Croceibacter atlanticus HTCC2559 uid49661

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|298206643|ref|YP_003714822.1| putative copper transport-related membrane protein [Croceibacter atlanticus HTCC2559]
    MATTNQNTVTQTFPVLGMTCASCASSAESIVTHQEGVVSASVNYATGNLIVEFLSNVTNAEKIRKAVQGVGYDLLIEDES
    KQQESLEVIHEKKFKQLKNKTLWAVILSLPVVIIGMFFMDMPYGNEIMWAFSTPVVLWLGRDFFINAWKQAKHRKANMDT
    LVALSTGIAYIFSVFNMLFAGFWHQRGLHAHVYFEAAAVIIAFILLGKLLEEKAKGNTSSAIKKLMGLQPKTVIVIQADN
    TEKQTAIENVKVDDVILVKPGEKIAVDGMVISGSSYVDESMLSGEPVPILKKENEKVFAGTINQKGGFQFKAVKVGKETM
    LAQIIKMVQDAQGSKAPVQKLVDKVAGIFVPVVMGIALLSFIVWMIFGGDNAIVQGLLAAVTVLVIACPCALGLATPTAI
    MVGVGKGAEQGTLIKDAESLELAKKVNAIILDKTGTITEGRPQVTGIQWLNNDDSKKYILFSIEKQSEHPLAEAVVKYLD
    KVNSTSLTNFDSITGKGAKADQNNETYFVGNKKLLFENNISIPEELQQQANEWSKLSKTVIWFSDSKQALSVIAISDKIK
    KTSAQAIKEMQDMGIDLYMLTGDNEATARAIAEQTGIKHYKAEVLPQHKADFVKELQEEGKTVAMVGDGINDSTALATAD
    VSIAMGKGSDIAMDVAKMTIISSDLTKIPQAVKLSKQTVATIKQNLFWAFIYNLIGIPIAAGILYPINGFLLNPMIAGAA
    MAMSSVSVVSNSLRLKWKKVI

    >gi|298206740|ref|YP_003714919.1| thioredoxin reductase [Croceibacter atlanticus HTCC2559]
    MISTDILIIGAGPTGLFTVFEAGLLKLKCHLIDALPQPGGQCSEIYPKKPIYDIPAFPEVLAGDLVNNLMKQIEPFQPGF
    TLGERAQTIDKQEDGTFIVTTNKGTKHHAPVVAIAGGLGSFEPRKPPISNIKDFEDRGVSYIIRDPEVYRDKKVIIAGGG
    DSALDWSIFLADVASEVTLVHRRSEFRGALDSVEKVSELSKLGKIKLVTNAEVVGINGSEKLESVVIQHKDKAAQDTLLE
    VDDFIPLFGLSPKLGPIADWGLEIEKNAIKVDNTLDYQTNIPGIYAIGDVNTYPGKLKLILCGFHEATLMCQSAFQRINP
    DKRYVMKYTTVGGVHGFDGSVKTAKKEVVQKIG

    >gi|298206776|ref|YP_003714955.1| Thiol-disulfide isomerase/thioredoxin-like protein [Croceibacter atlanticus HTCC2559]
    MKTIFKFLKKQWQNVLLLFFIVLLLIPQTRFKIQVFAQQLLAFSPSIEETSKEVNLSNWEIVDANGMVLRVEHINKPLVV
    NFWATW
    CPPCVAEMPSFQNVYNDYKDDVVFVFLSNEDVKTTKAFAEKHNYTLPFYTSTNSLPEAFNSDQLPTTYVLDAKD
    NLIINHTGSANWNSKKFRSTLDELLSKPE

    >gi|298206807|ref|YP_003714986.1| hypothetical protein CA2559_01090 [Croceibacter atlanticus HTCC2559]
    MSSKINTNNLLSKETSPYLLQHANNPVNWVGWSSKVLNKAKEDNKLILISIGYAACHWCHVMEHESFEDISIAEVMNANF
    INIKVDREERPDVDQVYMKALQLMTGQGGWPLNIVALPDGRPIWGATYLPKKQWKGSLHQLADLYRSNSEHMITYAEKLS
    KGMAQVSLVTKTDSNTDISKAFLKDSLQTWSNQFDYTYGGTQRSPKFMMPNNYQFLLRYAHQTKDKSLLDYVILTLNKIS
    YGGVYDHIGGGFSRYAVDSKWHVPHFEKMLYDNAQLVSLYSKAYTLTKDPWYKTVVTNTLNFIETELTRDNGSFYSSLDA
    DSLNTEGKLEEGAFYVWTKAELKSLLNEDYPLFEAYYNINEYGHWEHNNYVLIRTKSNSEIANDFSIPISTLDKKLTSWK
    ALLNNNRQKRAQPRLDDKSLTSWNALMINGYIDAYKAFQINDYLEIALKASNFILDKMLQKDGSLTHSYNKNEAKINGYL
    EDYAFTIEAFISLFEVTFNSKWLSKAEELTTYALKHFYDEEQHIFYFNSNLDDALVTRPIEQQDNVIPASNSTMAKNLFK
    LSHLLGIKSYKEIAEQQLKTVLQDAKTYASGYSNWLDVIMNFSFPYHEIVITGKNASNYVKDLNLNYIPNSITAATEKEN
    NDLLIFKNRYVDEQTLIYVCKDNTCNVPTDKVSSAVKQCLE

    >gi|298206836|ref|YP_003715015.1| hypothetical protein CA2559_01245 [Croceibacter atlanticus HTCC2559]
    MKFFVSIICVLLFTSLTFSQSNPLVIKEKTPLIIYGSNTCHYCIDTKLFLKEKNIEFIFYDIDLSVSKLNEMLKKLSTNG
    VDISNVKLPVIDKSGKLFMNDSKFQDFLKMLVQ

