Cronobacter sakazakii ATCC BAA 894 uid58145

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|156932372|ref|YP_001436288.1| thiol:disulfide interchange protein precursor [Cronobacter sakazakii ATCC BAA-894]
    MAHRILTLILLFCSAHASASLFGQQNASQFVPADQAFAFDFQQQQHQLTLNWQIKPGYYLYRQQIRVTPANASVAPPALP
    TGEPHEDEFFGKSEIYRDALSVPVTVEQAAPGATLSVTYQGCAEAGFCYPPETRTVPLSAVEPTESVKANAATPSAATGE
    QTRVNSDSPSATLPFSAFWALLIGIGVAFTPCVLPMYPLISGIVLGGDKRLSTRRALLLAFIYVQGMALTYTALGLVVAA
    AGLQFQAALQSPWVLVTLSAVFVLLALSMFGLFTLQLPASLQTRLTLMSNRQRGGSPGGVFAMGAIAGLICSPCTTAPLS
    AILLYIAQSGNLWLGGGTLYLYALGMGLPLILVTVFGNRLLPKSGPWMEQVKTAFGFVILALPVFLLERVLGEPWGVRLW
    SVLGVAFFGWAFVTSLNATRSWMRAVQIVLLGAAMICARPLQDWVFGAPVAESQAHLAFTRIATVDDLDRALAQAKGKPV
    MLDLYADW
    CVACKEFEKYTFSAPEVQRALDGAVLLQADVTANSAADVALLKRLNVLGLPTIIFFDAQGNEIPNGRVTGFM
    DAPAFATHLHNRLR

    >gi|156932446|ref|YP_001436362.1| methionine sulfoxide reductase A [Cronobacter sakazakii ATCC BAA-894]
    MSFFDKKQMITEEEALPGRNTRMPVAALHTVTGHSMTNVPEGMEVALFAMGCFWGVERLFWALPGVYSTAAGYTGGYTPN
    PTYREVCSGQTGHAEAVRVVYDPNVISYEQLLQVFWENHDPAQGMRQGNDVGTQYRSAIYPLTPEQEAAAQASLERFRAA
    MEAAGDYRHITTEIAPAKPFYYAEDEHQQYLHKNPYGYCGIGGIGVCLPPEA

    >gi|156932488|ref|YP_001436404.1| glutaredoxin 2 [Cronobacter sakazakii ATCC BAA-894]
    MENCMKLHIYEHCPFCVRALMIFGLKKLPVEVCVIMEGDADTPIRMVGRKVVPILEKDDGTYMPESMDIVRYVDGLAQPR
    VADAPVDEAIKQWCESVSTPLFNLAIPRFTEGDFAELATPQARRAYTAREEKAFGDLAALRAQTPALLAQVNSDLNALEP
    LVAGRQAIDTTDFILFPLLRSLTIVKGAAFGPQVSAYIERVSAQTGVALLSAQAK

    >gi|156932655|ref|YP_001436571.1| thiol:disulfide interchange protein DsbC [Cronobacter sakazakii ATCC BAA-894]
    MKKTIALLSVTLAAFSGFAQADDAAIKQSLTKLGVANAEIQPSPLAGMKTVLTESGVIYVTEDGKHIIQGPLYDVSGGQP
    VNVTNQMLMTKLNALEKEMIVYKAPQEKHVITVFTDIT
    CGYCHKLHEEMKDYNALGITVRYLAFPRQGPRSETAKDMQAI
    WCAKDRNKAFDNAMSGGKVEAASCDVDTAKHYELGVQFGVQGTPAIVLSNGAMVPGYQGPKEMKAFLDEHQKQLQASGK

    >gi|156932798|ref|YP_001436713.1| glutaredoxin-like protein [Cronobacter sakazakii ATCC BAA-894]
    MRITIYTRNDCVQCHATKRALESRGIAFDTINLDEQPEAIDTLRAQGFRQLPVVMTDSLSWSGFRPDMINRLRADSLAAN
    A

    >gi|156932877|ref|YP_001436793.1| thioredoxin 2 [Cronobacter sakazakii ATCC BAA-894]
    MNTVCAACQTVNRVDEERIEDGAKCGRCGHALFDGDVINATSETLDQLLKDDLPVVIDFWAPWCGPCRSFAPIFEDVAEE
    RSGKIRFVKVNTEAEPELSARFRIRSIPTIMMFKNGQLVDMLNGAVPKAPFDTWLNEATNEAV

    >gi|156932921|ref|YP_001436837.1| iron-sulfur cluster assembly protein [Cronobacter sakazakii ATCC BAA-894]
    MSITLSDTAAARVNAFLANRGKGFGLRLGVRTSGCSGMAYVLEFVDAPQPEDTVFEDKGVKVVVDGKSLQFLNGTQLDFV
    KEGLNEGFKFTNPNVKDECGCGESFNV

    >gi|156932931|ref|YP_001436847.1| 3-mercaptopyruvate sulfurtransferase [Cronobacter sakazakii ATCC BAA-894]
    MSTSFFVASHWLAEHIDDPEIQILDARMAPAGQEHLRNMAQEYRAGHLPGARFFDIEALSDHSTPLPHMMPRPEAFAVAM
    RELGVSHDKHLIVYDEGNLFSAPRAWWMLRAFGVQNVSILAGGLAEWQRDGFPLEEGMVDAPEGDFEAKFDDGLVKRLTD
    VLLASHEKTAQLVDARPAARFNAEADEPRPGLRRGHIPGALNVPWTDLVVKGQLKTTDELREIFADQGVDLHRPIIAS
    CG
    SGVTAAVVMLALATLEASDVKLYDGSWSEWGARDDLPIEPAS

