Agrobacterium vitis S4 uid58249

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|222102540|ref|YP_002539579.1| hypothetical protein Avi_7169 [Agrobacterium vitis S4]
    MTDTIIDPKVENAPNVFTQDQIGWTPWLEPLTETELTERHYEALVDKARAKSPYFSLLVRDPDILEARTKTDKDIFYNTA
    DGLPRAERELSATATSRYNGCIF
    CASVHSRFASHHSPRKDDVQKLLDEGVGADLDERWNAIVSASVALTATPPVFATTHV
    ERLRAAGLSDDEIYDVVHGAAFFNWANRLMLSLGEPTPAA

    >gi|222102709|ref|YP_002539748.1| glutaredoxin protein [Agrobacterium vitis S4]
    MSRNERRQRRLRRPFCGQKSKPNEDMMTITVYSKPACVQCSATTRALDRQGLDYHIVDISVDEDAYAKVQGLGYRQVPVV
    IAGDTHWAGFRPDMINALA

    >gi|222080292|ref|YP_002540156.1| D-nopaline dehydrogenase [Agrobacterium vitis S4]
    MTRELIDIVIIGAGPAGMSAAVEARNAGLSVTLIDEGIGAGGQIYRSVLNERPDLGTILGPDYLAGRQLAEDFHACGATY
    LPRTTAFMIEQTSEQLSIGISAAGRARFIGARFVIIATGALERPFPIKGWTLPGVMTAGAAQTMLKASGTVPGGST
    CLAG
    CGPLLYLLAAQYIRAGVNVSAVLDTTPWSNAIRALPFAPAFLATPYFRKGIKLMREVQAKVRVVRGVSTLEAVGENDLTS
    VKYTLRGKSHTVEAETLLLHQGVVPQVNLAMSVGVRHDWNDERLAFEPVLDDCGQTSVRNLFIAGDSASISGAEAASCRG
    QLVVAGILKMLDNKSRDASKSEAAARKQLRKASRGRLFLEKLYRPAPQFRMPADDVIVCRCEEVRAGEIRAIAARGAKGP
    NQAKAFSRAGMGPCQGRSCGLTVCELIGDATAQPPGQVGYMNIRAPVKPVTLGEMARSQDYPSD

    >gi|222102382|ref|YP_002546523.1| heavy-metal transporting P-type ATPase [Agrobacterium vitis S4]
    MTAIPKIEASKTLPLPTDFGIEGMSCASCVVRVEKAIAAVPGVASAIVNLATERATVTYNEVVPTEAVLQAIEKAGYEPK
    LETRELGVEGMT
    CASCVSRVEKALKSVQGVRQATVNLATEKATVRVVSGTSTLVLEDAVRAAGYEVRRITAVRSTDNDED
    RRDREANRLTMSLALSAALTLPLFVLEMGSHFIPALHDWIMVNIGMGNNLVIQFVLATAVLFGPGLRFFRKGVPNLLHWT
    PDMNSLVVLGTSAAWGYSVVATFLPGVLPSGTANVYYEAAAVIVTLILLGRYLEARAKGKTSQAIKHLIGLQAKTAHVKR
    GEDFVEIEIGAVSLGDIVRIRPGEKVPVDGRLVDGGSYVDESMITGEPVPVKKSAGDDVVGGTINKTGSFTFEATKIDAD
    TLLAQIIKMVEAAQGSKLPIQALVDRVTGWFVPAVIAAAALTFLAWLLFGPSPALTFALINAVAVLIIACPCAMGLATPT
    SIMVGTGRAAELGILFRKGEALQTLRDVDVVALDKTGTLTKGKPELTDFVVSDGFDRAETLRLVAGLETQSEHPIAEAIV
    AAAKADGLSLSDVSDFEAAPGYGVSGRIDGRTVLVGADRSMTKSGIDVSAFSAQAAALGDAGKSPLYAAIDGRLAAIIAV
    ADPIKDTTPQAIKTLHALGLKVAMITGDNRRTAQAIARQLDIDEVVAEVLPDGKVEAVRKLRSGGRKVAFIGDGINDAPA
    LSEADIGLAVGTGTDIAIESADVVLMSGDLNGVPRAIAISKATIRNIRQNLFWAFAYNVSLVPVAAGVLYPVNGTLLSPI
    LAAGAMGLSSVFVLANALRLRRFKTT