    >gi|298206842|ref|YP_003715021.1| hypothetical protein CA2559_01275 [Croceibacter atlanticus HTCC2559]
    MKPTEKAPNLSLPLVNDTEWELYSQNPEHFTLLVFYRGLHCPVCKKQLEELSSKLEDFKNEGVNVVAISMDTEKRAKLSQ
    EKWDTGNLPIAYGLSEEDAKTWGLYFSKAISDSEPELFSEPGLFLIKNDHSLYFSSIQTMPFARPKVEDLIKAFQFIKDK
    DYPARGKA

    >gi|298207102|ref|YP_003715281.1| regulatory protein [Croceibacter atlanticus HTCC2559]
    MAYKHFDVFIIGSGIAGQTCAKKLAKEGLNVAIADDREFGGTCANRGCDPKKVIYGLTHILQRSNDLLGKGITTMPEYSW
    KDLMAYKCNFTDAVPAVTEEKLEDLNITLYHQSPEFIDQSTISVEGKTVTADKFVIATGLHPRNLGFDGCKLMKVSDDFL
    ELETLPETMIFVGAGYIGMEFAHMAARCGVKVTVIDFAKRPLGNFDEDIVEELVKASKKLGIKFIFEADVRQVKHLRKNY
    EVEYLKDGKLQTAKAELIFNVAGRVPATEKLKLQKGNIEFNKNGIEVNSYLQNPTNKNVYACGDVSDHAVPLTPFSGREG
    STVATNILAELNSKTTSKKKITFPPTPSVCFTIPNVASVGILEADAKNESLEYIVKSGDGKDWYNARRVNTSVYAYKIII
    HKETDKILGAHLIGPQASEVINLFSMAIFKEMTAAELKQMVFAYPTWGTDVAAMV

    >gi|298207112|ref|YP_003715291.1| hypothetical protein CA2559_02625 [Croceibacter atlanticus HTCC2559]
    MVNILINPFMKYFILSLVAIVIVSCATENKQHTIVSGTLTNNSKDIVAVNGHGEAYELKVDKEGNFKDTLNISANGYYYF
    FAGRERTTIYLEKGKTLNVTVNTDEFDETINYSGDLANENNYLAAKYLYNEANRDMQSLYAKEEAQFKNALSSSSKSYDS
    ILSANNVTNTAFLELEKDDIRYAEAGNILNYETYHKYATKNDSFKVSEGFYSSVKDLNYKDTLAYKNSEVYRGLVATHLN
    TIISKKQEEDSTANYSVTFVETVNDEYANGTIKDNVLTNYLSGYGLRPDEHLEKIYSTYISTNPTKENLEKVNKRYNVLK
    DITPGKISPEFSFENIDGSTTSLKDLSGNYVYIDVWATW
    CGPCIAEIPSLKQVEKDYHGQPVKFVSISIDNEKDKQKWKA
    MIEEKDLQGIQLFADNNWESKFVQDYGIQGIPRFILIDKKGHIVSADAPRPSNPELRTKLDTLLKS

    >gi|298207149|ref|YP_003715328.1| probable fusion protein [Croceibacter atlanticus HTCC2559]
    MPLVTPLDASHDKETAELAEFFNETLGFCPNSVLTMQRRPAISKAFINLNKAVMANEGRVTSSLKRMIAWVSSNATGCRY
    CQAHAIRAAERYGAEQEQLDNIWEYRTHSAFSDAERAALDFSLAASQVPNAVDADIQKRLHEHWDEGEIVEMLGVISLFG
    YLNRWNDSMGTTLEGDAIESGNQYLGKHGFEVGKHV

    >gi|298207279|ref|YP_003715458.1| hypothetical protein CA2559_03470 [Croceibacter atlanticus HTCC2559]
    MQLYNKLSAKERAELIDKAGEDRLTLSFYKYAKIGNPEIFRNHLFLAWDQLEVLGRIYVAHEGINAQLSVPAKKFNEFKA
    FIDDINFLENVRLNIAVEQDAKSFLKLKVKVRPKIVADGLNDTSFDVTNKGVHVDAETFNQLIEDPNTVLVDMRNHYESE
    IGHFKNAITPDVDTFRDSLDIIEEDLKDHKEDKKLVMY
    CTGGIRCEKASAYYKHKGFKNVFQLEGGIIEYTRQVNEKALE
    NKFLGKNFVFDHRRSERISDDVISNCHQCGKACDTHVNCANEACHLLFIQCEECSKAMDTCCSTECQDINALPIETQREL
    RKGSHNSNKIFKKGRSEKLKYKA

    >gi|298207303|ref|YP_003715482.1| methylated-DNA--protein-cysteine s-methyltransferase [Croceibacter atlanticus HTCC2559]
    MDPLKLNKLDEAIISSPLGAIQVLGDENGVQSILFLEDAKPFTEDIPKSLSIAVQELTDYFTKKTKDFTFKLNPQGTEFQ
    QKVWQQLCTIPFSKTSSYLDMAKALGDPKVIRAAASANGKNPISIVIP
    CHRVIGSDGSMTGYAGGIWRKEWLLNHESAVT
    QGTLF

    >gi|298207472|ref|YP_003715651.1| Scaffold protein for iron-sulfur cluster assembly [Croceibacter atlanticus HTCC2559]
    MVKQAIFSIFAHIFKTMIKVSEGAKNRISSLMAESGYDALKDYVRVGVKSGGCSGLSYDLDFDNKTEETDKVFEDNSIKI
    VVDKRSFLYLVGTTLEYSGGLNGKGFVFNNPNAQRTCGCGESFSL

    >gi|298207518|ref|YP_003715697.1| hypothetical protein CA2559_04665 [Croceibacter atlanticus HTCC2559]
    MSQNEAISVDVAKDNDTLIFFVSNNTDFTQDVIFTVKDLEGLEGNTNPLLKRLNPQVTDIFHKLKITGPYNYNFDFLNEF
    PKEHLINEAFTVGDDILLNKGIVIFEKTD
    CGRCQTTMAYLNAKNKPYAKLNITDNPMYNQLMWELLELNGYLGDSVKTPV
    ILVNGAISFSHEDLEGFLEQL

