Cryptobacterium curtum DSM 15641 uid59041

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|256826512|ref|YP_003150471.1| hypothetical protein Ccur_00560 [Cryptobacterium curtum DSM 15641]
    MESLNSKKGLALVGVVVGLLIAVLAATGNPGNMAICAACFIRDMAGSLKLHTAAPVQYFRPEIVGFVAGAFLIALATREY
    RSTAGSSPMVRFILGFIMMIGALIFLGCPLRMVIRMSAGDLNAWVGLVGLVAGVATGAVFLKRGFSLGREHDTNKAAGTV
    LPIALVVLLIISLTLTVMAVSESGPGSKHAPWIISLAVALVIGALAQKTRICFIGGVRNVILMRDFSLLIPIVGLFAVMA
    IYNVATGGFKLSFDGQPIAHAQHLWNILGLYAVGFAGTLAGG
    CPLRQMILAGQGSCDGAMTFLGMLIGAAFAHNFGLAGA
    AAAAATADTPAVAGGPSLAGQVVLVAGIAVLFVIAFTNQKKKKAAAAKATPAVSAPVASEA

    >gi|256826567|ref|YP_003150526.1| peroxiredoxin [Cryptobacterium curtum DSM 15641]
    MSLIGKEISDFSVQSYQNGEFKTVTKQDVLGKWGLFFFYPADFTFVCPTELEDLADLYGKFQEAGCEVYSVSCDTHFVHK
    AWHDESERIQKVTYPMLADPTHALARDFKVYIKEDGLAERGAFIVDPEGRIQVYQVNAGGIGRNAAELLRLLLAAQFVAK
    YGDQVCPAKWQPGADALKPSIDLVGQL

    >gi|256826642|ref|YP_003150601.1| ABC-type Fe3+-hydroxamate transport system, periplasmic component [Cryptobacterium curtum DSM 15641]
    MKSKNELILDEVSRLSRRDFLKLAGIAGLTAATGGMLAGCGNGNGGSNSSDSSNQATTQMVTDMNGNQVEVPLNPTKYAD
    GWYAHNEITIMLTGAEGLVATHCDEKSFPWMYKVCSNMSKATATFGNDFNFEDLVALEPQVIFDSKESLRDK
    CEEVGIPL
    VNCNFQTYETMQQSIELTAQVFGGKAPEIAKKYNDELSSTVSAVKAKTDKLSDSDRPRVMHGNSVYTFILDGTETIIDTW
    IQAAGGVNAVAESTKGNAQAQFSLEQIIAWDPEVIITGKAAEVDQILSDPNWSSISAVKNNKVYVNPKGVFGWDRYGVEE
    LLQIQWVSALLHPDLFPDLDIRTKVKDFYATYLNYQTTEDDIDRIMGAQNPA

    >gi|256826821|ref|YP_003150780.1| thiol-disulfide isomerase-like thioredoxin [Cryptobacterium curtum DSM 15641]
    MISVVVLVAVVAVAVVAYRALSAGQMSSSTSAGSASTSSSSIDQSQALSQSPGNSSSANGSGSAMSGGSSGNSQALPSFS
    VLDSSGAKVSSDSVIGKPTFIGFWATW
    CPNCVSEAPDIQKLYDTYGDRVNFMMIDCVDGQRETVDIAKQWIESKGYTYPV
    YFDTTNQASLALRVQYLPTIYLVDAQGNVTSMKIGSTSFDAMATALDGLLAS

