Coxiella burnetii RSA 493 uid57631

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|29653426|ref|NP_819118.1| rhodanese domain-containing protein [Coxiella burnetii RSA 493]
    MKEHSPSFVALAKEAKSHIEETDIYTVKKMMDNEEDFELVDVREESEWDEGHLPSAIHLGKGIIERDIEKVIPNRNRKLI
    LY
    CGGGFRSALAAESIKKMGYKNVLSMDGGFRAWREAGFPIIMD

    >gi|29653786|ref|NP_819478.1| methylated-DNA-[protein]-cysteine S-methyltransferase [Coxiella burnetii RSA 493]
    MSDAVCYQATVSTPVGKIGVRTSDDHLLGIDYLYDDSILVKPKTILAKETVEQLLCYFADPEFPFEIPIALGLTPFQETV
    LNALRTIPVGTTRTYAQLAEQLDTRARPIGNACRKNPIPIIIP
    CHRVVAATHLGGYSSATKGKLLAVKQWLLQHESASFE
    SNLGEKLKKTK

    >gi|29653799|ref|NP_819491.1| thioredoxin [Coxiella burnetii RSA 493]
    MAIMELTQSNFDNVVSQHDLIIIDFWANWCAPCLTFTKIIEEVEKDYPEVVFGSVNIEKEKRLAEEFNVKSIPAVMILRD
    RVVVFAESGALPREGLRELIEKAKDLNTDILREAQKQKARE

    >gi|29653807|ref|NP_819499.1| dihydrolipoyl dehydrogenase, E3 component of pyruvate dehydrogenases complex [Coxiella burnetii RSA 493]
    MTKEIKTEVVVLGSGPGGYAAAFRAADLGKKVVLVERYETIGGVCLNVGCIPSKALLHVAKVIDDAKDMSSFGIDFGKAA
    LEIEKIRSWKENVVKKLTGGLKMMAKQRKVEIITGYGKFSSSNELAVENKEKSVTKIKFDQAIIAVGSLPVKLPFIPDDP
    RIMDSTGALELEDVKGHLLVLGGGIIGLEMATVYHALGTKISVVEMMDQLIPGADADVVKPLHQRIQKRYEEILLKTKVT
    KIEPKKDGLYVTFEGENAPKEPKKYDRILVAVGRSPNGKLIDAEKAGVKVDDKGYIAVDKQMRTNVSHIYAIGDVVGQPM
    LAHKATYEGRLAAEVIAGIKHYNDARCIPAVAYTDPEVAWVGLTETQAKEKGIKYEKGVFPWAASGRALSLNRSEGSTKL
    LFDEKGTVIGGGIVGVNAGDLISEVALAIEMGCDAEDVGLTIHPHPTLSETVMMACEMFEGTITDLIPPKKKDK

    >gi|29653921|ref|NP_819613.1| glutaredoxin family protein [Coxiella burnetii RSA 493]
    MRVHEEIQQQVTSNPVVLYMKGTPDFPQCGFSGRVVQILRQCKIDFTSFNVLESPELRQGIKEFSSWPTIPQLYIKGEFI
    GGCDIVGELFETGKLQELL

    >gi|29653925|ref|NP_819617.1| thiosulfate sulfurtransferase [Coxiella burnetii RSA 493]
    MMYKQISHLEAWELVKKRDIVIADVRDQDSYEEEHIANALHLSMAKLQEYSEKADKEKPVLVYCYHGISSQSVAQHLVEQ
    GFKEVYSLIGGFETWKAHHPTSDANKN

    >gi|29654053|ref|NP_819745.1| thioredoxin reductase family protein [Coxiella burnetii RSA 493]
    MPIERVDVAIVGGSFSGLSAALLLGNSLRNVIVIDDNQPRNLKSAHAFNLLGNEQTKPLTFLKRAHKEVQQLETAQVISG
    NIKSISCINNRGFTLQLQNGPRIESRKIILATGVVDELPAIKGIETFWPDNIFH
    CPYCIGYAVKNEPLAVYSTEEEAYVL
    ALIIHKWTSDFILFTDGHEVLSDPQLEHLKDLGIRVYSQKISQFTGVRGKFIVAHLSDQQQIKRRGIFMHLKFKQRAPNL
    IADLGCSYNEENLLHVNEFFKTSVDGVYAIGDIALKVQKMTTAIASGSVAAFAVDHELTDEMAVFA