    >gi|298207547|ref|YP_003715726.1| hypothetical protein CA2559_04810 [Croceibacter atlanticus HTCC2559]
    MKYTLLLVLLIFTTTLSAQEVEWMSMNDALEAQKENPKKIFVDVYTDWCGPCKLMDKKTLQNKDVAKYISNNYYAVKFNA
    EGTEEVNYNDFTYTNPNYNPDRKGRNSQHLFAHALKITGYPSIVFFDETGKVIAPVVGYQSPTQLEVYLKMINNDDYKRL
    NTAEAWNAYKDNFNYKFKN

    >gi|298207575|ref|YP_003715754.1| thioredoxin [Croceibacter atlanticus HTCC2559]
    MALEITDANFEDTVLKSDKPVMVDFWAAWCGPCRMVGPIIDDISKDYEGKAVVGKLDVDANQEFAAKYGVRNIPTVLVFQ
    NGEVVGRQVGVAPKNTYAEALDALL

    >gi|298207588|ref|YP_003715767.1| hypothetical protein CA2559_05015 [Croceibacter atlanticus HTCC2559]
    MSYLDTTHDVYKEAAITPDVGLCCTTNPIWELPGLKIPKIMQEMNYGCGSTVHARDLSNNPKMLYVGVGGGMELLQFSYF
    NRQKNGVVGIDVVDEMLEASRKNFKIAEEQNDWFKSEFVDLKKGDALNLPVEDNSIDVAAQNCLFNIFKAEDLTRAIKEM
    YRVLKPHGKLVMSDPTCEQDMNETLRNDERLRAL
    CLSGSLPIKEYVKALTDVGFGTIEIRARKPYRILNPGTYPTDELIY
    IESIEVAAIKDPMPEDGPCVFTGKAAIYYGKDDYFDDKKGHILLKNQPLAI
    CDKTAAALKALGRDDIYFSESTYHYDGGG
    CC

    >gi|298207591|ref|YP_003715770.1| hypothetical protein CA2559_05030 [Croceibacter atlanticus HTCC2559]
    MKTLILVSLLFFSAGSMLAQKNIDALLEQYNTRSIPYISVQELKMDEDTYTILDTRKKQEFLVSHLPNAVWVGEQPNDSI
    LNTLSISKSKPIVVY
    CSVGIRSETFGEKLSNKGYTNIQNLYGSIFAWKDAGFAVVDSLNKKTNKVHVFSKVWGKYLRTGD
    KVY

    >gi|298207592|ref|YP_003715771.1| hypothetical protein CA2559_05035 [Croceibacter atlanticus HTCC2559]
    MATKSLKKQDSELANANRQLEILSNGIFQSGELPTFKEKISEINQFPLRPKTLEILQMNLGYMCNQVCEHCHVDAGPDRK
    EIMTVETMKQCLEIIKTTGAHTLDLTGGAPEMNPNFRWFVEEASKAGIKDFIVRSNLTIIRANKKYYDLPDFFKAHNVHV
    ISSMPHWTRGKTDKQRGDGVFDKSIKALQELNERGYGMPGSDLRLDLVYNPSGAFLPGDQAAMEKDFKKALLEDFNIQFH
    NLFAITNLPIARFLDYLIASENYEDYMYQLVDAYNPAAVENVMCTNTISISWDGWLYDCDFNQMLGLKVASKVKHVSEYN
    EDLLNDRNIIISQHCYGCTAGAGSS
    CQGTVA

    >gi|298207593|ref|YP_003715772.1| carboxymuconolactone decarboxylase [Croceibacter atlanticus HTCC2559]
    MNKTYYDPADLRKFGKITEWSEELGTKFFDYYGKVFEEGALSAREKSLIALAVSHVVKCPYCIDAYTKDGLQRGITKEEM
    MESVHVGAAIESGATLVHGVQMMNKYEKLSH

    >gi|298207827|ref|YP_003716006.1| Dihydrolipoyl dehydrogenase [Croceibacter atlanticus HTCC2559]
    MSKFDVAVIGSGPGGYVAAIRCAQLGLKTAIIEKYSTLGGTCLNVGCIPSKALLDSSHHYHDAVAHFEEHGIEISGDVKV
    NLEQMMSRKEKVVNQTCDGVKFLMDKNKIEVFQGVGSFKDTTHINIEDSEGKTQTIEAAKTIIATGSKPSSLPFIDLDKE
    RIITSTEALKLKEIPKHLIVIGGGVIGLELGQVYKRLGADVTVVEYMDRIIPTMDSACSKELTKILKKQKVKIATSHKVS
    AVTRDGDKITVKATDKKDKEVSFEGDYVLVSVGRKAYTDGLNLDAVKIKADDRGRVEVNEHLQTNVENIYAIGDVVKGAM
    LAHKAEEEGVFVAETIAGQKPHINYNLIPGVVYTWPEVAAVGKTEEELKEEGIKYKSGQFPMRALGRSRASGDIDGMVKI
    LADETTDEVLGVHMVGARVADLIAEAVTAMEFRASAEDIARMSHAHPTYAEAVKEAALAATEDRPLHI

    >gi|298207828|ref|YP_003716007.1| putative thioredoxin peroxidase [Croceibacter atlanticus HTCC2559]
    MTLVGKQFPNLDVNAMNDMGDTFKLNILEEAKSKGKKILLFWYPKDFTFVCPTELHAFQAALGEFEKRNTLVVGASCDSA
    EVHFAWLNTAKDNGGIEGVTYPLLADTNRNLASRLGILDLTNERYDEETGDITVDGDNVTYRATYLIDEEGTVFHEGVNH
    MPLGRNVSEFLRLVDAYTHVQEKGEVCPANWEEGKDAMNANRDGVAEYLKTNA