    >gi|222106387|ref|YP_002547178.1| glutathione S-transferase [Agrobacterium vitis S4]
    MQLYHTPGTCSTASRIVLQETSIAASSIPVNLREKTLPDGTSYLQVNPKGQVPALVLDDGNVLTEGAIILQYLADQAPES
    GLLPPPGDLARYRVLEWTNYVATELHKTFTPLMRPNTPPDFAEITKTALLPRVFGTLDRRLGLSDYLAGATFSIADAYAF
    VILGWAKLQAIDLAAWPNIQAYLKRIESRPSVQSLQ

    >gi|222106508|ref|YP_002547299.1| osmotically inducible protein OsmC [Agrobacterium vitis S4]
    MKIEKYGSAQWSGGLKDGKGKVSTQSGALNAYPYGFNTRFEGVTGSNPEELIGAAHAACFTMALSMMLGEAGLTAESLET
    KANVTLEKLEAGFAITAIELVLKGKVPGADEARFTEIANQAKAG
    CPVSKALAAVPISLSVTLG

    >gi|222106587|ref|YP_002547378.1| P type cation (metal) transporter ATPase component [Agrobacterium vitis S4]
    MATEQTTRFRVEGMDCASCAAKIDTAARRVAGITDVRVSVTAQTMAVVHDGDADLVTLADRVTGLGYKTTRLAASVPQHD
    HQHDHAHGPTCTGHHDGEAHNHHHDEHNHEGHEHASHGDGLHSHQHDAGPTTGVWWRTQKARQVATSGATLVLAMLIGHL
    IPSLSFWAFLAAIAIGIVPIARRAVMAALAGTPFSIEMLMTIASIGAIIIGATEEAATVVFLFLVGELLEGFAAGRARAS
    IQGLTKLVPDTARIERNGRLEDVAAASLTLGTIVTVRPGDRIPADGEIIDGTSAINEAPVTGESLPKTKGAGEGVFAGTV
    NGEGTLRVKVTATAADNTIARVVRLVEEAQESKAPTERFIDRFSRYYTPAVTLLAALVAILPPLFWDGDWSLWLYKGLAI
    LLIGCPCALVISTPAAIAAGLSAGARRGLLMKGGAVLENVGRITAIALDKTGTLTEGKPKVTDIIAFGGAVEENVLADAA
    ALEMGSSHPLARAIIEAATDRAVSVPTANETGAIAGKGVRGTVGGISLFLGSASAAAELAAVSAEIVTRIEKLSAEGKSV
    SLLVKNGSVTGLIALRDEPRPDARQGLDALKAAGIRPVMLTGDNAATARAIATLLDIEPRAELLPQDKQAIVRDMQAKGE
    RVAKVGDGINDAPALAAADIGIAMGGGTDVALETADAAILHGRVMDLADMVMLSRQVMGNIRQNITIAIGLKAVFLVTTI
    IGITGLWPAILADTGATVLVTANAMRLLRWRGSAKAA

    >gi|222106999|ref|YP_002547790.1| arsenate reductase [Agrobacterium vitis S4]
    MNATIYHNPECGTSRNTLAMIRNAGIEPLVIEYLSTPPTRGELARMIADAGLSVREAIREKGTPYAQLGLDNPDLTDAQL
    LDAMLEHPILINRPFVITPLGTRLARPSERVLEILPNTHQGAFTKEDGERVLDSEGKRIV

    >gi|222147039|ref|YP_002547996.1| thioredoxin [Agrobacterium vitis S4]
    MATVKVDASNFEAEVLQSVEPVVVDFWAEWCGPCKMIAPSLDEISTEMAGKVKIAKLNIDENPELAAKFGVRSIPTLAMF
    KGGEVADIKVGAAPKTALSSWIAGAA

    >gi|222147108|ref|YP_002548065.1| hypothetical protein Avi_0112 [Agrobacterium vitis S4]
    MTTEPETDKPKITILYCTQCNWLLRAAWMAQELLQTFGDSLGEVGLIPGTGGNFEIRVNGALIWERKRDGGFPGPKELKQ
    RVRDVIEPGKDLGHVDRTNGKTEKGEE

    >gi|222147123|ref|YP_002548080.1| hypothetical protein Avi_0134 [Agrobacterium vitis S4]
    MTITLYGIKNCDTMKKARTWLETAGIDYAFHDYKAKGIDRASLQAWSAKLGWEVLLNRAGTTFKKLPDEAKIDMNEEKAL
    DLMLAQPSMIKRPVLDKDGTLTVGFKPEQYQAVFAGTGF

