Coxiella burnetii Dugway 5J108 111 uid58629

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|209363679|ref|YP_001423541.2| iron-sulfur cluster insertion protein ErpA [Coxiella burnetii Dugway 5J108-111]
    MDNLLMNALAQKTPSPPTLVFTEAAARKVKGLIDEENNPYLNLRVFITGGGCSGFQYGFTFDEAINSDDLVIEKQLEEED
    DDEGGTGQMALVKLLVDPLSLQYLQGAEIDYHEDVSGAQFVIRNPNAKTTCGCGSSFAA

    >gi|154707107|ref|YP_001423634.1| outer membrane protein [Coxiella burnetii Dugway 5J108-111]
    MKNRLTALFLAGTLTAGVAIAAPSQSSFSPQQVKDIQSIVHHYLVNHPEVLVEASQALQKKTEAQQEEHAQQAIKENAKK
    LFNDPASPVAGNPHGNVTLVEFFDYQ
    CGHCKAMNSVIQAIVKQNKNLRVVFKELPIFGGQSQYAAKVSLAAAKQGKYYAF
    HDALLSVDGQLSEQITLQTAEKVGLNVAQLKKDMDNPAIQKQLRDNFQLAQSLQLAGTPTFVIGNKALTKFGFIPGATSQ
    QNLQKEIDRVEK

    >gi|154706624|ref|YP_001423704.1| thiol:disulfide interchange protein [Coxiella burnetii Dugway 5J108-111]
    MSLKKPPKGTSFWHGCRNDVRKRAPVVHFIVEMCLDKSMIRRLITLLVLFFLPIYALSEQPVPVDQAFQFSAMAKDYQTV
    IGLWNIKPGFYLYRNRIHFSSLKSDDYLGEPLWPRVDTVKDYPGIGKLPVYQGQLRISVPVIKAMNQTLYLKVDYQGCSE
    KGFCYPPTTKTVAIDLAGNYMQPVAPLAIDIAPGKTAGPKAAPPITQQDRVTQLLTYKNLFFVLLSFFGFGLLLSFTPCV
    LPMIPVLSGIIVGQQKYPKRAFGLSLMYVLGMAITYAIAGVIFGFIGSTVQAAFQNPWLIGLFSLLFIAMALSLFGLYDL
    QLPQRWQTRLAQASDRQKHGTYLGTALMGALSTLILSPCVTPALVGVLGYISHTGNASLGGVALFTMGLGMGAPLLLLGA
    FSRKWLPKAGPWMTVIKHILGVLMLAVAVWLLARILPGTVTMFLWAALAVGSAIALGALSTTQTKMQKIGKTLGLFLLVY
    GIVLATGGLSGNTNPLRPISLASLPEKGEGPSFTAVYTLPDVEHQLKMATTKGQPMMIDFYADW
    CISCKQMEQFTFANQN
    VQKALAGFRLLRADVTRNDQGSTVLEKHFGVVAPPTVLFLDPQGKEIPNSRIVGEMSAFRFLKHLENLRS

    >gi|154707314|ref|YP_001423722.1| thioredoxin peroxidase [Coxiella burnetii Dugway 5J108-111]
    MAVLVGREAPDFTVPAVLANGDIVENFNLAEAIQNKYGLVFFYPLDFTFVCPSELIALDKAIADFQKRRVEVIGVSIDSQ
    FTHNAWRNTPVEKGGIGPVRYPLASDVTHSICRSYGVEHVAGVALRGAFLIDKQGIVRSQIVNDLPLGRSIPELLRLVDA
    LQFTEEHGEVCPANWKKGDPAMQASPDGVAKYLAENADNL

    >gi|209363800|ref|YP_001423881.2| rhodanese-related sulfurtransferase [Coxiella burnetii Dugway 5J108-111]
    MVTMEQLPEFIARHWLLVAAFIVALMALLIVEARSKGLSGKYRLTPQHAIRLINSEKAVIVDIRDANAYSKGHITNAINI
    PATELDKHPQRLEQYKQQPIILV
    CAMGQKSGPLRNKLHKKGYEKVYLMIGGMNAWNSANMPIVK

    >gi|154706233|ref|YP_001423882.1| glutaredoxin [Coxiella burnetii Dugway 5J108-111]
    MAKIEIYTTARCPYCVRAKALLDRKGLDYMEIRIDEAPEKRDEMLSRSEGRRTVPQIFINGRGIGGFDELWELEQSKKLD
    ELLKT