    >gi|298207829|ref|YP_003716008.1| thioredoxin [Croceibacter atlanticus HTCC2559]
    MIKELDQDNLADVVSQHHNVIVQFSAGWCGNCRVMKPKFKKLATENENAEFVIVDAEKFPESRKLATVDNLPTFATFQNG
    TFKNQVQTNKFDVLKDLVNEVTGN

    >gi|298207831|ref|YP_003716010.1| thiol peroxidase [Croceibacter atlanticus HTCC2559]
    MAQVILGGNTVNTYGELPEIGEKAPHFELLKSDLSVGRLKDFEGKRLILNIFPSIDTNTCATSVRTFNERAKKLKNTEVL
    CISRDLPFALKRFIDDEGITNVTNLSDFRERTMGKDYGLEMMDGPFEGLLSRAVIVLDEKGVILHSERVQDISNEPDYDA
    ALNALA

    >gi|298207867|ref|YP_003716046.1| Thiol:disulfide interchange protein tlpA [Croceibacter atlanticus HTCC2559]
    MKYVLMALFIATLVSCKADKETPEAIDNYNDAASDITITSYDYNGFKPFLEKQDGKVHIINFWATWCKPCVEELPYFEMI
    NSQYSNEDVTVTLVSLDMPSMVDGHVIPFVKKNQIKSDVILLDDPDANFWIRDINAQWTGAIPATIIYKNGKQKFYEQTF
    TFNQLQKELKSFL

    >gi|298207868|ref|YP_003716047.1| hypothetical protein CA2559_06425 [Croceibacter atlanticus HTCC2559]
    MKTLKILTVFTIVVAGIALAADQFIGFDAIKSSETNGYAIGDAATDFSLKNVDGNMVSLIDYKDAKGFIVIFTCNHCPYS
    VAYEDRIIALDKAFKTKGYPVIAINPNNPEAYPDDSYKKMIERSVEKGFTFPYLFDDGQTIYPQYGATKTPHVYVLEKVG
    QENIVKYIGAIDNNYKDEKLATDKYVEDAVNALLNNEPVKVETTRAIGCSIKS

    >gi|298207869|ref|YP_003716048.1| metallo-beta-lactamase superfamily protein [Croceibacter atlanticus HTCC2559]
    MILDQLYTKCLAEATYYITSGKEAAIVDPLRETEPYLERLKNDGATLKYIFLTHFHADFVSGHVDLALKTGARIVLGPNA
    TAAYEFHQAKDGEIFTLGDLKIKALHTPGHTMESTCYLLFTEKGEQHAIFTGDTLFIGDVGRPDLAVKSDLTTADLAGYL
    YESLRNKIMPLDDHIIVYPAHGAGSACGKNMSSETYDTLGSQKKLNYALDSKLSKTEFVNMTTEGLAEPPQYFPLNVAMN
    KAVNSTIDSILGSGTTALSPLEFQNLASQEDVLILDVRTPNDYAKGSVKNAWFIGLDGTFAPWVGALIEDIHQKIILIAP
    EGREAEAVTRMARVGYDNTLGYLSGGMAAWERAGFPVEKTGNISAQEFVDGIQLGEIKNPLDVRKTPEYDTKHIEDIALL
    PLDDIHKKLSSLQPQSTYHVH
    CAGGYRSMIFSSIAKSKGYLNMVNVEGGFGAIKKTNLKSLNLVSTSTIDL

    >gi|298207870|ref|YP_003716049.1| rhodanese-like domain protein [Croceibacter atlanticus HTCC2559]
    MENLTNEQWQERLAKDENAVVLDVRTQEEVDEGVIPNAQHLDIYDSAGFMQGVQEMDKSKSYYVYCRSGGRSQQACMLMN
    QMGIENTYNLKTGFSEWDGETSKL

    >gi|298207871|ref|YP_003716050.1| lipoprotein, putative [Croceibacter atlanticus HTCC2559]
    MLRTYIKTILIVLGFGLSSCNSQTTEVITVVNEEEFNTLLANNSNAQLIDVRTVNEFNNGFINNAENIVYDINFKNKLEA
    LDKTKPVMVY
    CKSGGRSAKASKILEAEGFKIVYDLDGGYDNYRKKAQ

    >gi|298207949|ref|YP_003716128.1| predicted ABC-type Fe3+-hydroxamate transport system, periplasmic component [Croceibacter atlanticus HTCC2559]
    MTIKDQLSRTLLVKTTPKRIVSLVPSQTELLVNLGLEHQIVGLTKFCVHPKGLIKKKTVVGGTKQIHSDKLEALNPDIIL
    CNKEENTKEIVDT
    CEEICPVHVSNVQTLEENYELIKQYGALFNKEPEAETLISKQKSEFSQLTNQLKGVKKKRVVYLIWR
    NPYMTIGNDTFINYLLKIAGFENVFANKSRYPELQLESLKDLAIDYVFLSSEPYPFNEKHFKDFKGIIDKSKLIKVDGEY
    FSWYGSRLLGAATYFKHLRASLGLGL

    >gi|298208019|ref|YP_003716198.1| hypothetical protein CA2559_07195 [Croceibacter atlanticus HTCC2559]
    MSLTPSNMLPLGTKAPTFNLVDAVTKNSYSLEDIKGTKGTVVMFICNHCPFVKHVNDELVRTANDYRVTGFGFVAINSND
    IEKYPQDHPDLMWKTAREENYPFPYLFDATQDVAKAYKAACTPDFFVFDAELKLVYRGQLDNSRPGNGIPVNGRDLRESL
    DNILNNNPQRKDQKPSIGCNIKWKS

    >gi|298208133|ref|YP_003716312.1| hypothetical protein CA2559_07826 [Croceibacter atlanticus HTCC2559]
    MKFITLILALSLSTCGGQTTEPSEAQQKVINVDPVTVPTNNGLEHAYFASGCFWCVEAIYESVKGVEDVISGYSGGHTSN
    PTYEASNTGRTGHAEAVEVIYDPSIVSFSTLVDVYFGSQNVTQVNGQGPDNGSQYRSILFYQNAEEKRILEEKKAEVAET
    VSKPVAAEIYPFQKFWVAEDYHQNYEKLHPEHPYIQNVSKPRYQRFKAKFPELIKENAH