    >gi|222147251|ref|YP_002548208.1| molybdopterin biosynthesis protein MoeB [Agrobacterium vitis S4]
    METLSSEEIQRYQRHILLPEIGGAGQQKLKAARVLVIGAGGLGAPVLQYLAAAGIGTLGIADDDHVSLSNLQRQVIHDSG
    TLHDLKTESAAKAIARLNPHVRVMRFEQRFDADFAATHLPGFDLLIDGSDNFDSRYAAADAGQQHCRPLVTGAVGRFEGS
    LTVLKPYETGPDGVLYPGYRDLFPEKPPAGLIPT
    CAETGIIGALTGVIGTLMAMEAIKLITGIGEPLVGRLLMYDALSAR
    FDTVRYRRRDSNRSAP

    >gi|222147380|ref|YP_002548337.1| Disulfide bonded thioredoxin protein [Agrobacterium vitis S4]
    MIKRRTLVAAAACLATPGLLRAKELGPQEIFFDKDIPVLGNPKGDVTIAEFFDYQCGYCKTYHPIVSKVVKDDGHVRLVM
    KDWPVFGPASVVAAQAVLSIPDLGQYKAAQDALLDMKGGLTPDSVSQALESVGVNMTVVKAAANKNSDKISRLLDRNWLQ
    AQALNFRGTPSFVIGTTLYPGALDEKALKEAIAKARAA

    >gi|222147440|ref|YP_002548397.1| polyketide biosynthesis associated protein [Agrobacterium vitis S4]
    MQLEIWSDYACPYCYIGKRFLDQALAEFEHAKDVQITFKAFELDPTASPVVVNTTQQRIEYKYRKSPEGARDMIQQIMML
    GKRVGLDMRYDTVRYTNTFDAHRLAKFAESKGLADTMSERLFLAYFVENRELANHAVLAEIAVELGLDYDETKAMLQSDV
    FAEQSRADEAQAHGMGIHGVPFFVFDEGLGLSGAQPKASLLQALKTTWSKAHSAEKDRAPVCGEEGCSVPLAG

    >gi|222147638|ref|YP_002548595.1| hypothetical protein Avi_0834 [Agrobacterium vitis S4]
    MAEIKMKARPMGATAVIGRTGFPQITSATGGELSIVTGPSQAGFNPLDLLYASLAGCLTISARLAASEMGVMDRISEITA
    KVTGEKAKEGLSRVERFEITLTITGEIDAKTRKAIADRAEHEI
    CTVSNTLSGSPEFVTTLLPS

    >gi|222147807|ref|YP_002548764.1| peroxiredoxin [Agrobacterium vitis S4]
    MTIAIGDTVPAATFKEKTADGPVEISTEDLFKDKKVVLFAVPGAFTPTCTLNHLPGYLEHRDALLAKGVDEIAVLSVNDW
    HVMGAWAQHSGGMGKIHFLADWDASFSKALGLDMDLSAGALGVRSKRYSMLVENGVVKSLDIEENPGQATVSSAEAMLER
    L

    >gi|222147829|ref|YP_002548786.1| hypothetical protein Avi_1093 [Agrobacterium vitis S4]
    MSNSELTLTKRHLLAGIATAATGLAVSGMVSPAFAAAEMPKPDNDVDMAEVMKPGPLPDMALGKPDAPVKIVEYFSMTCP
    HCAHFHATTFDTIKEKYIDTGKVYFVFREFPFDPAATAAFMLARCAPKDQYYPFITMFLKQQRSWAAPDNGDVRGAMLQM
    SKMAGFTQESFQACLTNTKLAGDVTAMRDLGAKQFGVNATPTFLINGKSYSGDMSVESMSALIDSLL

    >gi|222147897|ref|YP_002548854.1| organic hydroperoxide resistance protein [Agrobacterium vitis S4]
    MAILYTTKASATGGREGRAVSENGVLDVTLTTPKELGGNGATGTNPEQLFAAGYSACFLGALKFAAGQQKVKVPEDAKVT
    ATVGIGPREDGTGFGIEVSISVDLPGIDRETGEKLVAAAHIV
    CPYSHAMRTATEVSATLA

    >gi|222147967|ref|YP_002548924.1| methionine sulfoxide reductase B [Agrobacterium vitis S4]
    MSEDSIDSREKPAAARSEAEWREQLTPDQYRILREHGTERAFTGPYWDNFEPGLYRCAGCDTPLFYSDTKFDAGCGWPSY
    FEPVKPDAVTEHRDTAYGMVRTEIRCATCGGHLGHVFPDGPKPTGLRY
    CINGHSMVFEQKP