    >gi|156932963|ref|YP_001436879.1| hypothetical protein ESA_00766 [Cronobacter sakazakii ATCC BAA-894]
    MSRDVTIYHNPRCSKSRETLSLLTERGIEPDVVLYLETPPDAATIKTLLNQLGFSQARELMRTKEDLYKTLNLADPSLSE
    EALIQAMVDNPKLIERPIVISHGKARLGRPPEQVLEIL

    >gi|156932966|ref|YP_001436882.1| thioredoxin-dependent thiol peroxidase [Cronobacter sakazakii ATCC BAA-894]
    MMNPLKAGDIAPKFSLPDQDGEQVNLTDFQGQRVLVYFYPKAMTPGCTVQACGLRDNMDDLKKAGVEVLGISTDKPEKLS
    RFAEKELLNFTLLSDEDHQVSDQFGVWGEKSFMGKTYDGIHRISFLIDAEGKIEHVFNDFKTSNHHDVVLAWLKEHA

    >gi|156932976|ref|YP_001436892.1| hypothetical protein ESA_00779 [Cronobacter sakazakii ATCC BAA-894]
    MVVMYGIKNCDTIKKARRWLENNHVDYQFHDYRTDGLDAQMMHKFIAELGWEALLNTRGTTWRKLDEAQRAAITDADSAA
    ALMLEMPAIIKRPLLCAPGKPMLLGFSESTYQHYFNEV

    >gi|156933065|ref|YP_001436981.1| hypothetical protein ESA_00875 [Cronobacter sakazakii ATCC BAA-894]
    MRRRILLLPLALFLLLAAVLFWQLTRNAAGDDPSQLESTLVGKPLPAFRLAALDDPNVTYDRAALLNGKPLLLNVWATWC
    PTCRAEHQFLNGLAAKGVRIVGLNYKDDRAKAVAWLNTLGNPYALSLFDGSGMLGLDLGVYGAPETFVIDGRGVIRYRHA
    GDLNDEVWRQDVKPLWDALNQEVEP

    >gi|156933165|ref|YP_001437081.1| hypothetical protein ESA_00976 [Cronobacter sakazakii ATCC BAA-894]
    MNVADFTSEHARWQAVESRDARADNAFVFAVVTTGIFCRPSCRARRPLRENVRFYEDANAASAAGFRPCKRCQPAGLTPQ
    AQKAQRIAAACRLMEQSDTPLTLAALAESAAMSPYHFHREFKAITGMTPKAWQNALRAQKLQAALRGGMSVTDSLWEAGF
    SSGSALYRDANRALGMRPRQYRRGGEQTAIRYAIAPCEAGLCLVATSDRGLCAVLLADDAAALEAELATIFPHAERLAPD
    NTFRAQVAQVIAWLDAPQGELALPLDLRGTAFQLRVWQALQSVPPGSTISYQALAERTGNPQAVRAVASACAANKLAIVV
    P
    CHRVVRRDGALSGYRWGADRKARLLAREREQEK

    >gi|156933465|ref|YP_001437381.1| putative inner membrane protein [Cronobacter sakazakii ATCC BAA-894]
    MSWHDFKQQYLVRFWAPLPAVIAAGILSTYYFGITGTFWAVTGEFTRWGGQLLQLFGVHAENWGYYKLIHLEGTPLTRID
    GMMIIGMFGGCFAAALWANNVKLRMPQHRIRIIQAVAGGIIAGFGARLAMG
    CNLAAFFTGIPQFSLHAWFFALATAIGSW
    FGARFTLLPLFRIPVKMQKVSAAAPLTQKPDQAKRRFRIGMLVFAGMIGWALLTAMNAPKLGLAMLFGVGFGLLIERAQI
    CFTSAFRDMWITGRTHMAKAIIFGMAASAIGIFSYVQLGAEPKIMWAGPNAVLGGLLFGFGIVLAGG
    CETGWMYRAVEGQ
    VHYWWVGLGNVIGSTVLAYFWDDLAPSLATSWDKINLLNTFGPLGGLLVTYLLLFAALMLVIAQEKRFFRRQKPAATAAA
    IKEGA

    >gi|156933642|ref|YP_001437558.1| disulfide bond formation protein B [Cronobacter sakazakii ATCC BAA-894]
    MASGVKPVFVYTAGSTQIAEIIIMLRYLNQCSRGRGAWLLLALTAFALEMVALWFQHVMMLKPCVLCIYERCALFGVMGA
    GLVGAIAPKTPLRFVAMGIWIYSAWKGLMLAIEHTNIQLHPSPFVT
    CDFAARFPSWLPLDKWLPQVFVASGDCAERQWSF
    LTLEMPQWLIGIFAAYLVVALLVLLAQAFKPKKRDLFGRY

    >gi|156933686|ref|YP_001437602.1| hypothetical protein ESA_01508 [Cronobacter sakazakii ATCC BAA-894]
    MAKEFRMQKIVIIANGAAYGSESLFNSLRLAIALRDQPQAPELKLFLMSDAVTAGLRGQKPAEGYNVQQMLEILTAQNVP
    VRL
    CKTCADGRGVSALPLIDGVEIGTLVELAGWTLEADKVLTF

