYLTN
    SSMMEVDFLPEHLIIVGGSYIGLEFGQMYRRFGARVTIVEKGPRLIQREDEDVSQAVREILEREGIEVRLDANCLSARKD
    GDHIAVGLDCAGGAPEVHGSHLLMAVGRVPNTDDLGLDKAGIETDARGYIKVDDQLRTSVPGIWALGDCNGRGAFTHTSY
    NDYEIVAANLLDNDPRAVTDRIPAYALFTDPPLGRIGMTEREARQSGRKVLVGTRPMSRVGRAVEKGESQGFMKILVDAD
    TRLLLGAAILGLNGDEVVHSLLDVMYAGAPYTTISRAVHIHPTVSELVPTVLQGLRALT

    >gi|94314594|ref|YP_587803.1| putative transporter component domain-containing protein [Cupriavidus metallidurans CH34]
    MLLIDLGNFTPGLSLAGGIVIGVAAAVLVLFNGRIAGISGILGGLLSLPRRDMTWRVAFLIGLIGAPILAALFGMPAKAD
    IQASWGEVLVAGFLVGIGTRYAGG
    CTSGHGVCGISRGSIRSLVATLTFMAAGFLTVFVTHHLIGA

    >gi|94314707|ref|YP_587916.1| DSBA oxidoreductase [Cupriavidus metallidurans CH34]
    MTQALRIDFVSDIACPWCAIGLTSLKQALERLGDEVEAEIVVHPFELNPDMPPEGRTILDYVSTKYGSTAEQLAERQVQI
    RERGEAVGFEFGPRTHIYNTFDAHRVLQWAGTQGKKLPLKLALLKAYHGAGKDPSNHDVIVEAAQSAGLDGAEARRILES
    DAYADEVRAEVAQFQSMGINSVPSVIFDNRYLLTGGQPPEAFEQVIREVLEKRQS

    >gi|94313272|ref|YP_586481.1| alkylhydroperoxidase AhpD [Cupriavidus metallidurans CH34]
    MDWKPLGGRHCGAQTEPIDSPGASVSRSVALQYYLGRSVMSVMRTLLASAGLALLLALATEPSVSAQEAPEWMKQTLPEQ
    ALKPHWDESRAVMNPTGALDAKTKQLIALGVAAQIPCAY
    CVSAHTKAAKAAGATDAQIKEAIATAALVRFNSTMLNGSDG
    GTEWSPQRK