    >gi|222148067|ref|YP_002549024.1| ferredoxin reductase [Agrobacterium vitis S4]
    MENSLVIVGAGQAGFSVASKLRALNDQRPITMICLAPELPYQRPPLSKKYLIGEMSFDRLLLRPAQWYDENAITMRLSSW
    VEEIDRPKKLLRLQDGSSLSYDTLVLATGSTPRGLPQEIGGNLAGVYTIRNKADADRLAEVMKPGRRLLIIGGGYIGLEA
    AAVARHLGLEVTVIEMADRILARVAAKETADFIRAVHQGHGVMIRENMGLKRLLGKNDIVTAAELSDGSRLDVDLVIVGI
    GATANDGLARNAGLNVQNGIIVDSYARTSDPNIFAAGDCALLPWGEGAVRLESVQNAVDQGEAIAMVLAGGTTPYTPKPW
    FWSDQYDLKLQIAGLNLGYDETIIRPGMREGSLSVWYYRQDRFLAVDAINDAKAYVTAKKLLEAGGSADKAIIGNPQEDL
    KQLLA

    >gi|222148074|ref|YP_002549031.1| methylated-DNA--protein-cysteinemethyltransferase [Agrobacterium vitis S4]
    MLFKQPSDDTLYAALVAKDASYDGFAYVCVTSTRIFCRFTCTARKPKPENCRFTETIAACLEGGFRPCKRCRPLLAYGHA
    DPLVKTLLDLLDADPGRRWQEADVVALGHDPSTVRRAFKRRFGISFIEMARLRRISLGTEVLAAGETVIEARMEAGYESG
    SGFRAAITQLLGNAPARMKDLNLLKADWIDTPIGPMLAIADDHALHLLEFADRPALPTELNRLKERQGCGVTIGRTAVTE
    QIAAELARYFSGDPSGFESRGFQTRLAGHGTPFERDVWQALRHIPVGETCSYSKLATSLGRPSAVRAVARANGANQIAIV
    IP
    CHRVIGADGSLTGYGGGLWRKQWLLNHERRIKHNP

    >gi|222148335|ref|YP_002549292.1| outer membrane protein [Agrobacterium vitis S4]
    MPPKTQAKNDGRRQWPETRIDMKIRFFRTAVLATLIASTGLGAPAYALDDKQKQEIGAFIKEYLIAHPEIMLDVQDALQK
    KQEAARASQASSGIELNKAEIFNSKDDIVLGNPKGDVTIVEFFDYN
    CGYCRHALADMDTILKTDKNVRFVLKEFPILGPD
    SVAAHRVADAFRKLAPEKYSDFHHALLGSEGRATQESAIDAGVMLGVSEAALRKEMTDSPNDTSVKKVYQLAQDLGINGT
    PAYVIGNELVSGAIGADALQEKLTNVRTCGKSTC

    >gi|222148394|ref|YP_002549351.1| thiosulfate sulfurtransferase [Agrobacterium vitis S4]
    MSAEKSRFVVSAEWVQKQLGAPQFKVVDASVYLPVHNRNAADEYASGHIPGAVFFDQDQIADHSSSLPHTLPSPERFSEA
    VGKLGIADTDTIVVYDGPGVYSAPRVWWMLRVMGARDVFVLDGGLDGWKQQGLPLETDLPEPAPATFNATFNEAQVTSFA
    EMRTIVDDSLKQVADARPAGRFTGQDAEPRAGMRSGHMPGARSVPASILSENGRLKDLSALRAIFTEAGIDLTRPIVTS
    C
    GSGVTAAAVTLALQSLGHHDNTLYDGSWSEWGSRKDTPVVTGPADTIEGELPTLLTAHVTKLEMTAPPKSSLPVPINIQT
    AIIRATEMPLPYYRFLYRQVGSRWHWYKRLQMSDAELKATIHSPDVSICVLYVNGAPAGFFELTQQQDNTVELSYFGLFE
    HALGLGIGKWFLLQALYAAWSTAPTKISVMTNTLDHPRALQLYQQFGFSPVETWNELVEPPSESSLLDILKRDYNIQ

    >gi|222148400|ref|YP_002549357.1| bacterioferritin comigratory protein [Agrobacterium vitis S4]
    MAELSIGDMAPDFTLPRDGGGTVSLSSFKGKQVVVYFYPKDDTSGCTVEATSFTSLTPEFESSGAVIIGISPDTVKSHDK
    FVAKHGLAVMLGSDEEKTTLEAYGVWKEKSMYGKTYMGVERSTFLIDADGRIAGVWRKVKVPGHAEAVLQAVKDKAA