    >gi|29654202|ref|NP_819894.1| ThiF family domain/MoeZ/MoeB domain/rhodanese-like domain protein [Coxiella burnetii RSA 493]
    MTLTSNDIQRYARHLPLIGREGQAHLFAARILCVGAGGLGASVLQYLAAAGIGTIGIVDGDQVELSNLQRQVIFSPEDIG
    KNKALVASRYLSRFNPSLKTIVREEFLNEDNATKILKDFELVIDCSDNYRTRYLLNDICIQLKKPLISASIYQFQGQCSV
    FNYKEGPCYRCLYEEPPPEELIPN
    CALGGVLGVLPGILGCIQATEALKIILDKGEVLSGRLLTIDALSMRTREFRVPKNP
    QCPCCYEGKSALDLFLNTDNSKKIREIEAQKLAQWLENQNDNLLLIDVREPYEREICHIGGQHIPLRELDARQANLPRNK
    FIICY
    CKSGQRSRRAVQLLMDNGFTNVSSLQGGIMAWISSIDHSLTKY

    >gi|215919064|ref|NP_819905.2| putative disulfide bond formation protein D [Coxiella burnetii RSA 493]
    MSAIALALSKPAALKATTIDTKGQPTLGNPAAPVHIVAFEDLKCPNCARFNVEVLPAIKKKYINTGVAKYILITLAFLPG
    SPPAGNAALCLYKQNKNYFFPFVSYLYQHQPDETQNWATIPRLLQFARNSVPQANMKQLSNCIFSSRYSGALQKNLKIAE
    KTMNPVATPAVYVNGVNVEPLTQKRLEALIKGARSRAKN

    >gi|215919071|ref|NP_819955.2| rhodanese-like domain-containing protein [Coxiella burnetii RSA 493]
    MLETEKCTKIFLSFSLNSRRIIMNLSLTQDPQKAKEFFEKKMAFTTGPVEVSGMLKKNAKIQVVDVRAAEDYKKGHVPGA
    INLPSNEWEKAAEKLDKEKTNIIY
    CYSQVCHLAAKAAVKFAEQGFPVMEMEGGFKTWTEHKLETEK

    >gi|215919074|ref|NP_819971.2| antioxidant, AhpC/TSA family [Coxiella burnetii RSA 493]
    MPYLIPYCKFDSTFSQFLLRRKTMSIEVGQKAPIFTLPTDEGEMLSLDDLKGKKVILYFYPKDDTPGCTKEACGFRDVWS
    QLSKAGVVVLGISKDSVKAHQSFKQKYNLPFTLLSDKDNTVCEQYGVMVDKNRFGKKYKGIERTTFLIDEEGVISAVWPK
    VKVDGHVAEVVGRL

    >gi|29654319|ref|NP_820011.1| putative biotin biosynthesis protein BioC [Coxiella burnetii RSA 493]
    MMVNSLKKRIQRSFNKAFDTYDDHASIQREICKQLLKPLKEMRIQTKIIADFACGTGISTKAVADSFPYQNLYAIDFCEK
    LLIQAKSKLKESNVEFILADFETNVFLCNSLDLIFCNMGFQWALDLKQTFFSLFSQLKAFGVLAFSVPLLGTFCELRND
    C
    RNPFLTLQSIVQLLKAVGFELLTADEKIFTDSFESPLDAIRSIKSIGANCLLYPKRNKGLSPMPIEKNNTDTTLTYHIGF
    FIAKKIIQ

    >gi|29654496|ref|NP_820188.1| thioredoxin-disulfide reductase [Coxiella burnetii RSA 493]
    MNKPQHHSLIILGSGPAGYTAAIYAARANLKPIMITGMEQGGQLMTTTDVDNWPGEAPGLQGPQLMERMQKHAERLDTQF
    IFDHINEADLNQRPFLLKGDNATYSCDALIIATGASARYLGLPSEKAYMGKGVSA
    CATCDGFFYRGKKVAVVGGGNTAVE
    EALYLSHIASHVTLIHRRDKLRAEKMLSAQLIKKVEEGKVAIVWSHVIEEVLGDDQGVTGVHLKHVKEEKTQDLTIDGLF
    IAIGHDPNTKIFKEQLEMDEAGYLRAKSGLQGNATATNIPGVFAAGDVTDHVYRQAITAAGMGCMAALDAERYLDSLNQA


    >gi|29654579|ref|NP_820271.1| antioxidant, AhpC/TSA family [Coxiella burnetii RSA 493]
    MALTPSKMIPLGTKAPDFNLPDAVSGKKMSLAQLKSNKATVIMFICNHCPFVQHIQEKLVEVAKEYQAKGIQFIAINSND
    IENYPEDSPEKMKITAEEFDYPFPYLFDESQEIAKAYQAECTPDFYVFDKNLACVYRGRFDSATPGRDTPVTGEDLRSAL
    DNILAGNLVDPNQQPSQGCNIKWKK