    >gi|156933829|ref|YP_001437745.1| thiol peroxidase [Cronobacter sakazakii ATCC BAA-894]
    MSQIVYFQGNPVSVVGQIPQAGSKAAPFSLVAKDLSDVSLSQFAGKRKVLNIFPSIDTGVCAASVRKFNQLATGMENTVV
    LCVSADLPFAQSRFCGAEGLSNVITLSTLRNPEFAKEYGVGIEEGALKGLTARAVLVLNENDEIVFSELVNEITHEPNYD
    AALNALKA

    >gi|156934042|ref|YP_001437958.1| hypothetical protein ESA_01868 [Cronobacter sakazakii ATCC BAA-894]
    MHTTPADGHSLTKECIMSRLQTIATETATGKTAQLFDTLKSAMGKVPNAYATIGSNAPDILSQALQHNMALKKGALSARE
    LEAINLLVSETTGCDY
    CLAAHTLMAKKAGYSADDTRALRAGRFAQDAHIDALLRFVKTVITTRGTLPESDVTALRAAGFD
    DRQVIEILSAISAILFTNMVNRVNDTVVDFPKAE

    >gi|156934123|ref|YP_001438039.1| hypothetical protein ESA_01949 [Cronobacter sakazakii ATCC BAA-894]
    MTRSSDLLDTLADIAPGSPLALARATRDAATLNIARSREALFNGASDLTRAERLHLAREVARWHEDEALSAHYSALLQDE
    PAPPARLSVALGHAEILTFHPVQATAQEIAALTEAGFSEEAIVTLAQVVAFVSFESRLLRGYRLINGGRVPGETAIPPAG
    RWHTAPTTQSGQPAPTAFTQDELGWEPWLAPKPFAAFSPDEQETLRRFGHQDSGYFRLLARNLPALEARTLTDKGIFYTP
    GGLARAERELAAAVASKVNGCIY
    CASVHARKASQLSKDNDAVQRLLEVTPGGSLSAGQSARWQAIIDFSAALSATPATAG
    AAHVAALREQALTDLELLDLVQATAFFAWANRLMLTLGEPFIPA

    >gi|156934127|ref|YP_001438043.1| O-6-alkylguanine-DNA:cysteine-protein methyltransferase [Cronobacter sakazakii ATCC BAA-894]
    MLTLLEDKIETPLGPLWVIADEQSRLRAVEWEEHSDRMEQLLAIHYRQEGFRRVGCVNPGGLSDALRAWFAGDLAVIDSL
    PTATAGTPFQREVWQMLRTIPCGQVMHYGEMAERLGRPGAARAVGAANGSNPISIVVP
    CHRVIGRNGTLTGYAGGVARKE
    WLLRHEGYLLI

    >gi|156934159|ref|YP_001438075.1| hypothetical protein ESA_01986 [Cronobacter sakazakii ATCC BAA-894]
    MTDYLLLFVGTVLVNNFVLVKFLGLCPFMGVSKKLESAIGMGMATTFVMTLATIFSWIIDHLILVPLELVYLRTMAFILV
    IAVVVQFTEMVVRKTSPALYRLLGIYLPLITTN
    CAVLGVALLSINLNHTFMQSALYGFSAAVGFSLVMVLFAAIRERLVV
    ADVPLPFRGNAIALVTAGLMSLAFMGFSGLVKF

    >gi|156934164|ref|YP_001438080.1| electron transport complex RsxE subunit [Cronobacter sakazakii ATCC BAA-894]
    MNDVKSILVNGLWKNNSALVQLLGMCPLLAVTSTATNALGLGLATTLVLTLTNASISAFRRWMPGEIRIPIYVMIIAAVV
    SIVQMLINAYAFGLYQSLGIFIPLIVTN
    CIVVGRAEAFAAKNGPLLSALDGFAIGLGATGAMFVLGSLREILGNGTLFDG
    ADGLLGSWARVLRIEVFHTDTPFLLAMLPPGAFIGLGMMLAVKYLIDERMKRRAAKPVVVEAAAEKAS

    >gi|156934167|ref|YP_001438083.1| glutathionine S-transferase [Cronobacter sakazakii ATCC BAA-894]
    MKLFYKAGACSLSPHIILREANIDFTLVAVDLAAKRTETGEDYLTINPKGQVPALLLDDNTLLTEGVAIVQYIADLVPDR
    QLLAPVGSMTRYHTLEWLNYIATELHKGFTPLFRPDTPDEYKTIARAQLQKKFAYVNEALAQKQWLMGLRFSVADAYLFT
    VLNWAKAVGLEMQVFDNIADYHARVKARPAVAAALKAEGLSA

    >gi|156934186|ref|YP_001438102.1| hypothetical protein ESA_02013 [Cronobacter sakazakii ATCC BAA-894]
    MSTTLEKIQRQIAENPILLYMKGSPKLPSCGFSAQAVQALSACGERFAYVDILQNPDIRAELPKYANWPTFPQLWVDGEL
    VGGCDIVIEMYQRGELQTLIKETAAKYNSATPDAE

