Cronobacter turicensis z3032 uid40821

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|260595824|ref|YP_003208395.1| hypothetical protein Ctu_00320 [Cronobacter turicensis z3032]
    MSNLEQLAYYQKKLSFEADSWDLYLALNAGENIVVVDGRNEEAYQREHIPGAINLPHKALCFNNTAELDKSKVYICYCDG
    IG
    CNGSTKTAMKLLTLGFQVKELIGGLDWWKRDGYATEGHQGRDGTPVSCGC

    >gi|260595989|ref|YP_003208560.1| soluble pyridine nucleotide transhydrogenase [Cronobacter turicensis z3032]
    MYKNKVSLTMPQTYDYDVIVIGSGPGGEGAAMGLVKQGATVAVIERYHNVGGGCTHWGTIPSKALRHAVSRIIEFNQNPL
    YSAHSRPLRSSFADILNHADNVINQQTNMRQGFYERNRCQILQGDARFIDEHTIELTCQDGSIETLTAEKFVIACGSRPY
    HPDDVDFNHSRIYDSDSILSMHHEPRHVIIYGAGVIGCEYASIFRGMNVKVDLINTRDRLLAFLDQEMSDSLSYHFWNSG
    VVIRHNEEYERIEGVDDGVIVHLKSGKKVKADCLLYANGRTGNTDSLALENIGLEADGRGLLKVNSMYQTALPHIYAVGD
    VIGYPSLASAAYDQGRIAAQALVKGVASAHLVEDIPTGIYTIPEISSVGKTEQQLTAMKVPYEVGRAQFKHLARAQIVGM
    NVGTLKILFHRETKEILGIHCFGERAAEIIHIGQAIMEQKGGGNTIEYFVNTTFNYPTMAEAYRVAALNGLNRLF

    >gi|260596010|ref|YP_003208581.1| thioredoxin [Cronobacter turicensis z3032]
    MSDKIIHLTDDSFDTDVLKADGLTLVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLL
    LFKNGEVAATKVGALSKGQLKEFLDANLA

    >gi|260596095|ref|YP_003208666.1| adenylyltransferase thif [Cronobacter turicensis z3032]
    MTGAPPRNGYLNWRGRAMNDADFMRYSRQLLLEDIAIDGQQKLLASRVLIVGLGGLGSPAALYLAGAGVGTLWLADDDAV
    HLSNLQRQILFGVSDIEQPKSRAAARRLQALNPAIESVALHQRLEGDALREAVEGVDLVLDCSDNMTTRQAINAACVAHG
    TPLITASAVGMGGQIATFAPPFDYGCYRCLWPDDSEPERN
    CRTAGVLGPVVGLMGTLQALEAIKLLCGITPGHGELRLFD
    ARASQWRTLTLQRAADCPVCGGEHAH

    >gi|260596366|ref|YP_003208937.1| hypothetical protein Ctu_05740 [Cronobacter turicensis z3032]
    MSLENVIYRAKAKATGGRDGRATSSDGVLDVKLGVPKEMGGMGGDVTNPEQLFAAGYSACFLGAMKFVAARDKIAMPKDA
    FIEGEVGIGPLPTGFGIEAKLNIHLPGMDAAEAQKLVDAAHIV
    CPYSNATRGNIDVTLNIIA

    >gi|260596543|ref|YP_003209114.1| dihydrolipoamide dehydrogenase [Cronobacter turicensis z3032]
    MSTEIKTQVVVLGAGPAGYSAAFRCADLGLETVIVERYSTLGGVCLNVGCIPSKALLHVAKVIEEAKALAEHGIVFGEPK
    TDIDKIRTWKEKVINQLTGGLSGMAKGRKVKVVNGLGKFTGANTLEVEGENGKTVINFDNAIIAAGSRPIQLPFIPHEDP
    RVWDSTDALELKEVPKRMLVMGGGIIGLEMGTVYHALGSEIDVVEMFDQVIPAADKDVVKVFTKRISKKFNLMLETKVTA
    VEAKEDGIYVSMEGKKAPAEAQRYDAVLVAIGRVPNGKNLDAGKAGVEVDDRGFIRVDKQMRTNVPHIYAIGDIVGQPML
    AHKGVHEGHVAAEVIAGMKHYFDPKVIPSIAYTEPEVAWVGLTEKEAKEKGISYETATFPWAASGRAIASDCADGMTKLI
    FDKETHRVIGGAIVGTNGGELLGEIGLAIEMGCDAEDIALTIHAHPTLHESVGLAAEVFEGSITDLPNPKAKKK

    >gi|260596579|ref|YP_003209150.1| iron-sulfur cluster insertion protein erpa [Cronobacter turicensis z3032]
    MSDDVALPLQFTDAAANKVKSLIADEDNPNLKLRVYITGGGCSGFQYGFTFDDQINDGDMTIEKQGVSLVVDPMSLQYLV
    GGAVDYTEGLEGSRFVVNNPNATSTCGCGSSFSI