    >gi|256826892|ref|YP_003150851.1| methionine-R-sulfoxide reductase/methionine-S-sulfoxide reductase [Cryptobacterium curtum DSM 15641]
    MISIGYVFAVFCAGLLSFFSPCILPILPVYIAYLSVDATSEKLSFARKLARTLAFIIGLSAAFFLLGFGAGALGGVISSP
    IFSIVCGVVVFIFGLYMAGLLKIAPLMRERRFTLPKSIAGKKSVASAFLLGLIFSLGWTPCVGPILASILALAAEQGTAA
    SGGFLLAIYSLGLAIPFLVLSLGSDFLLSRVRNLNRYLPTIKLVGGLVLAALGLFMIISQAYTLQTGASASRSLTPASTT
    ESVKAAEDFTLPALDGSTATLSDYRGRPVYTKFWASW
    CPTCLAGLDDFASLATDYNEAGSAQILSVVAPGQKGEVDESSF
    STWATGQDLTFPILFDSDGAQLSHFDIRAYPTSVFFDAEGRVVKKVTGEMTSDEVRAEIDALIAGKTGDTTTSVVDDGKG
    TTVHIDTNNLHDIYFAGG
    CFWGVEEYFSRIPGVYDVVSGYANGTTENPTYQQVCSGTTGHTETVHIRYDPSIVSLRTLAT
    QLFKIINPLSHNQQGNDRGTQYRTGMYYTDEADASTLSSVLAEEQTKYSDPIATELKPLENFSEAEDYHQDYLKKNPGGY
    CHIDFSSLDDVQLEAAQSYVDPSEYTRPTDEEIKAMLTDAQYHVTQQEGTDPAFSGEYFNTFEAGIYVDIVTGEPLFSSE
    SKYASGCGWPSFTQPIDPAVIVERTDTSHGMVRTEVTSRVGASHLGHVFPDGPSDKGGLRY
    CIDSSAIRFIPYDQMDAEG
    YGKFKDACAYGGDNS

    >gi|256827276|ref|YP_003151235.1| glutathione peroxidase [Cryptobacterium curtum DSM 15641]
    MRVYDYTATNLDGSEAPLSAYKGDVLLVVNTATGCGFTPQYEDLEKIYANHRTKGFEILDFPCNQFREQAPGSDEEIHQF
    CTMKFGTEFPQFKKIDVNGENAFPLFKEMATEKPFVGFGRGPKALMMNQVAKSVDKEFGDAAYIKWNFTKFLFDREGNLI
    ERFEPTAKMEDVEAAIEKLL

    >gi|256827315|ref|YP_003151274.1| thioredoxin-disulfide reductase [Cryptobacterium curtum DSM 15641]
    METFDIAVIGAGPAGMTAALYSARAGLSVVMFEEMMPGGQLAQTDKIENYPGFPGGIGGFELSMAMKEQDDGFGVVYRNE
    AVSAVDFTGDVKTLTTANGQVSAKAVIIATGARSRKLGIAGEAELAGHGVSY
    CATCDGNFFRGQDVVVVGGGNTAAADAV
    YLSRICNTVHLVHRRGEMRATAADRHRVAQADNVVFHGNKVVDELQQQDGAVVGVVIRDVNTGETQTIPTRAVFVAIGKL
    PNTEAFVGQVPLTDAGYIRTEENGATEVAGVYAAGDVREKLLRQVATAISDGAIAAEAAAESCSA

    >gi|256827316|ref|YP_003151275.1| thioredoxin [Cryptobacterium curtum DSM 15641]
    MAQQISSQEFEEKVLKSDKPVLVDFFATWCGPCKMMSPVIDEVATDMEGKAAVYKLDVDESSDIAQRYGVMSIPTLIVFE
    NGEVKNQTLGAQPKQAVLDLFN

    >gi|256827431|ref|YP_003151390.1| O-6-methylguanine DNA methyltransferase [Cryptobacterium curtum DSM 15641]
    MESNGDFFTRAFDVVRRIPGGKVATYGQIARLIGEPKKARYVGFAMHSSPGVAGGVPCHRVVFKDGSLAPGFAFGGADAQ
    CKLLEAEGVTFLSDGRVDMNACAWDGRDPNRMGPPPGFLTAAEFGD