    >gi|222148439|ref|YP_002549396.1| glutaredoxin-related protein [Agrobacterium vitis S4]
    MSGVNEFIDNAVKSNDVVLFMKGTPQFPQCGFSGQVVQMLDYLGIDYKGINVLADQEIREGIKTYSNWPTIPQLYVKGEF
    IGGCDIVREMFQAGELQSHLEEKGIAVRGAA

    >gi|222148509|ref|YP_002549466.1| methylated-DNA--protein-cysteinemethyltransferase [Agrobacterium vitis S4]
    MKDVRYTFMDSPIGSLLLAGDGYRLSRIGFPSGKGTIKPKPEWVFDDAAFHDAKDQLQAYLNGTRQEFDLRLDLKGTNFQ
    LEVWQELARIPFGVTISYGELARRIGRLSASRAVGAANGANPLPIVIP
    CHRVIGSNGSLTGFVGGLDTKKWLLMLERGAT
    VNDQQRLL

    >gi|222148538|ref|YP_002549495.1| glutathione reductase [Agrobacterium vitis S4]
    MSSFDYDLFVIGGGSGGVRSARLAASMGKRVAIAEEYRFGGTCVIRGCVPKKLFVYASQFHEHFEDAAGFGWTVGESHFD
    WKKLIAAKDQEIERLEGLYRKGLNSAGAELIESRAELTGPNRVRLLATGREVTAERIIIAVGGSANAHTSLPGHEL
    CITS
    NEAFHLETLPRSIVIAGGGYIAVEFANIFHGLGVDTTLIYRGKEILSRFDQDIRRGLHQAMEAKGIRILCTDVIEEVEKM
    AAGGLSVRTRNNGVISAETVMLALGRDPYTKGLGLETAGVAVNERGAIIVDQYSRTNVPGIFALGDVTDRVQLTPVAIHE
    AMCFVETEYKDNPTSPDHDLIATAVFSQPEIGTVGMTEEEAARTFPEIEIYKAEFRPMKATLSGRTEKVIMKLVVNAADR
    KVVGAHILGHDAGEMAQLLGITLKAGCTKDDFDRTMAVHPTASEELVTMYNPSYRIRNGERV

    >gi|222148561|ref|YP_002549518.1| dihydrolipoamide dehydrogenase [Agrobacterium vitis S4]
    MSNAYDVIIIGSGPGGYVTAIRAAQLGLKIAIVEREHLGGICLNWGCIPTKALLRSAEILDHANHAKSYGLTLNGTMTAD
    VKDVVARSRGVSARLNGGVAFLMKKNKIDVIWGEAKLTKPNEIVVGASSKPAVQPQNPVPKGVLGEGTYTAKHIIVATGA
    RPRALPGIEPDGKLIWTYFEAMKPDFMPKSIVVMGSGAIGIEFASFYRSMGVDVTVVELMANIMPVEDVEISTIARKALE
    KRGLKIITEAKVSKVEKGANSITAHVETKDGKVQQITADRLISAVGVQGNIENLGLEALGVKTDRGCIVIDGYGKTNVPG
    LYAIGDVAGPPMLAHKAEHEGVICIEKIAGLPHVHPMNKSLIPGCTYCNPQVASVGLTEAKAKADGREIRVGRYNFNANG
    KAIALGEDNGMIKTIFDKKTGELVGAHMVGAEVTELIQGFVVAMNLETTEEELMHTIFPHPTLSEMMKESVLDAYGKVLN
    A

    >gi|222148738|ref|YP_002549695.1| polyketide biosynthesis associated protein [Agrobacterium vitis S4]
    MQRITIDLVSDVVCPWCYLGKARLDLAIAEVQDTVSIDVNWRPYRLNPDYPPEGVDQQAELAKKFGGKENLERGHQQLAE
    LGREVGIAFNFEAIKIGPNTLDAHRLIHWAGLESREAQGAVVSGLFKAFFEDGRNLGDHAVLLDIVQEAGLDRKVMQALL
    AGDADKDMVIDEIDAAQKMGVNGVPFFIIDQKYAVSGAQPTEVLANALRDIAAEKAVEQSKLN