    >gi|298208148|ref|YP_003716327.1| hypothetical protein CA2559_07901 [Croceibacter atlanticus HTCC2559]
    MKKIMTLALVFFIGYAVQAQNGAKIEFKSDVIDYGEIAKGSDGVRSFEFTNTGDAPLVINRVYSSCGCTIPEKPEEPIGP
    GKTGVIKVKYDTKRVGPIRKTITVYSNDAENPTLPLKIKGTILAEENGGKSVLEKTTPRK

    >gi|298208186|ref|YP_003716365.1| hypothetical protein CA2559_08091 [Croceibacter atlanticus HTCC2559]
    MKSIFLLVFMLSSVLIQAQQDDVWLTDYNEAQKIAREKKLPLFMYFTGSDWCKPCIKLKEDYFETSEFLNKTNDFVLLMV
    DRPYRLDIISEVQMEKNKALIKKYNKENTFPLMLLLDYKGKVLKDISGYSGDPRYYRAFINENS

    >gi|298208239|ref|YP_003716418.1| hypothetical protein CA2559_08356 [Croceibacter atlanticus HTCC2559]
    MKAFFATLLVFTTLLSCKTETTTNTQESLPLKTGDWHAVLDVQDGKQLPFTFKVNDNNTLTVFNAEEEINVEDINVEGDT
    ITIQFPVYEGIIKGTFDSTNISAKYIKPSLNRIVNFTATYGKKDRFEIEDEPSVDMTGSWETIFSPGTEDSYVAKGIFIQ
    DGNTLTGTFRTTTGDYRYLEGVVYGNYFELSTFDGAHAFLFSGQVEGDQLKGTFYSGNHFKEPFEAMRNDAYELPDANAL
    TYIKDGYDGLEFTFPNLKGESISLNDDNLKGKVRIIQIMGTW
    CPNCLDETRYYVDYYNAYKTDDLEFLALAFEYAPTKEK
    AFKSIERLKDNANVPYPILLAQYGSADKAKSQEKLPMLNQILSYPTTIFVDKKGVVRKIHTGFDGPATGEKYEVFKREFD
    AFVTELLAE

    >gi|298208294|ref|YP_003716473.1| peptide methionine sulfoxide reductase [Croceibacter atlanticus HTCC2559]
    MKEKTEVATFANGCFWCTEAVFQRFKGVNKVQSGFTGGMIKNPPYREVVSGRTGHAEALQITFNPDIITFKELLYVFFST
    HDPTTLNRQGADVGTQYRSAIFYHSNSQKEMAKAVIKELDADTIFNAPIVTEVTEASEFYVAEEEHQNFYNNHPEYGYCK
    FVIDPKINKIQKYFSDKLN

    >gi|298208397|ref|YP_003716576.1| organic hydroperoxide resistance protein [Croceibacter atlanticus HTCC2559]
    MKTLYTATAIAEGGRSGHVSVDDGPIDLDLSVPKSMGGDGGDGTNPEQLFGSAYAACFGGAIQAIADKKKIELDEISVTA
    HISFNKDDDGGFLLSAVLDAYLPGVDQETGEDLINSAHEI
    CPFSKATRDNIDVELNLLMDE

    >gi|298208409|ref|YP_003716588.1| probable arsenate reductase (glutaredoxin) [Croceibacter atlanticus HTCC2559]
    MITIYHNPRCSKSRDGVKVLEESGKEFKTVKYLDDNLSFQELTEIIGKIGIQPIDLVRKNEKIWKEDYKGKDLSKTDIVN
    AMVNNPKLIERPIVVTDYGAVIGRPSEKIEELLDKPNQEPI

    >gi|298208542|ref|YP_003716721.1| putative exported cytochrome C biogenesis-related protein [Croceibacter atlanticus HTCC2559]
    MAFLKNGLLFLFFLVSVSTQAQFGNTEIFEPVEWSTSISKKGDIYEVSIKAIIDEGWHLYSQNEVEAGGPIPTEFSFPNA
    DGNFEVLYSTKEPEGKELFDPVFEMDIKYFEDEVTFTQDIKFINSPIAVEAEVFFMVCDDERCLAPQSVPFVITLDGSKA
    NTPIGNVSPEDIAKSEALDIDVKGFENYEAEDTEESSNLTIFFLGFIGGLIALLTPCVFPMIPLTVSFFTKGAKNRKQGL
    TNAILYGLFIFVIYLLLSIPFHLLDSLDPEILNNISTNVTLNVIFFIIFIVFALSFFGYFELTLPQSWSAKMDDKANSVG
    GIIGIFFMALTLAIVSFSCTGPILGSLLGGSLTSDGGAMQLTFGMGGFGLALALPFALFALFPNWLNSLPKSGGWLNTVK
    VVLGFIEVALAFKFLSNADLVQHWGILKREIFIGIWIIVAIGLALYLFGIIRFPHDGPKKRPHKTRIGLGILTLLFAMYL
    LPGLTNTAYANLKLLSGFPPPLFYSIYNKETEGPLGLEAFKDFEEGLAQARITNKPILLDFTGWA
    CVNCRKMEEQVWSIP
    QVYDHIKNDYILISLYVDDDKELEASEQFKYIKPNGSLKTIKTIGNKWATFQTLNFKNNSQPYYVLLDGDLNLLNKPVGY
    TPNGTEFEAWLAEGLKTFNENSK