    >gi|260596883|ref|YP_003209454.1| copper exporting atpase [Cronobacter turicensis z3032]
    MRRQRMSNTIELALDGLSCGHCVKRVKESLEQRPDVERADVTIEHASVTTTAPADALIETVKQAGYDATLAHPKANPLTE
    SSTPSEALTAAQPELPAADIADDDDSRQLLINGMS
    CASCVSRVQSALQGVEGVTQARVNLAERTALVMGHASAADLIAAV
    EKAGYGAEAIDDDAERRERQQQTAQAAMKRFRWQAALALAVGIPVMIWGMFGDNMMVTDANRSLWLVIGLITLGVMIFAG
    GHFYQSAWKSLRNRSATMDTLVALGTGAAWLYSMSVNLWPQHFPMEARHLYYEASAMIIGLINLGHMLEARARQRSSKAL
    ERLLDLTPPVARVVTPEGEKKLPLAEVTPGMTLRLTTGDRVPVDGDITDGEGWFDEAMLTGEPVPQQKAAGDTIHAGTVV
    QDGSVLFRAAAVGNHTTLSRIIRMVRQAQSSKPEIGKLADRISAVFVPVVVLIALFSGAVWYFAGPAPQIVYTLVIVTTV
    LIIACPCALGLATPMSIISGVGRAAEFGVLVRDADALQRASDVDTLVFDKTGTLTEGKPQVAAIATTGDITEADALRLAA
    ALEQGSSHPLARAIIERAEGASLPAVSGFRTLRGLGVSGEAQGKTLLLGNQALLEENGIATDALRDEAQREASLGATPVL
    LAVNGTLAALFAIRDPLRADSADALARLHREGYRLVMLTGDNAVTANAIAREAGIDEVIAGVLPDGKAQAIQKLQQAGRK
    VAMIGDGINDAPALAQAEVGIAMGGGSDVAIETAAITLMRHSLTGVADAMAISKATLGNMKQNLLGAFIYNALGIPIAAG
    VLWPLTGTLLNPVVAGAAMALSSITVVSNANRLLRFNPKK

    >gi|260596890|ref|YP_003209461.1| hypothetical protein Ctu_10980 [Cronobacter turicensis z3032]
    MKARAPPPCKKKIDNRESLMSEQNIINLSEANLHQILEQSMNVPVLFYFWSDRSQHCQQLTPVLEKLANQYQGQFILAKV
    DCDNEQAIAGQFGLRAIPTVYLFSQGQPVDGFQGPQPEEAIRALLDKVLPREEELKAQEAMALMQEGKNADALPLLKDAW
    QMSNQASEIGLLLAQVQIALNRSEDAEAVLKTIPLQDQDTRYQSLVAQIDLLKQAADTPEIQQLQQQVQQNPDDAQLASQ
    LALQLHQVGRNEEALELLFVHLKKDLNAADGQARKMFQEILAALGTGDALASKYRRQLYSLLY

    >gi|260596987|ref|YP_003209558.1| glutathione peroxidase [Cronobacter turicensis z3032]
    MEEPVMTPFHQLTATSLRGELISMADYAGKLILVVNTASHCGFTPQYAGLEALYKQYAARGLVVLGFPCNQFGHQEPGGA
    DEIAQTCHINYGVSFPMFEKVEVNGTATHPVFRYLKDELPGVLGGRIKWNFTKFLIGRDGKPLRRFAPFTTPEKIETVIL
    TAL

    >gi|260596994|ref|YP_003209565.1| inner membrane protein ygap [Cronobacter turicensis z3032]
    MPSKRFIVRENKMSSIFITPAEVHALSGRRIMLIDIRGQEEWRREHLSGARSLPLETVQPGSLDKDALAQTDMVIFHCQS
    GMRTENARQQLIAAAHPAEVRIMQGGLNAWKAAGLPVITDSRQPLPLMRQVQIVAGALALCGTLAGATVTPAFYIIPAFV
    GAGLMFAGITGWCGMAKLLAVMPWNKPVM

    >gi|260597033|ref|YP_003209604.1| alkyl hydroperoxide reductase subunit c [Cronobacter turicensis z3032]
    MSLINTKIKPFKNMAFKNGEFIEVTEKNTEGRWSVFFFYPADFTFVCPTELGDVADHHEELQKLGVDVYSVSTDTHFTHK
    AWHSSSETIAKIKYAMIGDPTGALTRNFEIMREDEGLADRGTFIVDPQGVIQAIEITAEGIGRDASDLLRKIKAAQYVAS
    HPGEVCPAKWKEGDATLAPSLDLVGKI

    >gi|260597034|ref|YP_003209605.1| alkyl hydroperoxide reductase subunit f [Cronobacter turicensis z3032]
    MLDTNMKTQLKAYLERLTKPVELVATLDDSAKSAEIKELLLEIAELSDKVSFREDNTLAARKPSFLITNPGSDQGPRFAG
    SPLGHEFTSLVLALLWTGGHPSKEAQALLEQIRDLDGDFEFETYYSLS
    CHNCPDVVQALNLMAVLNPRIKHTAIDGAVFQ
    NEITDRNIMGVPAVFMNGVEFGSGRMTLAEIVAKVDTGAEKRAAEELNQRDAYDVLIVGSGPAGAAAAIYSARKGIRTGL
    MGERFGGQVLDTVDIENYISVPKTEGQKLAGALKSHVDDYDVDVIDTQSATKLIPAASEGGLHQIETASGAVLKARSVIV
    ATGAKWRNMGVPGEDQYRTKGVTY
    CPHCDGPLFKGKRVAVIGGGNSGVEAAIDLAGIVEHVTLLEFAPEMKADQVLQDKL
    RSLKNVDIILSAMTTEVKGDGTKLTGLDYQDRVTGAVKHLEVAGIFVQIGLLPNTTWLEGAIERNRMGEIIIDAKCETSV
    KGVFAAGDCTTVPYKQIIIATGEGAKASLSAFDYLIRTKTA