    >gi|222148751|ref|YP_002549708.1| heavy-metal transporting P-type ATPase [Agrobacterium vitis S4]
    MNASNTLETTIAIDGMNCASCVRRVEKAIVAVPGVSSASVNLASEKASVQFSQQPDLAAVLAAIQQAGYAPRIETQELDI
    DGMN
    CASCVRRVEKALAAVPGVSLAAVNLATERATVTVTADTDRQTLVAAVEQAGYHIRKPANPEAPSDPLPDQRADETH
    RLTRMTVIAFLLTLPVFIIEMGSHLIPALHVWVMNTLGMQTSWVLQALLAGLVLFGPGLTFFRRGVPNLIGLHPDMNSLV
    VLGASAAYGYSLVATFMPGLMPQGTVNVYYEAAAVIVTLVLLGRTLESRAKGRTSDAIKRLIGLSPKTARVIREGKPVDL
    DIAAVIVGDILDIRPGERLPVDGVVIEGRSFIDESMISGEPVPVEKADGDVVTGGTINKNGAFRFRATKVGADTLLSQII
    RMVETAQGSKLPIQGMVDRITGWFVPAVIAAALLTFIVWLLFGPTPALSYALVNAVAVLIIACPCAMGLATPTSIMVGTG
    RAAELGVLFRKGEALQSLRDVTVVALDKTGTLTEGRPELTDLMAADGFSRADILSFAASLEARSEHPIAKAILAASEAEQ
    APRQIATDVVAEPGYGISGIVSGHQVLVGADRALTRHGIDLSPFAEDAEQLGLDAKTPLYLAIDGKPVALMAVADPIKAT
    TPAAIRALHDLGLKVAMISGDNRRTAEAIAARLGIDTVIAEVLPDGKVAAIAGLRKDGSKLAFVGDGINDAPALSAADIG
    IAVGTGSDIAIESADVVLMSGDLQGVARAISISKAVIRNIGQNLFWAFAYNVLLIPLAAGLLYPVNGTLLSPIFAAGAMG
    LSSVFVLTNALRLRKLRPA

    >gi|222148754|ref|YP_002549711.1| nitrogen fixation protein FixI [Agrobacterium vitis S4]
    MSCCAAGSEAALDLERSGALLPSSEEIRLASRDLGEGLTQVDFSVPGVYCGACITKIETALKRLPAVERARVNLSTRRVG
    VVWRTRVAEEGPFIDREAGPFTHDSGFDPAELARAIASTGYSCHLFTPQDLASDLLLKQLIRAVAVTGFAATNIMLLSVS
    VWSGADASTRDLFHWISALIAAPALIYGGRFFYQSAWTALRHRRTNMDVPIAIGISLSYFSSLWETIHHGEHAYFDATAS
    LLFFLLIGRALDHMMRDRARSAISGLARLNPRGATVVGADGSREYRLVDDIKVGEHVAISAGERIALDGTVIAGTSDLDV
    SIVNGESAPQTVGPGDAVQAGTLSLTGSLTVKATAQARDSFLSEIIRLMEAAEGGKAHYRRIADRASQLYAPVVHLLALT
    SFIVWGLYDGDWKHALMVAIAVLIITCPCALGLAVPVVQVVAAGKLFQRGIMVKDGSAMERLAKVDAVAFDKTGTLTLGR
    PMPVDINKASPGMISIAAGLAAHSRHPLSQSLWRSASSNYAAGAIRNFSGVTEIPGSGVEADAAEGRYRLGNRRFALGSG
    EGEADGPALSEVILSLNGYSLGCFRFEDSLRPSAAEVIAGLQAEGMRVTILSGDRTPVVKALAARLGVDAAEAELSPSGK
    AKFCASADEAGQHLLMVGDGINDAPALSAAYVSMAPATAADVGRQAADFVFMHEGLDAVPFAINVSRRAGQLIRENFVLA
    IGYNVLAVPVALLGYATPLIAAVAMSTSSIIVVANALRLNGLGGFTRKADAHALQPASNRKPLGIAA

    >gi|222148795|ref|YP_002549752.1| FeS assembly scaffold SufA [Agrobacterium vitis S4]
    MGFAVMTMTDAAAARVKEIVENSGPDAKGIRVGIKKGGCAGMEYTIDLVTEPNPRDDLIARDGASVWLEPAAVLYLLGTE
    IDFETTTLRSGFTFRNPNQTSACGCGESVELKAADLAELAKQRQAVHV

    >gi|222148977|ref|YP_002549934.1| hypothetical protein Avi_2678 [Agrobacterium vitis S4]
    MTTQTVTVSKNAAKRIAKIVSSENDKHALRVSVEGGGCSGFSYKFDLDQGPQDGDLVIERDGATLLIDPVSLVYMAGSEI
    DFVDNLMGQSFQITNPNAVASCGCGTSFAM