    >gi|29654606|ref|NP_820298.1| bifunctional methionine sulfoxide reductase B/A protein [Coxiella burnetii RSA 493]
    MDKRSSLPPIVRHITCDQMTEPAFQGEYTDLKETGRYLCRQCGIALFRSQDKFHSGCGWPSFDATIAGTIKRLPDPDGQR
    IEIRCERCGAHLGHVFEGEALTPKNTRY
    CVNSLSLDFVTDSQIRDTEEAIFAGGCFWGVEYYFKRLPGVVKTEVGYTGGH
    KNNPTYKEVCSRTTGHVEAIRVLYDPQQINYEKILHYFFEIHDPTQTDGQGPDLGDQYHSVIFYYDNQQKRMAEMAIKVL
    TEKGYRIATRLAPVSIFWRAEDYHQDYYQKTGKQPYCHHYVKRF

    >gi|29654652|ref|NP_820344.1| FeS assembly scaffold SufA [Coxiella burnetii RSA 493]
    MTQAETIIEFTKAAYTHIQSLIKKRTEHSFFRLSIKKTGCSGYMYQPEIVENPKENDVLMKTAIGLSVAIDPKCLHMIKG
    TVVDYVKKDLGQYQLHFNNPNAIGACGCGESFHLKEE

    >gi|29654768|ref|NP_820460.1| anti-oxidant AhpCTSA family protein [Coxiella burnetii RSA 493]
    MIKIGEQFPSFSLKAVISNDVNKAFTEINEKSYANKWLVLFFWPKDFTFVCPTEIAEFGRLNGEFADRDAQVLGASVDSE
    FVHLAWRREKEELSQLPFPMLSDIRRDLSQRLGILNEKEGVAERATFIVDPNHIVRFVMVNDLNVGRNPQEVLRVLDALQ
    TDELCPCNWQQGEETIVVA

    >gi|29654798|ref|NP_820490.1| copper-exporting ATPase [Coxiella burnetii RSA 493]
    MLMNTTKHQLTLKNMHCASCVASIESALKSVAGVKSVSINFATKQAEVEGDVDVKTILKAIKDQGYEAEIAGDDEEAQNE
    AQSHFRDLLKKAIFAAVVGFPLMINEFWAWLPSVNQPRIQWVWVIIGVLSFFVLYYCGGHIYRGAWRAFLKRQTNMDTLV
    AMGTGTAWLYSFVVVLIPMWIPPMARHAYFDTSTILIAFITFGAALEIRARGKTGEAIKRLIGLQPKTARVIRDDQEIDI
    PIAEVQIDDHLRVRPGEKIPVDGKIIKGASPIDESMLTGEPLPVVKSQGDEVIGGTINKSGTFIYRATRVGKDTALAQII
    ALVKRAQNSKPKIGRIVDKVSAVFVPVVIIVAILTAIGWLNFGPEPKAAFVLITTVAVLVIACPCALGLATPISIIVGVG
    KGAEMGVLIRNGDALQMASQLTAIILDKTGTVTEGKPMLSDFYTADGFDEKKLLSIAASVEKGSEHPLANAIIEGAKKYN
    IPLAKATQFESIAGHGVKAKIENQSILLGNLHLMKNEKVELGGAPAHAERMADQGQTPIYIALDGKIAGIVSIVDPIKPD
    SQKAIADLQRAGLKVVMVTGDNPLTANAVAKQVGIEQVIAEVLPEDKAKKVKLLQQQGERVAMVGDGINDAPALAAADVG
    FAIGTGTDVAIESADIALISGSLTGVVNAISISRATLRNIKQNLFGAFIYNTLGIPIAAGVFYPLTGLLLSPIIAGAAMA
    LSSVTVVANANRLRFFRRRKRT

    >gi|29654803|ref|NP_820495.1| rhodanese domain-containing protein [Coxiella burnetii RSA 493]
    MKIVNIAAYKFVTILNESLPTLQKQLREKALECNLKGTILLSTEGVNLMMAGQREAIEIYKQFLADKKEFKDLTYKKSFS
    SFYPYEKLVVRIKKEIITMHCADINPEKETAPHLSPEILHRWYEEKQEMVILDTRNRFEFVMGTFANAIDLNLTSFSDFP
    QAVDSLPESFKEKPVVTF
    CTGGIRCEKASALMLKKGFKKVYQLDGGILNYFEKCGGEYFKGKCFVFDDRIALEAGSS

    >gi|29654811|ref|NP_820503.1| glutaredoxin [Coxiella burnetii RSA 493]
    MAKIEIYTTARCPYCVRAKALLDRKGLDYMEIRIDEAPEKRDEMLSRSEGRRTVPQIFINGRGIGGFDELWELEQSKKLD
    ELLKT