    >gi|298208813|ref|YP_003716992.1| putative thioredoxin reductase [Croceibacter atlanticus HTCC2559]
    MSETTERIKCLIIGSGPAGYTAAIYAARADMNPIMYTGMEPGGQLTTTTEVDNFPGYPEGIDGPTMMVQLQQQAERFGTQ
    VRIGMITEVKFATEKGGIHKAQVDGDKWIEADTVIISTGASAKYLGLESEQRLRGGGVSA
    CAVCDGFFYKGQDVAIVGGG
    DTAAEEATYLSKICNKVTMLVRKDEMRASKAMQHRVTNTKNIDLRYNTEIDEVLGEQVVEGLRMKNNQTGEKETIDITGL
    FIAIGHKPNTDIFKGQIDMDNTGYIVTKPKTTETNIPGVFASGDVQDKEYRQAITAAGTGCMAALDAERYLADVGAIEEV
    STTTNW

    >gi|298208897|ref|YP_003717076.1| probable copper-transporting ATPase [Croceibacter atlanticus HTCC2559]
    MKNKLAVTSILTAITASLCCITPVLALIAGTTGVASTFSWIEPFRPYLIGLTILILLFAWYQKLKPEKEIDCECETDEKP
    KFMYSKTFLGIVTAFAIVMLAFPYYSSMLYPKTEKQIIIVNNSNIKTTEYKISGMT
    CASCEAHVNREVNKLNGIVNSKTS
    YENANAIIEYDKTKTNETEIEKAINATGYKVTDKK

    >gi|298208907|ref|YP_003717086.1| heavy-metal transporting P-type ATPase [Croceibacter atlanticus HTCC2559]
    MTMKHTYHIHGMTCNGCRNHVEQTLSKIEGVTNASVDLEKAEATIEMQAHIPIEKFQDALKADGGRYSIHQNGEHHHTHD
    KKKVEQPKAKGTGTFYCPMHCEGDKTYDQPGDCPVCGMDLVEEVNLKATSNTQYTCPMHPEIVKDELGSCPICGMDLVPM
    EPDLSAEEKTYKNLLKKFWIAVAFTLPIFIIAMSEMLPNNPLYDVLELKYWNWIQFALSIPVVFYATWMFFERAYRSIKT
    WNLNMFTLIGIGAGVAWLFSVFGMLVPDFFPNQFKTEAGTVHVYFEAATVILTLVLLGQVLEARAHSKTNSAVKELLKLA
    PNKAVKVVDGEEQEVAIDEIELGDILRVKPGDKIPVDGVITEGETSIDESMITGEPIPVNKSTDDKVSSGTINGNQSFLM
    KAEKVGSDTLLSQIIQMVNDASRSRAPIQKLADTVSGYFVPIVVIIAAVTFGVWAIWGPEPAYVYALVNAIAVLIIACPC
    ALGLATPMSVMVGVGKGAQNGVLIKNAEALEKMDKVDTLIVDKTGTITEGKPTVETVGSFDSKITENEVLQFIASLNSQS
    EHPLAEATVKYGKEQNAEFLKADGFNAVTGKGVEGKVNGNEVALGNAKMMEQANATLTEAMENEAQSYQKQGKTVSYLAI
    DANIVGYVVIGDKIKETSAKAIKDLQNKGIAVIMLTGDNHDTAKAVADELNLADFQASMLPENKLQEVEKLQEQGKVVAM
    AGDGINDAPALAKSDVGIAMGTGTDVAIESAAITLVKGDLHGIVKARNLSDAVMRNIKQNLFFAMIYNTLGIPIAAGLLY
    PFFGILLSPMIAALAMSFSSVSVIANSLRLKSKNI

    >gi|298208917|ref|YP_003717096.1| hypothetical protein CA2559_11773 [Croceibacter atlanticus HTCC2559]
    MRYITYLVIGIFFGIIMFKSEAASWFRIYEMFQFGSFHMYGIIGSALVLGIIGIQVIKRKNIKPLNGSEMSLKPKNKSII
    RYLVGGIIFGLGWALAGA
    CPGPMYVLAGAGYASILVVIFGAIAGTFLYGLIKEKLPH

    >gi|298208918|ref|YP_003717097.1| hypothetical protein CA2559_11778 [Croceibacter atlanticus HTCC2559]
    MYWIYQPWPWYVAGPLIALVMFVLLLVGKQFGMSSNLRTACAAVGAGKAADFFKFDWKAERWNLMVVLGAIIGGFIASNY
    MSDNTVEINPEIAQQLSNDYQIESAGEAYLPPEIFSTDALGDPFIIAILLIGGLLVGFGARYAGG
    CTSGHAISGLSNLQL
    PSLIAVIGFFIGGLVMIHLIYPLIF

    >gi|298208924|ref|YP_003717103.1| thioredoxin, putative [Croceibacter atlanticus HTCC2559]
    MNTKKENKNKKKPWIQYGIFAIVAISLYTTGLHTEVIGFAQRGLLATGLMNPDIEEIAQVRKNDKNNDEASMPNLTKADL
    NLKLIDAEGKKRSLKEFKDKVIFLNFWATW
    CPPCIAEMPTIDKLHEEMGDEVAFILLSFDDDFEKAKAFNKRKGYDLPIY
    APASNLPAMFQSSALPTTYVIDADGNMALTHKGMADYSDPKFKDFILDLKK

    >gi|298208926|ref|YP_003717105.1| conserved hypothetical rhodanese-domain protein [Croceibacter atlanticus HTCC2559]
    MKKYIIIMTLLSTLFGANGQSNKAIKILTATEYYNAISNNDVQLVDVRTEKEYNEGAIENALNIDFFQQENFNSKFNKLD
    KEKPVYLY
    CRSGNRSLQAAKKLDLLGFKKIYDLKGGYMGWPYKKY

    >gi|298208980|ref|YP_003717159.1| hypothetical protein CA2559_12088 [Croceibacter atlanticus HTCC2559]
    MSTLKIHNAETAPEESKPLLEKSQKAYGMIPGLHGVLAGAPGLLEAYQTLHELFTNSSFNNDELTVVWQSINVEHGCHYC
    VPAHTGIAKMMKVDDAITDALRNETELPTEKLEALRTMTLSVVKNRGNVSDEELKAFYDAGYGERQLLEIILGLSQKVIS
    NYTNHIAETPVDDAFEKFAWEKTSK