    >gi|154706565|ref|YP_001423890.1| rhodanese-related sulfurtransferase [Coxiella burnetii Dugway 5J108-111]
    MKIVNIAAYKFVTILNESLPTLQKQLREKALECNLKGTILLSTEGVNLMMAGQREAIEIYKQFLADKKEFKDLTYKKSFS
    SFYPFEKLVVRIKKEIITMHCADINPEKETAPHLSPEILHRWYEEKQEMVILDTRNRFEFVMGTFANAIDLNLTSFSDFP
    QAVDSLPESFKEKPVVTF
    CTGGIRCEKASALMLKKGFKKVYQLDGGILNYFEKCGGEYFKGKCFVFDDRIALEAGSS

    >gi|209363803|ref|YP_001423895.2| copper-exporting ATPase [Coxiella burnetii Dugway 5J108-111]
    MLMNTTKHQLTLKNMHCASCVASIESALKNVAGVKSVSINFATKQAEVEGDVDVKTILKAIKDQGYEAEIAGDDEEAQNE
    AQSHFRDLLKKAIFAAVVGFPLMINEFWAWLPSVNQPRIQWVWVIIGVLSFFVLYYCGGHIYRGAWRAFLKRQTNMDTLV
    AMGTGTAWLYSFIVVLIPMWIPPMARHAYFDTSTILIAFITFGAALEIRARGKTGEAIKRLIGLQPKTARVIRDDQEIDI
    PIAEVQIDDHLRVRPGEKIPVDGKIIEGASPIDESMLTGEPLPVVKSQDDEVIGGTINKSGTFIYRATRVGKDTALAQII
    ALVKRAQNSKPKIGRIVDKVSAVFVPVVIIVAILTAIGWLNFGPEPKAAFVLITTVAVLVIACPCALGLATPISIIVGVG
    KGAEMGVLIRNGDALQMASQLTAIILDKTGTVTEGKPMLSDFYTADGFDEKKLLSIAASVEKGSEHPLANAIIEGAKKYN
    IPLANATQFESIAGHGVKAKIENQSILLGNLHLMKNEKVELGGAPAHAERMADQGQTPIYIALDGKIAGIVSIVDPIKPD
    SQKAIADLQRAGLKVVMVTGDNPLTANAVAKQVGIEQVIAEVLPEDKAKKVKLLQQQGERVAMVGDGINDAPALAAADVG
    FAIGTGTDVAIESADIALISGSLTGVVNAISISKATLRNIKQNLFGAFIYNTLGIPIAAGVFYPLTGLLLSPIIAGAAMA
    LSSVTVVANANRLRFFRRRKRT

    >gi|154706501|ref|YP_001423935.1| peroxiredoxin [Coxiella burnetii Dugway 5J108-111]
    MIKIGEQFPSFSLKAVISNDVNKAFTEINEKSYANKWLVLFFWPKDFTFVCPTEIAEFGRLNGEFADRDAQVLGASVDSE
    FVHLAWRREKEELSQLPFPMLSDIRRDLSQRLGILNEKEGVAERATFIVDPNHIVRFVMVNDLNVGRNPQEVLRVLDALQ
    TDELCPCNWQQGEETIVVA

    >gi|154707668|ref|YP_001424133.1| thioredoxin reductase family protein [Coxiella burnetii Dugway 5J108-111]
    MPIERVDVAIVGGSFSGLSAALLLGNSLRNVIVIDDNQPRNLKSAHAFNLLGNEQTKPLTFLKRARKEVQQLETAQVISG
    NIKSISGINNRCFTLQLQNGPRIESRKIILATGVVDELPAIKGIETFWPDNIFH
    CPYCIGYAVKNEPLAVYSTEEEAYVL
    ALIIHKWTSDFILFTDGHEVLSDPQLEHLKDLGIRVYSQKISQFTGVRGKFIVAHLSDQQQIKRRGIFMHLKFKQRAPNL
    IADLGCSYNEENLLHVNEFFKTSVDGVYAIGDMALKVQKITTAIASGSVAAFAVDHELTDEMVVFA