    >gi|260597224|ref|YP_003209795.1| molybdopterin biosynthesis protein moeb [Cronobacter turicensis z3032]
    MFSAPLARATALSCWSASAATSSRANGLRSSCLTTCSEAEMTEALSDAEMLRYNRQIILRDFDFDGQERLKAARVLVVGL
    GGLGCAAAPYLAAAGTGRLTLLDFDTVALSNLQRQVLHRDATIGQPKVESAREALSAINPHCVIDAVNAQLDDAALAELI
    ARHDLVLDCTDNVATRNQLNALCFHHKVPLVSGAAIRMEGQISVFTWQPGEPCYRCLSRLFGDNALT
    CVEAGVMAPLVGV
    IGSLQAMEAIKVLARYGEPCAGKLVMYDALRTQFREMKLACNPHCEVCGDGR

    >gi|260597291|ref|YP_003209862.1| thioredoxin reductase [Cronobacter turicensis z3032]
    MGTAKHSKLLILGSGPAGYTAAVYAARANLKPVLITGMEKGGQLTTTTEVENWPGDPHDLTGPLLMERMHEHAAKFETEI
    LFDHINKVDLQNRPFRLIGDSGEYTCDALIIATGASARYLGLPSEEAYKGRGVSA
    CATCDGFFYRNQKVAVIGGGNTAVE
    EALYLANIASEVHLIHRRDTFRAEKILIKRLMDKVESGNIVLHTHRTLEEVTGDQMGVSGLRLRDTVNPENVETLDVAGL
    FVAIGHSPNTAIFDGQLELENGYIKVQSGIHGNATQTSIPGVFAAGDVMDHIYRQAITSAGTGCMAALDAERYLDGLAEK
    QS

    >gi|260597425|ref|YP_003209996.1| hypothetical protein Ctu_16330 [Cronobacter turicensis z3032]
    MPVLHNRISNEELRARMLAETEPRTTISFYKYFTIDDPKATRDALWQTLTALNVFGRIYLAHEGINAQISVPESHVEAFR
    AALYAFHPALNGVRLNIALDDDGKSFWVLRMKVRDRIVADGIDDPTFDASDVGDYLKAAEVNAMLDDPDAVFIDMRNHYE
    YEVGHFENALEIPADTFREQLPKAVEMMEEYRDKKIVMY
    CTGGIRCEKASAFMRHNGFQKVWHIEGGIIEYARKAREQGL
    PVRFVGKNFVFDERMGERISDDVIAHCHQCGAPCDSHTNCKNDGCHLLFIQCPACAEKFSGCCSEVCKEEMSLPEEEQRR
    RRAGRENGNKIFNKSRGRLNTTPGIPDPE

    >gi|260597433|ref|YP_003210004.1| glutaredoxin 2 [Cronobacter turicensis z3032]
    MSNLSRRRNVKLYIYDHCPFCLKARMIFGLKNLPVELIVMSNDDEATPTRMIGQKMAPILQKDDSRYLPESMDIVHYVDN
    LDGKPLLTGKRNPAIEEWLRRVNGYINRLLLPRFAKAPFDEFATPEARRYFTEKKEAAIGSFDDHMAHSAGLIKNISDDL
    RALDKLIVQPNAVNGELSEDDIHLFPLLRNLTLVAGVNYPTRVADYRDNMAKQTQINLLSRMAI

    >gi|260597596|ref|YP_003210167.1| methionine sulfoxide reductase b [Cronobacter turicensis z3032]
    MPRCHLMANQNSHDDLKNTLTEMQFYVTQNHGTEPPYTGRLLHNKRDGVYRCLVCDAALFNSATKYDSGCGWPSFYEPVS
    EDSIRYINDYSHGMQRIEIRCGSCDAHLGHVFPDGPQPTGERY
    CVNSASLSFTDDDNGEQIKG

    >gi|260597602|ref|YP_003210173.1| selenophosphate synthetase [Cronobacter turicensis z3032]
    MSEQAIRLTQYSHGAGCGCKISPKVLETILHSDQAKFIDPNLLVGNETRDDAAVYDLGNGTSVISTTDFFMPIVDNPFDF
    GRIAATNAISDIYAMGGKPIMAIAILGWPVNTLAPEIAREVVEGGRFACQQAGIALAGGHSIDAPEPIFGLAVTGVVPTE
    RVKKNSTAEAGCKLFLTKPLGIGVLTTAEKKSLLRPEHQGLATEVMCTMNKAGAEFAEIDGVRAMTDVTGFGLLGHLSEV
    CQGAGLQAELWYEAVPKLPGVEEYIAQGAVPGGTSRNFASYGHLMGDMPDAWRSLLCDPQTSGGLLLAVDPQSEAQVQAV
    AAEHGITLSAIGELKTARGGRPMVEIR

    >gi|260597645|ref|YP_003210216.1| glutathione peroxidase [Cronobacter turicensis z3032]
    MQHDILNTEVTTIDGETISLEQYKGKVLLIVNVASKCGLTPQYEQLENIHKAWEPSGFRVLGFPCNQFLGQEPGSEDEIK
    TFCSTTYGVTFPMFSKVDVNGDNRHPLYQKLIAAAPKAVAPEQSGFYERMASKGRAPLYPDDILWNFEKFLVGRDGHVIQ
    RFSPDMTPEDPIVMEAIKLALAK