    >gi|156934264|ref|YP_001438180.1| iron-sulfur cluster assembly scaffold protein [Cronobacter sakazakii ATCC BAA-894]
    MESQTGTFNPAEFNWQGLTMTPDAARHIRDLMAQKPGLLGVRLSVKQSGCAGFGYVLDTVSEPKDEDLVFETDGARLYVP
    LQAMPFIDGTEVDYVREGLNQIFKFNNPKAQHACGCGESFGVQAE

    >gi|156934274|ref|YP_001438190.1| hypothetical protein ESA_02105 [Cronobacter sakazakii ATCC BAA-894]
    MSQHPRFIATWRDELPGFYTELTPTPLNNSRLLCHNAPLAQALELPETLFDYQGPAGVWGGETLLPGMAPLAQVYSGHQF
    GVWAGQLGDGRGILLGEQQLSDGCKLDWHLKGAGLTPYSRMGDGRAVLRSTVREFLASEAMHGLGIPTTRALTIVTSDTP
    VRRETTERGAMLMRIAESHVRFGHFEHFYYRREPERVRELAQYVIEHHFAHLAQEEDRFALWFGEVVTRTAQLMASWQCV
    GFAHGVMNTDNMSILGLTMDYGPYGFLDDYQPGFICNHTDYQGRYAFDNQPGVGLWNLQRLAQALSPIIPAERLNALLDD
    YQPALLREWGRQMRAKLGFTVEKEGDNDYLRELLTLMAREGSDYTRTFRMLSETEQHSSASPLRDEFIDRATFDAWFARY
    RARLEEEGEEDDARQRLMKSVNPALVLRNWLAQRAIEAAERDDASELSRLLEALRNPFADRDDDYTHRPPDWGKHLEVS
    C
    SS

    >gi|156934281|ref|YP_001438197.1| putative glutathione peroxidase [Cronobacter sakazakii ATCC BAA-894]
    MQHDILNTEVTTIDGETISLEQYKGKVLLIVNVASKCGLTPQYEQLENIHKAWEPSGFRVLGFPCNQFLGQEPGSEDEIK
    TFCSTTYGVTFPMFSKIDVNGDNRHPLYQKLIAAAPKAVAPEQSGFYERMASKGRAPLYPDDILWNFEKFLVGRDGQVIQ
    RFSPDMTPEDPIVMEAIKLALAK

    >gi|156934331|ref|YP_001438247.1| selenophosphate synthetase [Cronobacter sakazakii ATCC BAA-894]
    MSEQAIRLTQYSHGAGCGCKISPKVLETILHSDQAKFIDPNLLVGNETRDDAAVYDLGNGTSVISTTDFFMPIVDNPFDF
    GRIAATNAISDIYAMGGKPIMAIAILGWPVNTLAPEIAREVVEGGRFACQQAGIALAGGHSIDAPEPIFGLAVTGVVPTE
    RVKKNSTAEAGCKLFLTKPLGIGVLTTAEKKSLLRPEHQNLATEVMCTMNKAGADFAEIDGVRAMTDVTGFGLLGHLSEV
    CQGAGLQAELWYEAVPKLPGVEEYIAQGAVPGGTSRNFASYGHLMGDMPDAWRSLLCDPQTSGGLLLAVEPAAEAQVQAV
    AAKHGITLSAIGELKTARGGRPMVEIR

    >gi|156934338|ref|YP_001438254.1| methionine sulfoxide reductase B [Cronobacter sakazakii ATCC BAA-894]
    MANQNSQDDLKNTLTEMQFYVTQNHGTEPPYTGRLLHNKRDGVYHCLVCDAPLFNSETKYDSGCGWPSFYEPVSEDSIRY
    LNDYSHGMQRIEIRCGNCDAHLGHVFPDGPQPTGERY
    CVNSASLSFTDDDNGEQIKG

    >gi|156934461|ref|YP_001438377.1| hypothetical protein ESA_02292 [Cronobacter sakazakii ATCC BAA-894]
    MPVLHNRISNEELRARMLAETEPRTTISFYKYFTIDDPKATRDALWQAFTALNVFGRIYLAHEGINAQISVPESNVEAFR
    AALYGFHPALDGVRLNIALDDDGKSFWVLRMKVRDRIVADGIDDPTFDASDVGEYLKAAEVNAMLDDPDAVFIDMRNHYE
    YEVGHFENALEIPADTFRAQLPKAVEMMQEYKDKKIVMY
    CTGGIRCEKASAFMRHNGFQKVWHIEGGIIEYARKAREQGL
    PVRFVGKNFVFDERMGERISDDVIAHCHQCGAPCDSHTNCKNDGCHLLFIQCPACAEKFSGCCSELCKEEMSLPEEEQRR
    RRAGRENGNKIFNKSRGRLNTTLGIPDPE

    >gi|156934617|ref|YP_001438533.1| thioredoxin reductase [Cronobacter sakazakii ATCC BAA-894]
    MGTAKHSKLLILGSGPAGYTAAVYAARANLKPVLITGMEKGGQLTTTTEVENWPGDPHDLTGPLLMERMHEHAAKFETEI
    LFDHINKVDLQNRPFRLIGDSGEYTCDALIIATGASARYLGLPSEEAYKGRGVSA
    CATCDGFFYRNQKVAVIGGGNTAVE
    EALYLANIASEVHLIHRRDTFRAEKILVKRLMDKVESGNIVLHTHRTLEEVTGDQMGVSGLRLRDTVNPENVETLDVAGL
    FVAIGHSPNTAIFEGQLELENGYIKVQSGIHGNATQTSIPGVFAAGDVMDHIYRQAITSAGTGCMAALDAERYLDGLAEK
    QS