    >gi|222149057|ref|YP_002550014.1| methionine sulfoxide reductase A [Agrobacterium vitis S4]
    MTSERAVLAGGCFWGMQDLIRKLPGVIATRVGYSGGDVANATYRNHGTHAEAIEIIFDPSKTSFRDLLEFFFQIHDPSTP
    NRQGNDVGVSYRSAIFYTSEEQKKVAEDTIADVDASGIWPGKVVTELAPVGDFWQAEPEHQDYLERIPNGYTCHFPRPHW
    KLPKRQAVA

    >gi|222149304|ref|YP_002550261.1| thioredoxin-disulfide reductase [Agrobacterium vitis S4]
    MPHTTRPSPRKGKTMSARHTKVLIIGSGPAGYTAAIYAARAMLKPVLIAGMEQGGQLMITTDVENYPGFADPIQGPWLMG
    EMLKQATHVGTEIVNDLVTEVETTRRPFTVKTDSGAVWTADTLIICTGAKAKWLGIESEQHFQGFGVSA
    CATCDGFFYRN
    KDVIVVGGGNSAVEESLYLSHIAKTVTVVHRRDSFRSEKILQERLFAKDNVKVLWNTVIDEVTGIPAKPPMPPSVTGVRL
    KNLDSGIVTDTPIDGVFVAIGHAPAVELFTGKLKLKPNGYLWTAPDSTATDVPGIFAAGDVTDDIYRQAITAAGMGCMAA
    LEAERYLAAEIIPAQAAE

    >gi|222149346|ref|YP_002550303.1| Glutathione peroxidase protein [Agrobacterium vitis S4]
    MNVHDFSAKDITGRERKLAEFAGKLLLIVNTASKCGFTPQYEGLETLQKRFQDDLVIIGFPCNQFGGQEPGSEAEIASFC
    DLNFKVSFPMFAKIDVKGNEAHPLYKYLTHEVRGILGTEAIKWNFTKFLVGRDGTPIARYAPITKPEEIADDIAKAVKG

    >gi|222149396|ref|YP_002550353.1| hypothetical protein Avi_3269 [Agrobacterium vitis S4]
    MFAFDNSYARLPEPFHAAVLPQPVAQPKLIRFNHALAQDLGLDMEGKDDTALAEIFSGNRIVQGASPLAMAYAGHQFGNF
    VPQLGDGRAILLGEVLDRHGRRRDIQLKGAGPTPFSRNGDGRAALGPVIREYIVSEAMHALGLPTTRALAAVATGQPVRR
    EVALPGAVLTRVAASHIRVGTFQFFAARQDNDSLKALADHVIDRHYPILKDADNRYLALLNAIADRQAALIARWLSIGFI
    HGVMNTDNVAVSGETIDFGPCAFLDEYNPKKVFSSIDQRGRYAYANQPGIGQWNMARLAECLLPLFDGGEDKAVEDANAA
    LARFGEVFQTYWLAAFRAKLGVTGNDEADLALINDFLGLMETHEADFTLTFRQLGRIAGGGVAQDLIPETDALIAWLIRW
    RARLGTERPAEMIEAEMQTINPALIPRNHRIEEAISAAVYDDYSFFERLTQALERPFEELEDTADLRVPPKAEERVTRTF
    CGT

    >gi|222149544|ref|YP_002550501.1| hypothetical protein Avi_3473 [Agrobacterium vitis S4]
    MLIGRKVPSVTFRTRVRDEEVGGPNPFRWQDMTSDDYFKGKKVVLFSLPGAFTPTCSTFQLPDFEKLYSEFQSAGIDDIY
    CISVNDAFVMNAWGKQQGLANVKLIPDGSGEFTRKMGMLVSKDNLGFGMRSWRYAAIINDGVVEQWFEEEGYSDNCDSDP
    YGVSSPQNILEKLKEKQAA

    >gi|222149807|ref|YP_002550764.1| hypothetical protein Avi_3823 [Agrobacterium vitis S4]
    MTDDLQNPRHEEGGAFCVAALYHFASFARFESFREPLDALCKAQGVKGTLLLAHEGINGTIAGTDAGIAAVLAYLRAQPE
    FASLEHKESRASKMPFVRMKVKLKKEIVTMGVEDIDPNKIVGTYVDPKDWNALISDPDTIVIDTRNDYETAIGIFRGAVD
    PNTKTFREFPDWVKNNPGLHNKPKIAMY
    CTGGIRCEKATAFMKQQGFEEVYHLKGGILKYLENVPEEESLWDGACFVFDE
    RVSVTHGLKEGDHQLCHACRNPITPEELSSPYYEAGVSCSHCYETRTEEDRDRYRQRQKQIALAKQRGERHIGG