    >gi|260597652|ref|YP_003210223.1| hypothetical protein Ctu_18600 [Cronobacter turicensis z3032]
    MSQHPRFTATWRDELPGFYTELTPTPLNNSRLFFHNAPLAQALELPQTLFDYQGPAGVWGGETLLPGMAPLAQVYSGHQF
    GVWAGQLGDGRGILLGEQQLSDGRKLDWHLKGAGLTPYSRMGDGRAVLRSTVREFLASEAMHGLGIPTTRALSIVTSDTP
    VRRETTERGAMLMRIAESHVRFGHFEHFYYRREPESVRELAQYVIEHHFAHLAQEEDRFALWFGEVVRRTAHLMASWQCV
    GFAHGVMNTDNMSILGLTMDYGPYGFLDDYQPGFICNHTDYQGRYAFDNQPGVGLWNLQRLAQALSPIIPAERLNALLDD
    YQPVLLREWGRQMRAKLGFTVEKEGDNDYLRELLTLMAREGSDYTRTFRMLSETEQRSSASPLRDEFIDRATFDAWFARY
    RARLEDEGVEDDARQQRMKSVNPALVLRNWLAQRAIEAAERDDASELSRLLEALRHPFDDRDDDYTHRPPDWGKHLEVS
    C
    SS

    >gi|260597663|ref|YP_003210234.1| iron-sulfur cluster assembly scaffold protein [Cronobacter turicensis z3032]
    MALKALTPGDRPMESQTGTFNPAEFNWQGLTMTPDAAKHIRDLMAQKPGLLGVRLSVKQSGCAGFGYVLDTVSEPKDEDL
    VFEADGARLYVPLQAMPFIDGTEVDYVREGLNQIFKFNNPKAQHACGCGESFGVQAE

    >gi|260597772|ref|YP_003210343.1| hypothetical protein Ctu_19800 [Cronobacter turicensis z3032]
    MSTTLEKIQRQIAENPILLYMKGSPKLPSCGFSAQAVQALSACGERFAYVDILQNPDIRAELPKYANWPTFPQLWVDGEL
    VGGCDIIIEMYQRGELQPLIKETAAKHNPATPDAE

    >gi|260597791|ref|YP_003210362.1| glutathionine s-transferase [Cronobacter turicensis z3032]
    MKLFYKAGACSLSPHIILREADIDFTLVAVDLAAKRTENGEDYLTINPKGQVPALLLDDNTLLTEGVAIVQYIADKVPDR
    QLLAPVGSMTRYHTLEWLNYIATELHKGFTPLFRPGTPDEYKTTAREQLQKKFEYVNEALAQKQWLMGLRFSVADAYLFT
    VLNWANAVGLEMQAFENIADYQARVKARPAVAAALKAEGLSA

    >gi|260597794|ref|YP_003210365.1| electron transport complex rsxe subunit [Cronobacter turicensis z3032]
    MPPCLPVETPMNDVKSILVNGLWKNNSALVQLLGMCPLLAVTSTATNALGLGLATTLVLVLTNASVSTFRRWMPGEIRIP
    IYVMIIAAVVSIVQMLINAYAFGLYQSLGIFIPLIVTN
    CIVVGRAEAFAAKNGPLLSALDGFAIGMGATGAMFVLGSLRE
    ILGNGTLFDGADGLLGSWARVLRVEVFHTDTPFLLAMLPPGAFIGLGMMLAVKYLIDERMKRRAAKPVVVEAAAEKAS

    >gi|260597799|ref|YP_003210370.1| electron transport complex protein rnfa [Cronobacter turicensis z3032]
    MTDYLLLFVGTVLVNNFVLVKFLGLCPFMGVSKKLESAIGMGMATTFVMTLATILSWIIDHLILVPLELVYLRTMAFILV
    IAVVVQFTEMVVRKTSPALYRLLGIYLPLITTN
    CAVLGVALLSINLNHTFLQSALYGFSAAVGFSLVMVLFAAIRERLVV
    ADVPLPFRGNAIALVTAGLMSLAFMGFSGLVKF

    >gi|260597827|ref|YP_003210398.1| methylated-DNA--protein-cysteinemethyltransferase [Cronobacter turicensis z3032]
    MGPEYDVFRLYFLFSRKKRVRFVFSGNAGGAARICIPYSAPAVTWARRLAAASGNGMPGLSPLRSSCGGMASRWPPCYFD
    ASTRRPRMLTLLEDKIDTPLGPLWVIADEQSRLRAVEWEEHSDRMEQLLAIHYRSEGFRRVGCENPGGLSDALRAWFAGD
    LAVIDTLPTATGGTPFQREVWQMLRTIPCGQVMHYGEMAQRLGRPGAARAVGAANGSNPISIVVP
    CHRVIGRNGTLTGYA
    GGVARKEWLLRHEGYLLI

    >gi|260597831|ref|YP_003210402.1| hypothetical protein Ctu_20390 [Cronobacter turicensis z3032]
    MTRSPDLLDTLADIAPGSPLALARATRDAATLNIVRSHEALFSGASDLTRAERLHLAREVARWHEDEALYAHYSAAVENE
    PAPAARLSAALGHAEILAFRPVQATAQAITALTEAGFSEEAIVTLAQVAAFVSFQSRLLRGYRLINGGRVAGETAIPPAG
    RWHTTATTQRGQPAPTAFTQAELDWEPWLAPKALAAFSPDEQETLHRFGHQDSGYFRLLARNLPALEARTLTDKGIFYTP
    GGLARAERELAATVASKVNGCIY
    CASVHARKASQLSKDNDAVQRLLEVAPGGSLSAGQSARWQAIIDFSAALSATPASAG
    AAHVAALREQGLTDLELLDLVQATAFFAWANRLMLTLGEPFVPA