    >gi|156934675|ref|YP_001438591.1| molybdopterin biosynthesis protein MoeB [Cronobacter sakazakii ATCC BAA-894]
    MTEALSDAEMLRYNRQIILRDFDFDGQERLKAARVLVVGLGGLGCAAAPYLAAAGTGRLTLLDFDTVALSNLQRQVLHRD
    ATIGQPKVESAREALAAINPHCVIETVNAQLDDAALAALIARHDLVLDCTDNVATRNQLNAACFHHKVPLVSGAAIRMEG
    QISVFTWQPDAPCYRCLSRLFGENALT
    CVEAGVMAPLVGVIGSLQAMEAIKVLARYGEPCAGKLVIYDALRTQFREMKLA
    RNPHCEVCGDGR

    >gi|156934871|ref|YP_001438787.1| hypothetical protein ESA_02719 [Cronobacter sakazakii ATCC BAA-894]
    MLDTNMKTQLKAYLERLTKPVELVATLDDSAKSAEIKELLLEIAELSDKVSFREDNTLAARKPSFLITNPGSDQGPRFAG
    SPLGHEFTSLVLALLWTGGHPSKEAQALLEQIRDLDGDFEFETYYSLS
    CHNCPDVVQALNLMSVLNPRIKHTAIDGAVFQ
    NEITERNVMGVPAVFMNGVEFGSGRMTLAEIVAKVDTGAEKRAAEELNQRDAYDVLIVGSGPAGAAAAIYSARKGIRTGL
    MGERFGGQVLDTVDIENYISVPKTEGQKLAGALKAHVDDYDVDVIDTQSATKLIPAASEGGLHQIETASGAVLKARSVIV
    ATGAKWRNMGVPGEDQYRTKGVTY
    CPHCDGPLFKGKRVAVIGGGNSGVEAAIDLAGIVEHVTLLEFAPEMKADQVLQDKL
    RSLKNVDIILNAMTTEVKGDGTKLTGLDYQDRVTGSVKHLEVAGIFVQIGLLPNTTWLEGAVERNRMGEIIIDAKCETSV
    KGVFAAGDCTTVPYKQIIIATGEGAKASLSAFDYLIRTKTA

    >gi|156934873|ref|YP_001438788.1| alkyl hydroperoxide reductase subunit C [Cronobacter sakazakii ATCC BAA-894]
    MSLINTKIKPFKNMAFKNGEFIEVTEKNTEGRWSVFFFYPADFTFVCPTELGDVADHYEELQKLGVDVYSVSTDTHFTHK
    AWHSSSDTIAKIKYAMIGDPTGALTRNFEIMREDEGLADRGTFIVDPQGVIQAIEITAEGIGRDASDLLRKIKAAQYVAS
    HPGEVCPAKWKEGEATLAPSLDLVGKI

    >gi|156934925|ref|YP_001438841.1| hypothetical protein ESA_02774 [Cronobacter sakazakii ATCC BAA-894]
    MSEQNIINLSEANLHQILEQSMTVPVLFYFWSDRSQHCQQLTPVLEKLANQYQGQFILAKVDCDNEQAIAAQFGLRAIPT
    VYLFSQGQPVDGFQGPQPEEAIRALLDKVLPREEELKAQEAMALMQEGKHLEALPLLKEAWQMSNQASEIGLLLAQAQIA
    LNRSEDAEAVLKTIPLQDQDTRYQGLVAQIDLLKQAADTPEIQQLQQQVELHPDDAQLASQLALQLHQVGRNEEALELLF
    DHLKKDLNAADGQARKMLQEILAALGTGDALASKYRRQLYSLLY

    >gi|156934931|ref|YP_001438847.1| copper exporting ATPase [Cronobacter sakazakii ATCC BAA-894]
    MSNTIELALDGLSCGHCVKRVKESLEQRPDVERADVTIEHASVTTTAPADALIETVKQAGYDATLAHPKANPLTESSTPS
    EALTAAQPELPAADNADDDDSRQLLINGMS
    CASCVSRVQNALQGVAGVTQARVNLAERTALVMGHASAADLIAAVEKAGY
    GAEAIDDDAERRERQQQTAQAAMKRFRWQAALALAVGIPVMIWGMFGDNMMVTDANRSLWLVIGFITLGVMVFAGGHFYT
    SAWKSLRNRSATMDTLVALGTGAAWLYSMSVNLWPQHFPMEARHLYYEASAMIIGLINLGHMLEARARQRSSKALERLLD
    LTPPVARVVTPEGEKSVPLAEVTPGMTLRLTTGDRVPVDGDITDGEGWFDEAMLTGEPVPQQKAAGDAIHAGTVVQDGSV
    LFRAAAVGNHTTLSRIIRMVRQAQSSKPEIGKLADRISAVFVPVVVLIALFSGAVWYFAGPAPQIVYTLVIVTTVLIIAC
    PCALGLATPMSIISGVGRAAEFGVLVRDADALQRASDVDTLVFDKTGTLTEGKPQVAAIATTGDITEADALRLAAALEQG
    SSHPLARAIIERAGGADLPAVSGFRTLRGLGVSGEAQGKTLLLGNQALLEENGIPTDALRDEAQRQASLGATPVLLAVDG
    TLAALFAIRDPLREDSADALARLHREGYRLVMLTGDNAVTANAIAREAGIDEVIAGVLPDGKAQAIQKLQQAGRKVAMIG
    DGINDAPALAQAEVGIAMGGGSDVAIETAAITLMRHSLTGVADAMAISKATLGNMKQNLLGAFIYNALGIPVAAGVLWPL
    TGTLLNPVVAGAAMALSSITVVSNANRLLRFNPKK

