Coxiella burnetii RSA 331 uid58637

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|161830710|ref|YP_001596019.1| rhodanese-like domain-containing protein [Coxiella burnetii RSA 331]
    MKEHSPSFVALAKEAKSHIEETDIYTVKKMMDNEEDFELVDVREESEWDEGHLPSAIHLGKGIIERDIEKVIPNRNRKLI
    LY
    CGGGFRSALATESIKKMGYKNVLSMDGGFRAWREAGFPIIMD

    >gi|161831028|ref|YP_001596371.1| methylated-DNA-[protein]-cysteine S-methyltransferase [Coxiella burnetii RSA 331]
    MSDAVCYQATVSTPVGKIGVRTSDDHLLGIDYLYDDSILVKPKTILAKETVEQLLCYFADPEFPFEIPIALGLTPFQETV
    LNALRTIPVGTTRTYAQLAEQLDTRARPIGNACRKNPIPIIIP
    CHRVVAATHLGGYSSATKGKLLAVKQWLLQHESASFE
    SNLGEKLKKTK

    >gi|161831483|ref|YP_001596386.1| thioredoxin [Coxiella burnetii RSA 331]
    MAIMELTQSNFDNVVSQHDLIIIDFWANWCAPCLTFTKIIEEVEKDYPEVVFGSVNIEKEKRLAEEFNVKSIPAVMILRD
    RVVVFAESGALPREGLRELIEKAKDLNTDILREAQKQKARE

    >gi|161830135|ref|YP_001596393.1| dihydrolipoyl dehydrogenase, E3 component of pyruvate dehydrogenases complex [Coxiella burnetii RSA 331]
    MTKEIKTEVVVLGSGPGGYAAAFRAADLGKKVVLVERYETIGGVCLNVGCIPSKALLHVAKVIDDAKDMSSFGIDFGKAA
    LEIEKIRSWKENVVKKLTGGLKMMAKQRKVEIITGYGKFSSSNELAVENKEKSVTKIKFDQAIIAVGSLPVKLPFIPDDP
    RIMDSTGALELEDVKGHLLVLGGGIIGLEMATVYHALGTKISVVEMMDQLIPGADADVVKPLHQRIQKRYEEILLKTKVT
    KIEPKKDGLYVTFEGENAPKEPKKYDRILVAVGRSPNGKLIDAEKAGVKVDDKGYIAVDKQMRTNVSHIYAIGDVVGQPM
    LAHKATYEGRLAAEVIAGIKHYNDARCIPAVAYTDPEVAWVGLTETQAKEKGIKYEKGVFPWAASGRALSLNRSEGSTKL
    LFDEKGTVIGGGIVGVNAGDLISEVALAIEMGCDAEDVGLTIHPHPTLSETVMMACEMFEGTITDLIPPKKKDK

    >gi|161830540|ref|YP_001596511.1| glutaredoxin family protein [Coxiella burnetii RSA 331]
    MRVHEEIQQQVTSNPVVLYMKGTPDFPQCGFSGRVVQILRQCKIDFTSFNVLESPELRQGIKEFSSWPTIPQLYIKGEFI
    GGCDIVGELFETGKLQELL

    >gi|161830074|ref|YP_001596515.1| thiosulfate sulfurtransferase GlpE [Coxiella burnetii RSA 331]
    MMYKQISHLEAWELVKKRDIVIADVRDQDSYEEEHIANALHLSMAKLQEYSEKADKEKPVLVYCYHGISSQSVAQHLVEQ
    GFKEVYSLIGGFETWKAHHPTSDANKN

    >gi|161830571|ref|YP_001596634.1| pyridine nucleotide-disulfide oxidoreductase [Coxiella burnetii RSA 331]
    MPIERVDVAIVGGSFSGLSAALLLGNSLRNVIVIDDNQPRNLKSAHAFNLLGNEQTKPLTFLKRAHKEVQQLETAQVISG
    NIKSISCINNRGFTLQLQNGPRIESRKIILATGVVDELPAIKGIETFWPDNIFH
    CPYCIGYAVKNEPLAVYSTEEEAYVL
    ALIIHKWTSDFILFTDGHEVLSDPQLEHLKDLGIRVYSQKISQFTGVRGKFIVAHLSDQQQIKRRGIFMHLKFKQRAPNL
    IADLGCSYNEENLLHVNEFFKTSVDGVYAIGDIALKVQKMTTAIASGSVAAFAVDHELTDEMAVFA