    >gi|222149824|ref|YP_002550781.1| methylated-DNA--protein-cysteinemethyltransferase [Agrobacterium vitis S4]
    MTTFARSFETGASDITPEGSDYQTVRRVIEMLTLDYREQPALETIAERLGQSPTQLQKTFTRWAGLSPKAFLQAVTLDHA
    KRLLGHEGLPLLETALELGLSGPGRLHDLFVSHEAMSPGEWKAKGAGLTIRHSFHTSPFGLALVMVTDRGLAGLGFCDPG
    EEAACYADMAGRWPLANFVEDPLAIEPYVTRIFDPASWQAEQPLRVVLIGSDFQVRVWQSLLQIPLGRAVTYSDIAQKIG
    QPTASRAVGAAVGRNPISFVVP
    CHRALGKSGALTGYHWGLTRKRAMLGWEAGQVG

    >gi|222149921|ref|YP_002550878.1| glutaredoxin 3 [Agrobacterium vitis S4]
    MASVIIYTRKYCEYCARAKALLTTKGVAFTEVDATGNAALRQEMVDKSGRNTFPQIFIDNTHVGGCDDLHALERAGKLDP
    MLAA

    >gi|222149954|ref|YP_002550911.1| thiol:disulfide interchange protein [Agrobacterium vitis S4]
    MTKKRPLGLPSAKLIAFAAIAGVLAGAVAVYVKETGSGNGSEIAVAQGCETAAQAVKTLDPLIKGQVAAVVAANPPRQIT
    GLTFKDASGADKSLQDFKGKPLLVNLWATW
    CLPCREEMPALNRLQQAKGGDKFEVVAINIDSGSDERPKAFLSDNGIDHL
    GFYRDSSMGVFNALKKQGLAFGLPVTLAIDGKGCLLGSMNGPAVWDSEDAKNLIDGLKTL

    >gi|222150034|ref|YP_002550991.1| dihydrolipoamide dehydrogenase [Agrobacterium vitis S4]
    MAYDLVVIGSGPGGYVCAIKAAQLGMKVAVVEKRATYGGTCLNIGCIPSKALLHASEMFHHAAHGMAELGVDVSAPVLNL
    PKMMAHKDATVKANVEGVSFLFKKNKIDGVIGTGKIVAAGKVSVTNDKGEEQILETKNIVIATGSDVAGIPGVAVDIDEK
    IIVSSTGGIALDKVPGKMIVVGGGVIGLELGSVWARLGAKVTVVEYLDTILGGMDGEVSKQFQRMLVKQGMEFNLGAKVT
    AVEKTGTGAKVTFEPAKGGEATVLEADVVLIATGRKPYTTGLGLEDVGVALDNRGRVEIDNHFKTNVAGIYAIGDVVKGP
    MLAHKAEDEGVALAEILSGQHGHVNYDVIPGVVYTQPEVASVGKTEEELKAAGVAYKVGKFPFTANGRARAMLATDGFVK
    VLADKETDRVLGVHIIGLGAGEMIHEAAVLMEFGGSSEDLGRTCHAHPTMSEAVKEAALATFAKPIHM

    >gi|222150092|ref|YP_002551049.1| thiol:disulfide interchange protein [Agrobacterium vitis S4]
    MAENRLETAEKRGLSRYLLAAIPLAVFALIAGTAGKMLYDQDFNGKNVSDIPSALIGTKAPTLNLPPLEGSNLPALTSSA
    ITGKLTLVNVFASW
    CIPCRDEHPLLKQLSNDPRIQIVAINYKDKSDNALRFLGELGNPYKAIGIDPNGKAAIDWGVYGIP
    ESYLVAPDGTIVYKRVGPFDAQSIEKGLYPAIDRALAVKAITEPPARP

    >gi|222150129|ref|YP_002551086.1| thioredoxin [Agrobacterium vitis S4]
    MVMSNSGNPYGGSYGGQMTANAQFGAAPAAAAPASAGASPAGGLIKDTTTQGFAKDVLEESRRQPVLVDFWAPWCGPCRQ
    LTPIIEKAVNEAKGKVKLVKMNIDEHPAIAGQLGIQSIPAVVAFVDGRPADGFMGALPESQVKQFIDKLGGPDGGADQAA
    EIEAVLVEAKGLYDDGDFDGAAQLYAAVMQADPENAKAVAGIAECMLALNQHERVRQIVDGLPEELAKAPEIQAVAKKLE
    QIEEARKLGDPVALEQQLSLNPDDHEARLKLAKIRNVEGKREDAADHLLLIMKKDRTFDDDGARRQLVEFFEVWGPKDPA
    TIQARRKLSSILFS