    >gi|298208981|ref|YP_003717160.1| hypothetical protein CA2559_12093 [Croceibacter atlanticus HTCC2559]
    MSKQLKIDIVSDVVCPWCIIGYKRLEQAIKELNVEEQVTIEWQPFELNPNMPKEGQLVQEHISEKYGASLEDQKQSQERM
    TQFGAELGFTFNYHDALRMVNTKDAHIVLEYANEQHKQTELNLELVSLFFSEGKDISEKTILLDAVETVGLNKTEAEQRL
    DDVSYKNAVVAKEIKWQDLGVTSVPTMVFNHKSALSGAQPVSVYKDVLKELLEL

    >gi|298208991|ref|YP_003717170.1| NADH:ubiquinone oxidoreductase, Na translocating, E subunit [Croceibacter atlanticus HTCC2559]
    MEHLELFFKSIFVDNMVFAYFLGMCSYLAVSKKVSTAVGLGAAVIFVLTVTVPLNWLLDQYVLQEGALTWLGPEFADYDL
    SFLSFILFIATIATMVQLVEIVVEKFSPSLYTSLGIFLPLIAVN
    CAILGGSLFMQSREIETFTLALNYGFSSGIGWFLAI
    LAIAAIREKIRYSNVPAPLRGLGITFIITGLMAIGFMSFGGMLTGGDGETPSTEGTPDDLGVKIEESVKTNETAEVSNIT
    IK

    >gi|298208992|ref|YP_003717171.1| NADH-ubiquinone oxidoreductase [Croceibacter atlanticus HTCC2559]
    MALLSKKDRGLILDPLADDNPITIQVLGICSALAITAQLKPSIVMAISVVFVLGVGNVVISLMRNIIPSKIRIIVQLIVV
    ATLVIIVDQVLKAFAYELSKELSVFIGLIITN
    CIIMGRFEAFALGNGPWRSFLDGIGNAAGYGLILIIVGFFRELLGSGT
    LFGFKVLGDSVEKTGLYAIGYENNGFMVLPPMALIVVGIIIWVQRSKNKALIEEN

    >gi|298209027|ref|YP_003717206.1| bacterioferritin comigratory protein, thiol peroxidase, putative [Croceibacter atlanticus HTCC2559]
    MTTLSAGDKAPDFKAVDQDGNTHTLQDYKGKKLVVFFYPKASTPGCTAEACNLRDNWTTFQSQNYAILGVSADSQKRQSN
    FKTKHELPFPLLADEDKSVINAFGVWGPKKFMGKEYEGIHRTTFVIDEEGVISEVIQKVKTKAHAEQIL

    >gi|298209034|ref|YP_003717213.1| carboxymuconolactone decarboxylase [Croceibacter atlanticus HTCC2559]
    MINMVDEFNSYRSKMNDKILNEDNKVIKRIFNLDTNAFAEGALDVKTKELLGLVASLVLRCDDCVKYHLESSFNQGVTKA
    QIMETLSIGTLVGGTIVIPHLRRAYEYWEILETSEA

    >gi|298209052|ref|YP_003717231.1| putative methionine sulfoxide reductase, SelR [Croceibacter atlanticus HTCC2559]
    MSCGNAQKKDSAKTENTYEVSKTNAEWKEVLSSEEYHILREAGTERPFSSELLDIKEEGTYVCAACKTPVFKSEHKFDSG
    TGWPSFDREIDGNVAFSTDNKIGYTRVEEHCAVCGGHLGHVFNDGPKNTTGKRH
    CINGDALDFIPSTK

    >gi|298209053|ref|YP_003717232.1| SelR-like methionine sulfoxide reductase [Croceibacter atlanticus HTCC2559]
    MSTNYNINKTEEEWRKELSPEQYHILREAGTERPHTGKYNMHFEDGEYHCAACNTKLFDSDSKFESGCGWPSFDNAIDGA
    IEYKQDKTLGMIRTEILCANCGGHIGHVFDDGPTETGQRY
    CVNSASINFNK

    >gi|298209055|ref|YP_003717234.1| dihydrolipoamide dehydrogenase [Croceibacter atlanticus HTCC2559]
    MSKYDVIVLGSGPGGYVAAIRASQLGLKTAVIEKENLGGVCLNWGCIPTKALLKSAQVFDYLKHAEDYGLSVENPDKDFT
    KVVKRSRNVAEGMSKGVQFLMKKNKIDVIDGFGTLKTGKKISVEGKDGKKDYEANHIIVATGARSRELPNLKQDGEKIIG
    YRQAMNLPKQPKSMIIVGSGAIGVEFAHFYNAMGTEVTIVEFLPNLVPVEDEDVSKQFEKSFKKAGIKVMTNSSVESVDT
    SGDGVKAKVKTKKGEETLEAEIVLSAVGIKTNIENIGLEAVGIKTDKDKILVNDWYQTNIPGYYAIGDVTPGPALAHVAS
    AEGIICVEKIAGMKVEALDYGNIPGCTYATPEIASVGMTEKQAKEAGYELKIGKFPFSASGKASAAGTKDGFVKVIYDAK
    YGEWLGCHMIGAGVTDMIAEAVLGRKLETTGHEVLKAVHPHPTMSEAVMEATAAAYDEVIHL

    >gi|298209089|ref|YP_003717268.1| hypothetical protein CA2559_12633 [Croceibacter atlanticus HTCC2559]
    MDFIYDTWPWYVSGPLIALVMFLLLFAGKSFGMSSNLRTMCSAMGAEKFADFFKFDWKANIWNLTVVLGVVIGGFLASTF
    FSNNVVTINPVIATQLQEDYNFNSVNSSYLPKEIFSAEALDNPFNILILLIGGLLVGFGARYAGG
    CTSGHAISGLSNLQT
    PSLIAVIGFFIGGLLMIHLLFPLIF