    >gi|256827480|ref|YP_003151439.1| thioredoxin reductase [Cryptobacterium curtum DSM 15641]
    MQQYDVLVIGAGPAGISAAVYAASRGKQVGLFEAQAVGGMIGRVSTVTHYASVASGETGAQFARRLEEQAIDAGVDIIRE
    RVVLAKLTDEEKSVTTTAGKTFGAPRIILANGLKKRELGIPGEKLA
    CKSAQFEAGKFQSKNVYVIGGADGAVKEALYLAR
    FAKKVSIICVEDELACISQFREPALSANNIEIIPSSRVTALDGKGIVERLHIESLHSGQTTEIDDPGCGVFVFAGGTPDT
    ALYTGQIELDNGFIQVNEEMATSLPGVWAAGDIRVKQVRQVATAVADGAIAGINAAR

    >gi|256827510|ref|YP_003151469.1| hypothetical protein Ccur_10960 [Cryptobacterium curtum DSM 15641]
    MLFIEYPQCSTCQKAKKWLDAQGIDYTDRNIKQDRPTIAELTDWHERSGIDLKRLFNTSGMVYRARGLKDKLPTMTDEEK
    IAELASDGMLVKRPLVIDGDTVLAGFREAEWAQAFGVTKA

    >gi|256827535|ref|YP_003151494.1| copper/silver-translocating P-type ATPase [Cryptobacterium curtum DSM 15641]
    MKKTFDVTGMTCAACSARVTKATQAVPGVDEAVVNLLKNSMEVTYDGNDATLAAVSAAVEKAGYGATVRGQASSEAAPSR
    GSASDAAQKEARHVRMRLIVSILFTVPLFYLSMGHMFSWPIPAALAGHEGMMSLALTELLLTIPVVFVNFKFFRVGFKTL
    IHRAPNMDSLIALGSTASIIYGIAAMYRMSAALGVGDVQAAHTAGMDLYFESAVMILTLITLGKFFEARAKGRTTDAING
    LLDLAPATALRVRDGQEEEILIEQVVVGDILAVRAGAAVPCDGVVVEGTAAVDESVITGESLPVEKEAGDTVTGATVNRS
    GWFTMRATAVGADTALAHIVKLVDEATSTKAPIERKADQIAGIFVPAVIGVAIVVFAIWLVIGDFSAAVSHAISVLVISC
    PCALGLATPTAIMVGTGRGAQQGVLIKSAEALENAHDTRIVVLDKTGTITEGAPRVTDALVYEHDGWTAVETNQLTADQT
    RVVQAALSLEERSEHPLARAFVDYATERGVEAQPVEDFTTVAGRGVKGIVDGSFCVAGNERLLRETGVTVDAFATETKRL
    AEEGKTPLIVARDGKAELIVACADVVKPTSKHAIERLRAMGVKTVMLTGDDARTAAVIQREVGTDEAIASVLPEGKEERV
    RAFCAEGKTAMVGDGINDAPALARADVGIAIGAGTDVAIDAADIVLMRSDLEDVATSLELSRATMRNIKQNLFWALIYNA
    ICIPIAAGALSAWGIALNPMIAAACMSFSSICVVTNALRLRGWKPSLEAASVSVDAGQLSAGQRNSDQLGDDIKVNSNIK
    LEGDNRSKNNSQPDDDKSKSTGQSGDSTSDSVSQSNGEGQTTQNNPENEVDRKEPTMKKTLAVDGMMCEHCVAHVTKALE
    GIEGVSSVKVSLADKNAVVDLAQEVPDAALVDAVVDAGYEASVVA

    >gi|256827649|ref|YP_003151608.1| glutaredoxin-like protein [Cryptobacterium curtum DSM 15641]
    MVSSDSLLLYVLPGCPFCARVDRFLDDQGIKIEHRSVREPENADELKAIGGKVQSPCLVIDGKALYESKDIIEFLKREVV
    GA

    >gi|256827773|ref|YP_003151732.1| hypothetical protein Ccur_13750 [Cryptobacterium curtum DSM 15641]
    MRRNYKLQGEICANCAAKIEDKVRKLDGVNDAKVNFMMLRFTLDASEESFDDALTQSLRIFEDIEPDCTVVV