    >gi|260597911|ref|YP_003210482.1| hypothetical protein Ctu_21190 [Cronobacter turicensis z3032]
    MHGTPADGHSFTKECIMSRLQTIATDTATGKTAQLFDTLKSAMGKVPNAYATIGSNAPEMLSQALQHTMALKKGALSARE
    LEAINLVVSETTGCDY
    CLAAHTLMAKKAGYSAEETRALRAGQFAQDSHIDALLRFVKTVITTRGTLPESDVTALRAAGFD
    DRQVIEILSAVSAILFTNMVNRVNDTVVDFPKAE

    >gi|260598094|ref|YP_003210665.1| thiol peroxidase [Cronobacter turicensis z3032]
    MTMSQIVYFQGNPVSVVGQIPQAGSKAAPFSLVAKDLSDVSLSQFAGKRKVLNIFPSIDTGVCAASVRKFNQLATGMENT
    VVLCISADLPFAQSRFCGAEGLSNVITLSTLRNPEFAKEYGVGIEEGALKGLTARAVLVVNENDEVVFSELVNEITHEPN
    YDAALDALKA

    >gi|260598120|ref|YP_003210691.1| hypothetical protein Ctu_23280 [Cronobacter turicensis z3032]
    MEQRRLTGKSHWYHETQSSLCPADPLPLVPEAAKVEDRFLLDLPLDDVNIAAHAPWCDAARALIPSLLPDKHDVTRLHTL
    SVYDRLSTALTVAQVCGVQRLCNHYAARLAPEPGPDSSRESNRRLTLLTQTARQLASSPTLIDSAARTQLEDAGLSVHDI
    VTFTQIIGFVGFQARAVALLQAQPGQPARWLPGIDMQQDAPASLFTAHEPRWQPDLPTLEMGWASAEQQAAYNAALDEPL
    LQPLLSLLAHDACALQGLAALLASLRGHEITPDAALVALVSARINGSVS
    CFDEAALRLRDAPGLADAARNGERALLAWSH
    NHQSARAIIQAMQMLTRAPARFGHAQLEPLTDAGFDAQTALRLLAWGSVCGWVNRLRLGLGVTTQPAAV

    >gi|260598205|ref|YP_003210776.1| protein ychn [Cronobacter turicensis z3032]
    MQKIVIIANGAAYGSESLFNSLRLAIALRDQPQAPALKLFLMSDAVTAGLRGQKPAEGYNVQQMLEILTAQNVPVKLCKT
    CADGRGVSALPLIEGVEIGTLVELAQWTLEADKVLTF

    >gi|260598258|ref|YP_003210829.1| disulfide bond formation protein b [Cronobacter turicensis z3032]
    MLRYLNQCSRGRGAWLLLALTAFALEMVALWFQHVMMLKPCVLCIYERCALFGVMGAGLVGAIAPKTPLRFVAMGIWIYS
    AWKGLMLAWEHTTIQLHPSPFVT
    CDFAARFPSWLPLDKWLPQVFVASGDCAERQWSFLTLEMPQWLVGIFAAYLLVALLV
    LIAQAFKPKKRDLFGRY

    >gi|260598436|ref|YP_003211007.1| inner membrane protein [Cronobacter turicensis z3032]
    MSWHDFKQQYLIRFWAPLPAVIAAGILSTYYFGITGTFWAVTGEFTRWGGQLLQLFGVHAETWGYYKLIHLEGTPLTRID
    GMMIIGMFGGCFAAALWANNVKLRMPQHRIRIIQAVAGGIIAGFGARLAMG
    CNLAAFFTGIPQFSLHAWFFALATAIGSW
    FGARFTLLPLFRIPVKMQKVSAAAPLTQKPDQAKRRFRIGMLVFAGMVGWALLTAMNAPKLGLAMLFGVGFGLLIERAQI
    CFTSAFRDMWITGRTHMAKAIIFGMAVSAIGIFSYVQLGAEPKIMWAGPNAVLGGLLFGFGIVLAGG
    CETGWMYRAVEGQ
    VHYWWVGLGNVIGSTVLAYFWDDLAPSLATNWDKINLLNTFGPLGGLLVTYLLLFAALMLVIAQEKRFFRRQKPATTVAA
    VKEGA

    >gi|260598662|ref|YP_003211233.1| regulatory protein ada [Cronobacter turicensis z3032]
    MNVTDFTSDHARWEAVENRDPRADNAFVFAVVTTGIFCRPSCRARRPLRENVRFYPDAAAAGAAGFRPCKRCQPAGLTPQ
    AQKAQRIAAACRLMEHSDAPLTLATLAESAAMSPYHFHREFKALTGMTPKAWQNARRAQKLQAALRGGMSVTDSLWEAGF
    SSGSALYRDADRALGMSPRQYRRGGEKIAIRYAIAPCEAGLCLVAASDRGLCAVLLADDAAALEAELATIFPHAERLAPD
    ATFSAQVAQVTAWLDAPQGELALPLDLRGTAFQLRVWQALQAVPPGSTISYQTLAERTGNPQAVRAVASACAANKLAIVV
    P
    CHRVVRRDGALSGYRWGADRKARLLAREREQEK