    >gi|161831196|ref|YP_001596713.1| putative biotin biosynthesis protein BioC [Coxiella burnetii RSA 331]
    MVNSLKKRIQRSFNKAFDTYDDHASIQREICKQLLKPLKEMRIQTKIIADFACGTGISTKAVSDSFPYQNLYAIDFCEKL
    LIQAKSKLKESNVEFILADFETNVFLCNSLDLIFCNMGFQWALDLKQTFFSLFSQLKAFGVLAFSVPLLGTFCELRND
    CR
    NPFLTLQSIVQLLKAVGFELLTADEKIFTDSFESPLDAIRSIKSIGANCLLYPKRNKGLSPMPIEKNNTDTTLTYHIGFF
    IAKKIIQ

    >gi|161830386|ref|YP_001596751.1| anti-oxidant AhpCTSA family protein [Coxiella burnetii RSA 331]
    MSIEVGQKAPIFTLPTDEGEMLSLDDLKGKKVILYFYPKDDTPGCTKEACGFRDVWSQLSKAGVVVLGISKDSVKAHQSF
    KQKYNLPFTLLSDKDNTVCEQYGVMVDKNRFGKKYKGIERTTFLIDEEGVISAVWPKVKVDGHVAEVVGRL

    >gi|161830580|ref|YP_001596765.1| putative sulfurtransferase [Coxiella burnetii RSA 331]
    MNLSLTQDPQKAKEFFEKKMAFTTGPVEVSGMLKKNAKIQVVDVRAAEDYKKGHVPGAINLPSNEWEKAAEKLDKEKTNI
    IY
    CYSQVCHLAAKAAVKFAEQGFPVMEMEGGFKTWTEHKLETEK

    >gi|161831442|ref|YP_001596817.1| putative disulfide bond formation protein D [Coxiella burnetii RSA 331]
    MQKIFVKHLVLITVVIALTMSAIALALSKPAALKATTIDTKGQPTLGNPAAPVHIVAFEDLKCPNCARFNVEVLPAIKKK
    YINTGVAKYILITLAFLPGSPPAGNAALCLYKQNKNYFFPFVSYLYQHQPDETQNWATIPRLLQFARNSVPQANMKQLSN
    CIFSSRYSGALQKNLKIAEKTMNPVATPAVYVNGVNVEPLTQKRLEALIKGARSRAKN

    >gi|161831354|ref|YP_001596830.1| ThiF/MoeZ/MoeB domain/rhodanese-like domain-containing protein [Coxiella burnetii RSA 331]
    MTLTSNDIQRYARHLPLIGREGQAHLFAARILCVGAGGLGASVLQYLAAAGIGTIGIVDGDQVELSNLQRQVIFSPEDIG
    KNKALVASRYLSRFNPSLKTIVREEFLNEDNATKILKDFELVIDCSDNYRTRYLLNDICIQLKKPLISASIYQFQGQCSV
    FNYKEGPCYRCLYEEPPPEELIPN
    CALGGVLGVLPGILGCIQATEALKIILDKGEVLSGRLLTIDALSMRTREFRVPKNP
    QCPCCYEGKSALDLFLNTDNSKKIREIEAQKLAQWLENQNDNLLLIDVREPYEREICHIGGQHIPLRELDARQANLPRNK
    FIICY
    CKSGQRSRRAVQLLMDNGFTNVSSLQGGIMAWISSIDHSLTKY

    >gi|161830388|ref|YP_001597055.1| thioredoxin-disulfide reductase [Coxiella burnetii RSA 331]
    MNKPQHHSLIILGSGPAGYTAAIYAARANLKPIMITGMEQGGQLMTTTDVDNWPGEAPGLQGPQLMERMQKHAERLDTQF
    IFDHINEADLNQRPFLLKGDNATYSCDALIIATGASARYLGLPSEKAYMGKGVSA
    CATCDGFFYRGKKVAVVGGGNTAVE
    EALYLSHIASHVTLIHRRDKLRAEKMLSAQLIKKVEEGKVAIVWSHVIEEVLGDDQGVTGVHLKHVKEEKTQDLTIDGLF
    IAIGHDPNTKIFKEQLEMDEAGYLRAKSGLQGNATATNIPGVFAAGDVTDHVYRQAITAAGMGCMAALDAERYLDSLNQA


    >gi|161831318|ref|YP_001597131.1| anti-oxidant AhpCTSA family protein [Coxiella burnetii RSA 331]
    MALTPSKMIPLGTKAPDFNLPDAVSGKKMSLAQLKSNKATVIMFICNHCPFVQHIQEKLVEVAKEYQAKGIQFIAINSND
    IENYPEDSPEKMKITAEEFDYPFPYLFDESQEIAKAYQAECTPDFYVFDKNLACVYRGRFDSATPGRDTPVTGEDLRSAL
    DNILAGNLVDPNQQPSQGCNIKWKK