    >gi|298209102|ref|YP_003717281.1| hypothetical protein CA2559_12698 [Croceibacter atlanticus HTCC2559]
    MDFEKITFINADGQELSGRLELPVNKQPHNYVLFAHCFTCTKNFSATKNISRALTNEGFGVLRFDFTGLGDSEGDFENTN
    FSGNVEDLVCAANWLRDHKQAPTLLVGHSLGGAAVIFAKEQLPNVKAVVTIAAPSNPTHVKNLLKSNIEEIEEQGEATVN
    LAGRDFKIKKQFLDDLETKSLPQIVSKLNAALLVLHSPQDTTVGIINAEEIYKSAKHPKSFITLDGANHLLMEKEESTYI
    GKVIAGWSSRYLDIKQETFVVNSTHQVVASLDAESGFTTQLKLGNHYSQADEPKTVGGKDLGPTPYDLVSGGLSA
    CTAMT
    IQMYAKRKKWHVSNVEVHTSYSRDHAIDCETCEADDMKIDTFKREIKLEGELDDKQIKRLLQIADKCPVHKTLHSKTQVI
    TTLIE

    >gi|298209130|ref|YP_003717309.1| hypothetical protein CA2559_12838 [Croceibacter atlanticus HTCC2559]
    MNRALLYVLIILCSHFIAASQTRNNLFSEAIATHLTKYNKKINKAYEAKDYERAEFMFDSLVKHHLRGTYLDNFKVDCLA
    KSIDCFDDYKKPMFLVTYASW
    CVPTEGEIPAINELAKKYKKDIDFVVLFWDKKTNVRKSSKKYNKHVDILYVDELENSND
    NIVKKMKHSLGFPTSFYLGSDKKIIDIKRTVFHPLHISYSESYNLNYNTISQGLSLLLSEEAKKQDQPLYGY

    >gi|298209146|ref|YP_003717325.1| hypothetical protein CA2559_12918 [Croceibacter atlanticus HTCC2559]
    MKKGILVMFAAAAMVFTSCKENAADKVNEENVAAAAERDAQAGDFPVMEFSKTEHDFGTINEGDVVEHEFTFTNTGKAPL
    VVTNAKGS
    CGCTVPTWSKEPIAPGAEGKMLVKFNSNGKPNQQVKTVNITANTEAGKELIKIKAFVTPKKKAAGTPEAK

    >gi|298209204|ref|YP_003717383.1| thiol:disulfide interchange protein [Croceibacter atlanticus HTCC2559]
    MKKILLIATIALCFSCKKDTGYAVNGTIDESFNGKKVYISHLEENNATTKIDSAVIAEGKFKLDPQDTERQYLAFLNIEG
    ISLNLPFIAENEAISMTVYKDSLRQSVIKGGAQNKVFKDYLNHLTETNKRISEGTQKAREAMSQGDTATISSIKMEREEI
    IENDKLYKINVAKEHKTSLVAVLALTDLTNLKTISSIEAKEMFDELSDEVKTSSLGKNLSKMLSARSATDIGAKAPDFSG
    PTPNGETLSLKDALGKVTILDFWASW
    CKPCRIENPNVVRVYEKYHDKGLNIVGISLDKSTQKERWLKAIEDDNLTWQHVS
    NLQFWQEPIAQQYGVRSIPATFILDENGVIIAKNLRGKDLEDKMAELLN

    >gi|298209260|ref|YP_003717439.1| hypothetical protein CA2559_13488 [Croceibacter atlanticus HTCC2559]
    MVRSKNKHIKQNVKFSVMKYLGIILICFSVGIGTLKAQQFPEKALNDTFLNEDETVISLSEVLETYKGKTILIDIWATWC
    RD
    CIVGLPKLEALQQNFPDVAYVFISFDRSVENWKMGIEKYNLNGHHYFSKNGWKSNFAAAIDLDWIPRYIVVNSSGEIS
    LYKAIKADDPKLIKALQE

    >gi|298209285|ref|YP_003717464.1| putative peptide methionine sulfoxide reductase MsrA [Croceibacter atlanticus HTCC2559]
    MSTLLKFGFGGGCHWCTEAVFKQLKGVYKVLQGYIASTSPFSNFSEAVIVCFNPSEISLKDLIMVHLNTHASTKDHSFRD
    KYRSAVYYYSLNDKPYIKRLLEDLKREDNKAYITKILKLESFKESRESIRDYYTKHPNAPFCNRYILPKFKILKNNYSSL
    TFKGFDLENDI

    >gi|298206817|ref|YP_003714996.1| YpmQ [Croceibacter atlanticus HTCC2559]
    MKRKYSYIGLGIIILIFGIIVIPKIIETLSEGTVVKENRTESVKNSDLAFVTRDGEKRKVPPFKFINQDGDTITNQDYIG
    KVYVAEFFFTS
    CPTICPIMNSNLVAVDQEIGDENFGIASFSIDPRKDTPEVLKDYEKQYGITNPNWNLMTGDRDAIYDLA
    RTGFTIYAEENPEVPGGFEHSGYFALVDQEGYLRSRKDEFGNVIIFYRGSVPQGIDPTQADEEPQIDILIEDIKILLDHG
    NKN

    >gi|298208984|ref|YP_003717163.1| putative thioredoxin family protein [Croceibacter atlanticus HTCC2559]
    MRLTFFILVLCVTLMSCGHQKTAVESTATPTETTAKVDSIMVKTPSSILTKEDFMNAPYGDWFSPRYEDYSINAETAAAI
    SKYINDYDIKVFMGTW
    CSDSKRETPKLYKLLEESGYNMANLEVISVDRKKVTPNNLQEGYNIIKVPTIIFSKNGKEVNRF
    VEYAQETLAEDILKIVSGQPYKHSYAE