    >gi|260598761|ref|YP_003211332.1| thiol:disulfide interchange protein dsbe [Cronobacter turicensis z3032]
    MFWQLTRNAAGDDPSLLESTLVGKPLPAFRLAALDDPSVTYDRAALVNGKPLLLNVWATWCPTCRAEHQFLNGLAAKGVR
    IVGLNYKDDRAKAVAWLNTLGNPYALSLFDGSGMLGLDLGVYGAPETFVIDGRGVIRYRHAGDLNDQVWRQDVKPLWDAL
    NQEVEP

    >gi|260598857|ref|YP_003211428.1| hypothetical protein Ctu_30650 [Cronobacter turicensis z3032]
    MMVVMYGIKNCDTIKKARRWLENNHIDYQFHDYRTDGLDAQMMHKFITELGWEALLNTRGTTWRKLDEAQRAAITDADRA
    AALMLEMPAIIKRPLLCAPGKPMLLGFSESTYQHYFNEV

    >gi|260598867|ref|YP_003211438.1| thioredoxin-dependent thiol peroxidase [Cronobacter turicensis z3032]
    MNPLKAGDIAPKFSLPDQDGEQVNLTDFQGQRVLVYFYPKAMTPGCTVQACGLRDNMDDLKKAGVEVLGISTDKPEKLSR
    FAEKELLNFTLLSDENHQVSDQFGVWGEKSFMGKTYDGIHRISFLIDAEGKIEHVFNDFKTSNHHDVVMAWLKEHA

    >gi|260598870|ref|YP_003211441.1| hypothetical protein Ctu_30780 [Cronobacter turicensis z3032]
    MSRDVTIYHNPRCSKSRETLSLLTERGIEPDVVLYLETPPDAATIKTLLKQLGFSQARELMRTKEELYKTLDLADASLSE
    EALIQAMVANPKLIERPIVVSDGKARLGRPPEQVLDIL

    >gi|260598910|ref|YP_003211481.1| 3-mercaptopyruvate sulfurtransferase [Cronobacter turicensis z3032]
    MSTSYFVASHWLAEHIDDPEIQILDARMAPAGQEHLRNMAEEYRAGHLPGARFFDIEALSDHSTSLPHMMPRPEAFAVAM
    RELGVSHDKHLIVYDEGNLFSAPRAWWMLRAFGVQNVSILAGGLAEWQRDGLPLEEGMVDAPEGDFEAKFDDGLVKRLTD
    VLLASHEKTAQIVDARPAARFNAEADEPRPGLRRGHIPGALNVPWTDLVVKGQLKTTDELRELFAAQGVDLHRPIIAS
    CG
    SGVTAAVVMLALATLEANDVKLYDGSWSEWGARDDLPIEPAP

    >gi|260598920|ref|YP_003211491.1| iron-sulfur cluster assembly protein [Cronobacter turicensis z3032]
    MSITLSDTAAARVNAFLANRGKGFGLRLGVRTSGCSGMAYVLEFVDAPLPEDTVFEDKGVKVVVDGKSLQFLNGTQLDFV
    KEGLNEGFKFTNPNVKDECGCGESFNV

    >gi|260598963|ref|YP_003211534.1| thioredoxin 2 [Cronobacter turicensis z3032]
    MFPHRFLSPATQRLAMNTVCAACQTVNRVDEERIEDGAKCGRCGHALFDGDVINATSETLDQLLKDDLPVVIDFWAPWCG
    P
    CRSFAPIFEDVAEERNGKMRFVKVNTEAEPELSARFRIRSIPTIMMFKNGQLVDMLNGAVPKAPFDTWLNEATNEAV

    >gi|260599068|ref|YP_003211639.1| glutaredoxin-like protein [Cronobacter turicensis z3032]
    MYTRNDCVQCHATKRALESRGIAFDTINLDEQPEAIDTLRAQGFRQLPVVMTDALSWSGFRPDMINRLRADSLAANA

    >gi|260599233|ref|YP_003211804.1| thiol:disulfide interchange protein dsbc [Cronobacter turicensis z3032]
    MKKTIALLSVTLAAFSGFAQADDAAIKRSLTKLGVANAEIQPSPLAGMKTVLTESGVIYVTEDGKHIIQGPLYDVSGGQP
    VNVTNQMLMTKLNALEKEMIVYKAPQEKHVITVFTDIT
    CGYCHKLHEEMKDYNALGITVRYLAFPRQGPRSEPAKDMQAI
    WCAKDRNKAFDNAMGGGKVAAASCDVDTAKHYELGVQFGVQGTPAIVLSNGAMVPGYQGPKEMKAFLDEHQKQLQASGK

    >gi|260599398|ref|YP_003211969.1| glutaredoxin 2 [Cronobacter turicensis z3032]
    MKLHIYEHCPFCVRALMIVGLKKLPVEISVIMEGDAETPTRMVGRKVVPILEKDDGTYMPESMDIVRYVDGLAPPRVTDA
    PVDEAIKQWCESVSTPLFNLAIPRFTEGDFAELATTEARRAYTAREERAFGDLAALRAQTPALLAQVNAQLNALEPLVAG
    RRAIDTTDFILFPLLRSLTIVKGAAFGPQVSAYIERVSTQTQVALLSAQAK

    >gi|260599441|ref|YP_003212012.1| methionine sulfoxide reductase a [Cronobacter turicensis z3032]
    MSFFDKKQMITEEEALPGRNTRMPVAALHTVTGHSMTNVPEGMEVALFAMGCFWGVERLFWPLPGVYSTAAGYTGGYTPN
    PTYREVCSGQTGHAEAVRVVYDPKVISYEQLLQVFWENHDPAQGMRQGNDVGTQYRSAIYPLTPEQEAAAQASLDRFRAA
    MEAAGDYRHITTEIAPAKPFYYAEDDHQQYLHKNPYGYCGIGGIGVCLPPEA