    >gi|161831105|ref|YP_001597156.1| bifunctional methionine sulfoxide reductase B/A protein [Coxiella burnetii RSA 331]
    MDKRSSLPPIVRHITCDQMTEPAFQGEYTDLKETGRYLCRQCGIALFRSQDKFHSGCGWPSFDATIAGTIKRLPDPDGQR
    IEIRCERCGAHLGHVFEGEALTPKNTRY
    CVNSLSLDFVTDSQIRDTEEAIFAGGCFWGVEYYFKRLPGVVKTEVGYTGGH
    KNNPTYKEVCSRTTGHVEAIRVLYDPQQINYEKILHYFFEIHDPTQTDGQGPDLGDQYHSVIFYYDNQQKRMAEMAIKVL
    TEKGYRIATRLAPVSIFWRAEDYHQDYYQKTGKQPYCHHYVKRF

    >gi|161831019|ref|YP_001597197.1| FeS assembly scaffold SufA [Coxiella burnetii RSA 331]
    MTQAETIIEFTKAAYTHIQSLIKKRTEHSFFRLSIKKTGCSGYMYQPEIVENPKENDVLMKTAIGLSVAIDPKCLHMIKG
    TVVDYVKKDLGQYQLHFNNPNAIGACGCGESFHLKEE

    >gi|161830432|ref|YP_001597319.1| alkylhydroperoxide reductase AhpC [Coxiella burnetii RSA 331]
    MIKIGEQFPSFSLKAVISNDVNKAFTEINEKSYANKWLVLFFWPKDFTFVCPTEIAEFGRLNGEFADRDAQVLGASVDSE
    FVHLAWRREKEELSQLPFPMLSDIRRDLSQRLGILNEKEGVAERATFIVDPNHIVRFVMVNDLNVGRNPQEVLRVLDALQ
    TDELCPCNWQQGEETIVVA

    >gi|161830041|ref|YP_001597349.1| copper-translocating P-type ATPase [Coxiella burnetii RSA 331]
    MNTTKHQLTLKNMHCASCVASIESALKSVAGVKSVSINFATKQAEVEGDVDVKTILKAIKDQGYEAEIAGDDEEAQNEAQ
    SHFRDLLKKAIFAAVVGFPLMINEFWAWLPSVNQPRIQWVWVIIGVLSFFVLYYCGGHIYRSAWRAFLKRQTNMDTLVAM
    GTGTAWLYSFIVVLIPMWIPPMARHAYFDTSTILIAFITFGAALEIRARGKTGEAIKRLIGLQPKTARVIRDDQEIDIPI
    AEVQIDDHLRVRPGEKIPVDGKIIKGASPINESMLTGEPLPVVKSQGDEVIGGTINKSGTFIYRATRVGKDTALAQIIAL
    VKRAQNSKPKIGRIVDKVSAVFVPVVIIVAILTAIGWLNFGPEPKAAFVLITTVAVLVMACPCALGLATPISIIVGVGKG
    AEMGVLIRNGDALQMASQLTAIILDKTGTVTEGKPMLSDFYTADGFDEKKLLSIAASVEKGSEHPLANAIIEGAKKYNIP
    LAKATQFESIAGHGVKAKIENQSILLGNLHLMKNEKVELGGAPAHAERMADQGQTPIYIALDGKIAGIVSIVDPIKPDSQ
    KAIADLQRAGLKVVMVTGDNPLTANAVAKQVGIEQVIAEVLPEDKAKKVKLLQQQGERVAMVGDGINDAPALAAADVGFA
    IGTGTDVAIESADIALISGSLTGVVNAISISRATLRNIKQNLFGAFIYNTLGIPIAAGVFYPLTGLLLSPIIAGAAMALS
    SVTVVANANRLRFFRRRKRT

    >gi|161830629|ref|YP_001597354.1| putative sulfurtransferase [Coxiella burnetii RSA 331]
    MKIVNIAAYKFVTILNESLPTLQKQLREKALECNLKGTILLSTEGVNLMMAGQREAIEIYKQFLADKKEFKDLTYKKSFS
    SFYPYEKLVVRIKKEIITMHCADINPEKETAPHLSPEILHRWYEEKQEMVILDTRNRFEFVMGTFANAIDLNLTSFSDFP
    QAVDSLPESFKEKPVVTF
    CTGGIRCEKASALMLKKGFKKVYQLDGGILNYFEKCGGEYFKGKCFVFDDRIALEAGSS

    >gi|161831235|ref|YP_001597361.1| glutaredoxin 3 [Coxiella burnetii RSA 331]
    MAKIEIYTTARCPYCVRAKALLDRKGLDYMEIRIDEAPEKRDEMLSRSEGRRTVPQIFINGRGIGGFDELWELEQSKKLD
    ELLKT