    >gi|29654812|ref|NP_820504.1| rhodanese domain-containing protein [Coxiella burnetii RSA 493]
    MVTMEQLPEFIARHWLLVAAFIVALMALLIVEARSKGLSGKYRLTPQHAIRLINSEKAVIVDIRDANAYSKGHITNAINI
    PATELDKHPQRLEQYKQQPIILV
    CAMGQKSGPLRNKLHKKGYEKVYLMIGGMNAWNSANMPIVK

    >gi|29654995|ref|NP_820687.1| anti-oxidant AhpCTSA family protein [Coxiella burnetii RSA 493]
    MAVLVGREAPDFTVPAVLANGDIVENFNLAEAIQNKYGLVFFYPLDFTFVCPSELIALDKAIADFQKRRVEVIGVSIDSQ
    FTHNAWRNTPVEKGGIGPVRYPLASDVTHSICRSYGVEHVAGVALRGAFLIDKQGIVRSQIVNDLPLGRSIPELLRLVDA
    LQFTEEHGEVCPANWKKGDPAMQASPDGVAKYLAENADNL

    >gi|215919238|ref|NP_820704.2| thiol:disulfide interchange protein [Coxiella burnetii RSA 493]
    MSLKKPPKGTSFWHGCRNDVRKRAPVVHFIVEMCLDKSMIRRLITLLVLFFLPIYALSEQPVPVDQAFQFSAMAKDYQTV
    IGLWNIKPGFYLYRNRIHFSSLKSADYLGEPLWPRVDTVKDYPGIGKLPVYQGQLRISVPVIKAMNQTLYLKVDYQGCSE
    KGFCYPPTTKTVAIDLAGNYMQPVAPLAIDIAPGKTAGPKAAPPITQQDRVTQLLTHKNLFFVLLSFFGFGLLLSFTPCV
    LPMIPVLSGIIVGQQKYPKRAFGLSLMYVLGMAITYAIAGVIFGFIGSTVQAAFQNPWLIGLFSLLFIAMALSLFGLYDL
    QLPQRWQTRLAQASDRQKHGTYLGTALMGALSTLILSPCVTPALVGVLGYISHTGNASLGGVALFTMGLGMGAPLLLLGA
    FSRKWLPKAGPWMTVIKHILGVLMLAVAVWLLARILPGTVTMFLWAALAVGSAIALGALSTTQTKMQKIGKTLGLFLLVY
    GIVLATGGLSGNTNPLRPISLASLPEKGEGPSFTAVYTLPDVEHQLKMATTKGQPTMIDFYADW
    CISCKQMEQFTFANQN
    VQKALAGFRLLRADVTRNDQGSTVLEKHFGVVAPPTVLFLDPQGKEIPNSRIVGEMSAFRFLKHLENLRS

    >gi|29655163|ref|NP_820855.1| iron-sulfur cluster insertion protein ErpA [Coxiella burnetii RSA 493]
    MDNLLMNALAQKTPSPPTLVFTEAAVRKVKGLIDEENNPYLNLRVFITGGGCSGFQYGFTFDEAINSDDLVIEKQLEEED
    DDEGGTGQMALVKLLVDPLSLQYLQGAEIDYREDVSGAQFVIRNPNAKTTCGCGSSFAA

    >gi|29655195|ref|NP_820887.1| outer membrane protein [Coxiella burnetii RSA 493]
    MKNRLTALFLAGTLTAGVAIAAPSQFSFSPQQVKDIQSIVHHYLVNHPEVLVEASQALQKKTEAQQEEHAQQAIKENAKK
    LFNDPASPVAGNPHGNVTLVEFFDYQ
    CGHCKAMNSVIQAIVKQNKNLRVVFKELPIFGGQSQYAAKVSLAAAKQGKYYAF
    HDALLSVDGQLSEQITLQTAEKVGLNVAQLKKDMDNPAIQKQLRDNFQLAQSLQLAGTPTFVIGNKALTKFGFIPGATSQ
    QNLQKEIDRVEK

    >gi|29655365|ref|NP_821057.1| thioredoxin [Coxiella burnetii RSA 493]
    MSEHVHTASDENFETEVLQADMPVLVDFWAEWCQPCKMISPVVEEIAKEYAGRVKVFKLNVDENAQTPTKYGVRGIPSLL
    IFREGEVVDRKVGALNKSQLAAFLDESLHFSS

    >gi|215919190|ref|NP_820461.2| alkylhydroperoxidase [Coxiella burnetii RSA 493]
    MKRSEIRERHHNFPYFASLHTGYVRRINMLQTYKDQLPDYAKDLKLNLTQVLSESPSSELSNQQITGVALAVAYATRNRQ
    LIELIFQKAEAELDESTLQAIKAAASIMAMNNIYYRFVHLVKDSEYQRLPANLRMNIIANPGIDKKDFELYSLAVSAING
    CGL
    CIDAHANTLIKAGFSKHSIQHVIRIAAVLNGLAQVSIIENKT