    >gi|260599512|ref|YP_003212083.1| thiol:disulfide interchange protein precursor [Cronobacter turicensis z3032]
    MAQRILTLILLFCSAQAPASLFGQQNASQFVPADQAFAFDFQQQQNQLTLNWQIKPGYYLYRQQIHVTPANASVSPPALP
    TGEPHEDEFFGKSEIYRDALSVPITVEQASPGATLTVTYQGCAAAGFCYPPETRTVPLSAVEQKNSVKPEAAQPSPTTDE
    QTSDSGDAPTATLPFSALWALLIGIGVAFTPCVLPMYPLISGIVLGGEKRLSTRRALLLAFIYVQGMALTYTALGLIVAA
    AGLQFQAALQSPWVLVALSVVFILLALSMFGLFTLQLPASLQTRLTLMSNRQRGGSPGGVFAMGAIAGLICSPCTTAPLS
    AILLYIAQSGNLWLGGGTLYLYALGMGLPLILVTVFGNRLLPKSGPWMEQVKTAFGFVILALPVFLLERIVGEPWGLRLW
    SALGIAFFGWAFIVSLNASKPWMRTVQIVFLGAALICARPLQDWAFGAPTAGSQAHLAFTRIATVDDLDRALAQAKGKPV
    MLDLYADW
    CVACKEFEKYTFSAPDVQRALDGTVLLQADVTANSAADVALLKRLNVLGLPTIIFFDAQGNEIPNGRVTGFM
    DAPAFATHLHNRLR

    >gi|260599651|ref|YP_003212222.1| sulfur transfer complex subunit tusd [Cronobacter turicensis z3032]
    MRFALMVTGPAYGTQQASSALQFAKALLAESHSLESVFFYREGVYNANQFTSPASDEFDLVRAWQQLHDENGVALHICVA
    AALRRGVTDENEARTQGLPGANLQPGFQLSGLGALAEAALTCDRVVEF

    >gi|260599725|ref|YP_003212296.1| thiosulfate sulfurtransferase [Cronobacter turicensis z3032]
    MDQFECINVEEAHQKLQQGGAVLVDIRDPQSYAMGHAPGAFHLTNATLPAFMQQTDFDVPVLVMCYHGNSSKGAAQYLLH
    QGFDQVYSVDGGFDAWHRHFPAEVAHAES

    >gi|260599770|ref|YP_003212341.1| zinc/cadmium/mercury/lead-transporting atpase [Cronobacter turicensis z3032]
    MRKLSLPEDAMRTPSEKPHATPQFAKMTLTPAPQKPAISAAPCCESGDGETSPAIETTGALSWQVAGMDCAACARKVENA
    VRQVPEVRQVQVLFATEKLVVDAPASQREAIEEAVRAAGYTLRDAHAPAPAATSGLRDNLPIIVIAVFMALSWALEQFHP
    LAGRIAFTLTTLVGLFPVARQAWRLIRSGNPFAIETLMSVAAIGALIIGASEEAAMVLLLFLVGERLEGWAANRARSGVS
    ALVALRPETAARLRGDARETVAISALQPGDVIEVAAGGRLPADGKLLAAAASFDESALTGESLPVERQPGEKVPAGATSV
    DRLVSLEVTSRPGDSAIDRILHLIEEAESKRAPIERFIDRFSRVYTPVIMAAALLTALIPPLLFAAPWLPWIYKALALLL
    IGCPCALVISTPAAITSGLAAATRFGALIKGGAALEALGRVEQIAFDKTGTLTAGTPQVTAIDPVDGLEADALLAYAAAV
    EQGSTHPLAQAVVREANARGVATLRAGAQRTLAGAGVEAQVEGRLLRISAPDKVTIALPPHWQARIREQEAQGQTVIVVT
    ASDQLLGTLALRDTQRADARDAVEKLRALGVGSVMLTGDNPRAAAAIAGELGMDYRAGLLPADKVTAVNELNARAPLAVV
    GDGINDAPAMKAATIGIAMGSGTDVALEAADAALTHNRLAALPEMIALARATHRNIRQNITIALGLKAVFLVTTLLGLTG
    LWLAVLADTGATVLVTANALRLLRKRG

    >gi|260599808|ref|YP_003212379.1| glutathione reductase [Cronobacter turicensis z3032]
    MTRHYDYLAIGGGSGGIASVNRAAMYGQKCALIEAKALGGTCVNVGCVPKKIMWHAAQIAEAIHLYGPDYGFDTTVNHFD
    WQKLVASRTAYIDRIHTSYDNVLGKNNVDVIQGYARFVDAHTVEVNGERITADHILIATGGRPSHPDIPGAEYGIDSDGF
    FALSAMPQRVAVVGAGYIAVELAGVINALGAKTHLFVRKHAPLRTFDPMLSETLVEVMQAEGPQLHTHATPKAVEKNSDG
    SLTLRLEDGRSETVDALIWAIGREPETDNFNLAATGVKTNEKGYIVVDKYQNTNVPGIYAVGDNTGAVELTPVAVAAGRR
    LSERLFNNKPDEHLDYNNIPTVVFSHPPIGTVGLTEPQAREQYGDAEVKIYKSSFTAMYTAVTTHRQPCRMKLVCVGPEE
    KIVGIHGIGFGMDEMLQGFAVALKMGATKKDFDNTVAIHPTAAEEFVTMR