    >gi|156935326|ref|YP_001439242.1| hypothetical protein ESA_03184 [Cronobacter sakazakii ATCC BAA-894]
    MSDDVALPLQFTDAAANKVKSLIADEDNPNLKLRVYITGGGCSGFQYGFTFDDQINDGDMTIEKQGVSLVVDPMSLQYLV
    GGAVDYTEGLEGSRFVVNNPNATSTCGCGSSFSI

    >gi|156935362|ref|YP_001439278.1| dihydrolipoamide dehydrogenase [Cronobacter sakazakii ATCC BAA-894]
    MMSTEIKTQVVVLGAGPAGYSAAFRCADLGLETVIVERYSTLGGVCLNVGCIPSKALLHVAKVIEEAKALAEHGIVFGEP
    KTDIDKIRTWKEKVINQLTGGLSGMAKGRKVKVVNGLGKFTGANTLEVEGENGKTVINFDNAIIAAGSRPIQLPFIPHED
    PRVWDSTDALELKEVPKRMLVMGGGIIGLEMGTVYHALGSEIDVVEMFDQVIPAADKDVVKVFTKRISKKFNLMLETKVT
    AVEAKEDGIYVSMEGKKAPAEAQRYDAVLVAIGRVPNGKNLDAGKAGVEVDDRGFIRVDKQMRTNVPHIYAIGDIVGQPM
    LAHKGVHEGHVAAEVIAGMKHYFDPKVIPSIAYTEPEVAWVGLTEKEAKEKGISYETATFPWAASGRAIASDCADGMTKL
    IFDKETHRVIGGAIVGTNGGELLGEIGLAIEMGCDAEDIALTIHAHPTLHESVGLAAEVFEGSITDLPNPKAKKK

    >gi|156935533|ref|YP_001439449.1| hypothetical protein ESA_03395 [Cronobacter sakazakii ATCC BAA-894]
    MSLENVIYRAKAKATGGRDGRATSSDGVLDVKLGVPKEMGGMGGDVTNPEQLFAAGYSACFLGAMKFVSARDKIAMPKDA
    FIEGEVGIGPLPTGFGIEAKLNIHLPGMDAAEAQKLVDAAHIV
    CPYSNATRGNIDVTLNIIA

    >gi|156935805|ref|YP_001439721.1| hypothetical protein ESA_03681 [Cronobacter sakazakii ATCC BAA-894]
    MNDADFMRYSRQLLLEDIAIDGQQKLLASRVLLVGLGGLGSPAALYLAGAGVGTLWLADDDAVHLSNLQRQILFNVSDIE
    QPKSRVAARRLQALNPAINSVALNKRLEGDTLREAVASVDLVLDCSDNMTTRQAINAACVALGTPLITASAVGMGGQIAT
    FTPPFDYGCYRCLWPDDSEPERN
    CRTAGVLGPVVGMMGTLQALEAIKLLCGITQEHDELCLFDARASQWRTLTLQRAADC
    PVCGGKHAH

    >gi|156935888|ref|YP_001439804.1| thioredoxin [Cronobacter sakazakii ATCC BAA-894]
    MSDKIIHLTDDSFDTDVLKADGLTLVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLL
    LFKNGEVAATKVGALSKGQLKEFLDANLA

    >gi|156935910|ref|YP_001439826.1| soluble pyridine nucleotide transhydrogenase [Cronobacter sakazakii ATCC BAA-894]
    MYKNKVSLTMPQTYDYDVIVIGSGPGGEGAAMGLVKQGATVAVIERYHNVGGGCTHWGTIPSKALRHAVSRIIEFNQNPL
    YSAHSRPLRSSFADILNHADNVINQQTNMRQGFYERNRCQILQGDARFIDEHTIELTCHDGSIETLTAEKFVIACGSRPY
    HPDDVDFTHSRIYDSDSILSMHHEPRHVIIYGAGVIGCEYASIFRGMNVKVDLINTRDRLLAFLDQEMSDSLSYHFWNSG
    VVIRHNEEYERIEGVDDGVIVHLKSGKKVKADCLLYANGRTGNTDSLALENIGLEADGRGLLKVNSMYQTALPHIYAVGD
    VIGYPSLASAAYDQGRIAAQALVQGVASAHLVEDIPTGIYTIPEISSVGKTEQQLTAMKVPYEVGRAQFKHLARAQIVGM
    NVGTLKILFHRETKEILGIHCFGERAAEIIHIGQAIMEQKGGGNTIEYFVNTTFNYPTMAEAYRVAALNGLNRLF

    >gi|156936086|ref|YP_001440002.1| hypothetical protein ESA_03980 [Cronobacter sakazakii ATCC BAA-894]
    MSNLEQLAYYQKKLSFEADSWDLYLALNAGENIVVVDGRSEEAYQREHIPGAINLPHKALCFNNTAELDKSKVYICYCDG
    IG
    CNGSTKTAMKLLTLGFQVKELIGGLDWWKRDGYATEGHQGRDGTPVSCGC