    >gi|161831047|ref|YP_001597362.1| putative sulfurtransferase [Coxiella burnetii RSA 331]
    MEQLPEFIARHWLLVAAFIVALMALLIVEARSKGLSGKYRLTPQHAIRLINSEKAVIVDIRDANAYSKGHITNAINIPAT
    ELDKHPQRLEQYKQQPIILV
    CAMGQKSGPLRNKLHKKGYEKVYLMIGGMNAWNSANMPIVK

    >gi|161831417|ref|YP_001597528.1| anti-oxidant AhpCTSA family protein [Coxiella burnetii RSA 331]
    MAVLVGREAPDFTVPAVLANGDIVENFNLAEAIQNKYGLVFFYPLDFTFVCPSELIALDKAIADFQKRRVEVIGVSIDSQ
    FTHNAWRNTPVEKGGIGPVRYPLASDVTHSICRSYGVEHVAGVALRGAFLIDKQGIVRSQIVNDLPLGRSIPELLRLVDA
    LQFTEEHGEVCPANWKKGDPAMQASPDGVAKYLAENADNL

    >gi|161831572|ref|YP_001597546.1| thiol:disulfide interchange protein DsbD [Coxiella burnetii RSA 331]
    MSLKKPPKGTSFWHGCRNDVRKRAPVVHFIVEMCLDKSMIRRLITLLVLFFLPIYALSEQPVPVDQAFQFSAMAKDYQTV
    IGLWNIKPGFYLYRNRIHFSSLKSADYLGEPLWPRVDTVKDYPGIGKLPVYQGQLRISVPVIKAMNQTLYLKVDYQGCSE
    KGFCYPPTTKTVAIDLAGNYMQPVAPLAIDIAPGKTAGPKAAPPITQQDRSTLILSPCVTPALVGVLGYISHTGNASLGG
    VALFTMGLGMGAPLLLLGAFSRKWLPKAGPWMTVIKHILGVLMLAVAVWLLARILPGTVTMFLWAALAVGSAIALGALST
    TQTKMQKIGKTLGLFLLVYGIVLATGGLSGNTNPLRPISLASLPEKGEGPSFTAVYTLPDVEHQLKMATTKGQPTMIDFY
    ADW
    CISCKQMEQFTFANQNVQKALAGFRLLRADVTRNDQGSTVLEKHFGVVAPPTVLFLDPQGKEIPNSRIVGEMSAFRF
    LKHLENLRS

    >gi|161830470|ref|YP_001597697.1| iron-sulfur cluster insertion protein ErpA [Coxiella burnetii RSA 331]
    MNALAQKTPSPPTLVFTEAAVRKVKGLIDEENNPYLNLRVFITGGGCSGFQYGFTFDEAINSDDLVIEKQLEEEDDDEGG
    TGQMALVKLLVDPLSLQYLQGAEIDYREDVSGAQFVIRNPNAKTTCGCGSSFAA

    >gi|161831588|ref|YP_001597728.1| outer membrane protein [Coxiella burnetii RSA 331]
    MKNRLTALFLAGTLTAGVAIAAPSQFSFSPQQVKDIQSIVHHYLVNHPEVLVEASQALQKKTEAQQEEHAQQAIKENAKK
    LFNDPASPVAGNPHGNVTLVEFFDYQ
    CGHCKAMNSVIQAIVKQNKNLRVVFKELPIFGGQSQYAAKVSLAAAKQGKYYAF
    HDALLSVDGQLSEQITLQTAEKVGLNVAQLKKDMDNPAIQKQLRDNFQLAQSLQLAGTPTFVIGNKALTKFGFIPGATSQ
    QNLQKEIDRVEK

    >gi|161829780|ref|YP_001597821.1| thioredoxin [Coxiella burnetii RSA 331]
    MSEHVHTASDENFETEVLQADMPVLVDFWAEWCQPCKMISPVVEEIAKEYAGRVKVFKLNVDENAQTPTKYGVRGIPSLL
    IFREGEVVDRKVGALNKSQLAAFLDESLHFSS

    >gi|161830262|ref|YP_001597320.1| alkyl hydroperoxide reductase D protein AhpD [Coxiella burnetii RSA 331]
    MLQTYKDQLPDYAKDLKLNLTQVLSESPSSELSNQQITGVALAVAYATRNRQLIELIFQKAEAELDESTLQAIKAAASIM
    AMNNIYYRFVHLVKDSEYQRLPANLRMNIIANPGIDKKDFELYSLAVSAINGCGL
    CIDAHANTLIKAGFSKHSIQHVIRI
    AAVLNGLAQVSIIENKT