    >gi|260599841|ref|YP_003212412.1| hypothetical protein Ctu_40490 [Cronobacter turicensis z3032]
    MSLEKVVYRAKAKATGGRDGRATSDDGVLDVKLGVPKEMGGQGGQVTNPEQLFAAGYSACFLGALKHVASQEKKKVPQEA
    FIEGQVGIGPLPTGFGIEAQLDIHLPGMDRAEAEELVQKAHIV
    CPYSNATRGNIDVKLNVITD

    >gi|260599911|ref|YP_003212482.1| glutaredoxin 3 [Cronobacter turicensis z3032]
    MANIEMYTKATCPYCHRAKALLNSKGAAFLELPIDGDTAKREEMIQRSGRTTVPQIFIDGQHIGGCDDLHALDARGGLDP
    LLG

    >gi|260599986|ref|YP_003212557.1| periplasmic protein disulfide isomerase i [Cronobacter turicensis z3032]
    MMKKIWLALAGMVMAFSVSAADYADGKQYNTLEKPVAGAPQVMEFFSFYCPHCYQFEEVLHISDGVKKKLPAGTKMTKYH
    VEFLGPLGKDLTQAWAVAMAMGIEDKITAPMFEAVQKTQTVQTPADIRKVFIDAGVKPEEYDAAWNSFVVKSLVAQQEKA
    AADVGLQGVPAMYVNGKYQLNPQGMDTSNMDVFVQQYADTVNYLLGKK

    >gi|260424411|ref|YP_003212612.1| hypothetical protein Ctu_1p00360 [Cronobacter turicensis z3032]
    MNQTPDQSYQETIKALPALQPITFKAAHETHQVLVFIDNQCVYCTNVVKNINTYTDAGLTMSFLTIAPGSIRDSVIADMA
    RVWCATDKQKSLKNAMVGFLPDNDATPECENLIKAQSAFAIKNGVEVTPTMVVLDNPPQVFLGSLTAETILARLSAPSQK


    >gi|260424424|ref|YP_003212625.1| Arsenate reductase [Cronobacter turicensis z3032]
    MTPITIYHNPACGTSRNTLGLIRNSGVEPTIILYLDTPPTRDELKTLITEMGISVRALLRKNVEPYQALGLDDEKISDAQ
    LLDAMLAHPILINRPIVVTPLGTRLCRPSEAVLALLPDPQQGPFTKEDGEIVIPPAP

    >gi|260424430|ref|YP_003212631.1| Thiol:disulfide interchange protein dsbG [Cronobacter turicensis z3032]
    MKKMLMTGALLAAFHAQAQTDDLPEPVKQMEKQGITIIKPFSAPGGVQAWLGKYQDTGVTLYLTPDKKHVIAGYMYDEKG
    NNLSEKLFNDELYIPAGREMWKALDQAKGIKEGSDQAACKVVVFADPF
    CPYCHKFWEQAQPHLKDKSISLKTLLVGVIRP
    DSGRYAAAVLASDDPQKTWQALESSAGKTKPALPEKTSPAAFKQIQYNQQLMAQLGANGTPAIYYLNKDKLLQQIVGLPD
    PEQMADLVACK

    >gi|260600019|ref|YP_003212757.1| hypothetical protein Ctu_3p00130 [Cronobacter turicensis z3032]
    MAALGAAFSLFAGTAAAVPAQAFTPEQEASPEKTGADNKLDEAKFKAMIRQKLQLPEQKNPVPVVMANQEALLHDADTPA
    YGPEKAKVAVIEFLDYQ
    CLYCYKMTWEIEKVMKTNPEVRFVFKAWTIYAGKWPSSEQAAQRGLAVWKAKGEQAYMTYHNR
    LFNTMHMNGELTTEDIDNAAMAGGFVANSIPDNSAALSRNDALAKQLGLIGAPALIIMPVTGATPDNITVLEGGETAEEI
    QLAIRKAEQTSQ

    >gi|260600047|ref|YP_003212785.1| arsenate reductase [Cronobacter turicensis z3032]
    MSNITIYHNPACGTSRNTLEMIRNSGNEPTVIHYLENPPSRDELVKLIADMGISVRALLRKNVEPYEELGLAEDKFTDDQ
    LIDFMLQHPILINRPIVVTPLGTRLCRPSEVVLDILPDAQKGAFAKEDGEKVVDEAGKRLK

    >gi|260597480|ref|YP_003210051.1| NADH dehydrogenase [Cronobacter turicensis z3032]
    MTTPLRKIVIVGGGAGGLELATQLGHKLGRGKKAKVTLVDRNHSHLWKPLLHEVATGSLDEGVDALSYLAHARNHGFQFQ
    LGSVVDINREAKTLTLAELRDEKGELLVAERKVPYDTLVMALGSTSNDFNTPGVKDH
    CIFLDNPHQARRFHQEMLNLFLK
    YSANLGANGKVNIAIVGGGATGVELSAELHNAVKQLHSYGYKGLTNEALNVTLVEAGERILPALPPRISSAAHNELTKLG
    VRVLTNTMVTSAQEDGLNTKDGEFIQADLMVWAAGIKAPDFMKEIGGLETNRINQLVVEQTLQTTRDPDIFAIGDCASCP
    RPEGGFVPPRAQAAHQMASCALDNILAQIKGKPLKPYVYKDKGSLVSLSKFSTVGSLMGNLMRGSMMIEGRIARFVYISL
    YRMHQIALHGYFKTGLMMLVGSINRVIRPRLKLH