    >gi|156936140|ref|YP_001440056.1| periplasmic protein disulfide isomerase I [Cronobacter sakazakii ATCC BAA-894]
    MMKKIWLALAGMVMAFSVSAADYSDGKQYNTLEKPVAGAPQVMEFFSFYCPHCYQFEEVLHVSDSVKKKLPAGTKMTKYH
    VEFLGPLGKDLTQAWAVAMAMGIEDKITAPMFEAVQKTQTVQTPADIRKVFIDAGVKPEEYDAAWNSFVVKSLVAQQEKA
    AADVGLQGVPAMYVNGKYQLNPQGMDTSNMDVFVQQYADTVNYLLGKK

    >gi|156936218|ref|YP_001440134.1| glutaredoxin 3 [Cronobacter sakazakii ATCC BAA-894]
    MANIEMYTKATCPYCHRAKALLNSKGAAFLELPIDGDTAKREEMIQRSGRTTVPQIFIDGQHIGGCDDLHALDARGGLDP
    LLR

    >gi|156936288|ref|YP_001440204.1| hypothetical protein ESA_04187 [Cronobacter sakazakii ATCC BAA-894]
    MIANTKENKMSLEKVVYRAKAKATGGRDGRATSDDGVLDVKLGVPKEMGGQGGQVTNPEQLFAAGYSACFLGALKHVASQ
    EKKKVPQDAFIEGQVGIGPLPTGFGIEAQLDIHLPGMDRAEAEALVQKAHIV
    CPYSNATRGNIDVKLNVITD

    >gi|156936322|ref|YP_001440238.1| glutathione reductase [Cronobacter sakazakii ATCC BAA-894]
    MTRHYDYLAIGGGSGGIASVNRAAMYGQKCALIEAKALGGTCVNVGCVPKKIMWHAAQIAEAIHLYGPDYGFDTTVNHFD
    WQKLVASRTAYIDRIHTSYDNVLGKNNVDVIQGFARFVDAHTVEVNGERITADHILIATGGRPSHPDIPGAEYGIDSDGF
    FALSAMPQRVAVVGAGYIAVELAGVINALGAKTHLFVRKHAPLRTFDPMLSETLVEVMQAEGPQLHTHATPKAVEKNSDG
    SLTLHLEDGRSETVDALIWAIGREPETDNFNLAATGVKTNEKGYIVVDKYQNTNVPGIYAVGDNTGAVELTPVAVAAGRR
    LSERLFNNKPDEHLDYSNIPTVVFSHPPIGTVGLTEPQAREQYGDANVKIYKSSFTAMYTAVTTHRQPCRMKLVCVGPEE
    KIVGIHGIGFGMDEMLQGFAVALKMGATKKDFDNTVAIHPTAAEEFVTMR

    >gi|156936368|ref|YP_001440283.1| zinc/cadmium/mercury/lead-transporting ATPase [Cronobacter sakazakii ATCC BAA-894]
    MRKLSLPEDAMRTPSEKPRATPQFAKMTPISAPQKPAISKAACCESDSCENPQPVQEAAGALRWQVAGMDCAACARKVEN
    AVRQVPEVRQVQVLFATEKLVVDAPASQREAIEQAVRAAGYTLREANAAAPATPSGLRENLPILVIAAFMALSWALEQLH
    PLAGRIAFTITTLVGLFPVARQAWRLIRSGNPFAIETLMSVAATGALIIGASEEAAMVLLLFLVGERLEGWAANRARSGV
    SALVALRPETAVRLRGEARETVAISELQPGDVIEVAAGGRLPADGKLLAAAASFDESALTGESLPVERQPGEKVPAGATS
    VDRLVSLEVTSRPGDSAIDRILHLIEEAESKRAPIERFIDRFSRIYTPVIMAAALLTALIPPLLFAAPWLPWIYKALALL
    LIGCPCALVISTPAAITSGLAAATRFGALIKGGAALEALGRVEQIAFDKTGTLTAGTPQVTAIDPVDGLEAEALLAYAAA
    VEQGSTHPLAQAVVREATTRGVATLRAGAQRTLAGAGVEAQVEGRLLRISAPDKVSIALPEDWQARIRAQEAQGQTVIVV
    TASDRLLGTLALRDTQRADARDAVEKLRALGVGSVMLTGDNPRAAAAIAAELGMEYRAGLLPADKVTAVNALKARAPLAV
    VGDGINDAPAMKAATIGIAMGSGTDVALEAADAALTHNRLAALPEMIALARATHRNIRQNIAIALGLKAVFLVTTLLGLT
    GLWLAVLADTGATVLVTANALRLLRKRG

    >gi|156936416|ref|YP_001440332.1| thiosulfate sulfurtransferase [Cronobacter sakazakii ATCC BAA-894]
    MKEITMDQFECINVEEAHQKLQQGNAVLVDIRDPQSYAMGHTPGAFHLTNATLPAFMQQTDFDVPVLVMCYHGNSSKGAA
    QYLLHQGYDQVYSVDGGFDAWHRHFPAEVAHGES

    >gi|156936495|ref|YP_001440411.1| sulfur transfer complex subunit TusD [Cronobacter sakazakii ATCC BAA-894]
    MRFTLMVTGPAYGTQQASSALQFAKALLAEGHSLESVFFYREGVYNANQFTSPASDEFDLVRAWQQLHDENGVALHICVA
    AALRRGVTDENEARAQGLPGANLQPGFQLSGLGALAEAALTCDRVVEF

    >gi|156936604|ref|YP_001440518.1| hypothetical protein ESA_pESA3p05485 [Cronobacter sakazakii ATCC BAA-894]
    MTPITIYHNPACGTSRNTLGLIRNSGVEPAIILYLETPPPRDELKTLISDMGISVRALLRKNVEPYQALGLDDEKIGDEA
    LLDAMLAHPILINRPIVVTPLGTRLCRPSEEVLAILPDPQQGPFTKEDGEVLIPQGR

    >gi|156936626|ref|YP_001440540.1| hypothetical protein ESA_pESA3p05507 [Cronobacter sakazakii ATCC BAA-894]
    MKKMLMAGALLAAFHAQADDLPEPVKQLEKQGITIIKPFTAPGGVQAWLGKYQDTGVTLYLTPDKKHVITGYMYDAQGNN
    LSEKLINDELYIPAGREMWKTLDQAKGIHEGSEQAACKVVVFADPF
    CPYCHKFWEQAQPYLNDKSISLKTLLVGVIRPDS
    GRYAAAVLGSDDPQKTWQDLESSAGKNKPALPEKTSPAAFKQIQYNQQLMTQLGANGTPAIYYLNKDRLLQQIIGLPNAE
    QMADLVACK

    >gi|156936627|ref|YP_001440541.1| hypothetical protein ESA_pESA3p05508 [Cronobacter sakazakii ATCC BAA-894]
    MKMLFRSLWLLALSMSAAWAADSGWLLPAQPSHAHIQVRSSAPADGKVRLLLAITLDKGWKTYWRTPGDGGFRPVIDWST
    PAQTTWHWPQPVRFDAAGFSSVGYHDGVTFPLEVTTTETARLRGTLTLSLCSNLCVVNTFPLDVDLADGSSPGFDDDWNA
    AMATVPPDTGNITVKNVSARGSTLSLTATSPDGWPQPALFADNPDNVSLSVPVLEPSGDTLTAHFTALNERGEPTDASRI
    QAVSLVLSSGTTSQQMTVKPDGAPLFWQAVAVALLGGLILNLMPCVLPVMGMKLASLMTLAQADRRQTRIRFLATSAGMI
    FSFMVLAAIMSALRLSGAWTGWGFQFQHAGFIATMAVVTWAFCFSLAGVIEIRLPAALTTRLATAGGQGVGGSFLEGAFA
    TLLATPCTAPFLGTAVAFALAAPLPELWLIFLALGTGMSLPWLLVSLMPGVARWLPRPGPWMSKLRLVLVLMMLGSSLWL
    MSLLAKEWGARYVLIAGGLMIALFLWRCAVKLPRHRENLRTLAFGVLFGAGLYAFLAPAPDGRREGPLHWQPFSQAALEN
    ALAAHKRVLVDITADW
    CLNCKVNEVMVLHRPDVVDALHQNDVVLLQGNWSKPSAEIETFLRRHGASGIPFNAVFGPAIPD
    GKMLSSLLNKTELLSALDNAGAATSQTMNKDRK

    >gi|156934404|ref|YP_001438320.1| hypothetical protein ESA_02235 [Cronobacter sakazakii ATCC BAA-894]
    MTTPLRKIVIVGGGAGGLELATQLGHKLGRGKKAKVTLVDRNHSHLWKPLLHEVATGSLDEGVDALSYLAHARNHGFQFQ
    LGSVVDINREAKTITLAELRDEKGELLVAERKVPYDTLVMALGSTSNDFNTPGVKDH
    CIFLDNPHQARRFHQEMLNLFLK
    YSANLGANGKVNIAIVGGGATGVELSAELHNAVKQLHSYGYKGLTNEALNVTLVEAGERILPALPPRISSAAHNELTKLG
    VRVLTNTMVTSAQEDGLNTKDGEFIQADLMVWAAGIKAPDFMKEIGGLETNRINQLVVEQTLQTTRDPDIFAIGDCASCP
    RPEGGFVPPRAQAAHQMASCALDNILAQIKGKPLKPYVYKDKGSLVSLSKFSTVGSLMGNLMRGSMMIEGRIARFVYISL
    YRMHQIALHGYFKTGLMMLVGSINRVIRPRLKLH

    >gi|156935450|ref|YP_001439366.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Cronobacter sakazakii ATCC BAA-894]
    MQILLANPRGFCAGVDRAISIVENALAIYGAPIYVRHEVVHNRYVVDSLRERGAIFIEQISEVPDGAILIFSAHGVSQAV
    RNEAKSRDLTVFDAT
    CPLVTKVHMEVARSSRRGEEAILIGHAGHPEVEGTMGQYSNPEGGMYLVESPEDVWKITVKDENN
    LSFMTQTTLSVDDTSEVIDALRSRFPKIVGPRKDDICYATTNRQEAVRALAEQADVVLVVGSKNSSNSNRLAELAQRMGK
    TAYLIDDANDIQEAWVQNAACVGVTAGASAPDVLVQNVITRLKALGGSDAHELTGREENIVFEVPKELRIDAREVQ