    >gi|154707319|ref|YP_001424234.1| ADA regulatory protein [Coxiella burnetii Dugway 5J108-111]
    MISNDKRKIYYKALLDKKAEYEGLFYVGVKTTGVFCRPTCPAKKPKFENCEFFETAKEALTASFRPCQRCQPLSYPDDFT
    PTVKKLVDAIERNPEKRWKNADLRELSIDASTAQRQFKKRFGMTFIEYARARRMGLALKQIKEGSSIINTQLSTGYESSS
    GFRDAFSRVMGTPPSKAPQQLLKATWLDTKLGQMVAIADDTGLYLLEFSDRRGLEREIERLREKLKAAIIPGETSVIDRI
    KKEIRQYFAGKRMVFETPLHLIGPPFQKKVWEALRKIPPGETRSYVDIAKFIKEPKAYRAVARANGANQLAIIIP
    CHRVI
    NANGDLGGYSGGITRKQWLLEHERKIMLLNQ

    >gi|154706289|ref|YP_001424323.1| molybdopterin biosynthesis MoeB protein [Coxiella burnetii Dugway 5J108-111]
    MTLTSNDIQRYARHLPLIGREGQAHLFAARILCVGAGGLGASVLQYLAAAGIGTIGIVDGDQVELSNLQRQVIFSPEDIG
    KNKALVASRYLSRFNPSLKTIVREEFLNEDNATKILKDFELVIDCSDNYRTRYLLNDICIQLKKPLISASIYQFQGQCSV
    FNYKEGPCYRCLYEEPPPEELIPN
    CALGGVLGVLPGILGCIQATEALKIILDKGEVLSGRLLTIDALSMRTREFRVPKNP
    QCPCCYEGKSALDLFLNTDNSKKIREIEAQKLAQWLENQNDNLLLIDVREPYEREICHIGGQHIPLRELDARQANLPRNK
    FIICY
    CKSGQRSRRAVQLLMDNGFTNVSSLQGGIMAWISSIDHSLTKY

    >gi|154706029|ref|YP_001424334.1| thiol:disulfide interchange protein [Coxiella burnetii Dugway 5J108-111]
    MQKTFVKPLVLITVVIALIMSAIALALSKPAALKATTIDTKGQPTLGNPAAPVHIVAFEDLKCPNCARFNVEVLPAIKKK
    YINTGVAKYILITLAFLPGSPPAGNAALCLYKQNKNYFFPFVSYLYQHQPDETQNWATIPRLLQFARNSVPQANMKQLSN
    CIFSSRYSGALQKNLKIAEKTMNPVATPAVYVNGVNVEPLTQKRLEALIKGARSRAKN

    >gi|209363948|ref|YP_001424416.2| biotin synthesis protein [Coxiella burnetii Dugway 5J108-111]
    MMVNSLKKRIQRSFNKAFDTYDDHASIQREICKQLLKPLKEMRIQTKIIADFACGTGISTKAVADSFPYQNLYAIDFCEK
    LLIQAKSKLKESNVEFILADFETNVFLCNSLDLIFCNMGFQWALDLKQTFFSLFSQLKAFGVLAFSVPLLGTFCELRND
    C
    RNPFLTLQSIVQLLKAVGFELLTADEKIFTDSFESPLDAIRSIKSIGANCLLYPKRNKGLSPMPIEKNNTDTTLTYHIGF
    FIAKKIIQ

    >gi|209363960|ref|YP_001424456.2| thioredoxin peroxidase [Coxiella burnetii Dugway 5J108-111]
    MPYLIPYCKFDSTFSQFLLRRKTMSIEVGQKAPIFTLPTDEGEMLSLDDLKGKKVILYFYPKDDTPGCTKEACGFRDVWS
    QLSKAGAVVLGISKDSVKAHQSFKQKYNLPFTLLSDKDNTVCEQYGVMVDKNRFGKKYKGIERTTFLIDEEGVISAVWPK
    VKVDGHVAEVVGRL

    >gi|209363973|ref|YP_001424496.2| rhodanese-related sulfurtransferase [Coxiella burnetii Dugway 5J108-111]
    MLETEKCTKIFLSFSLNSRRIIMNLSLTQDPQKAKEFFEKKMAFTTGPVEVSGMLKKNAKIQVVDVRAAEDYKKGHVPGA
    INLPSNEWEKAAEKLDKEKTNIIY
    CYSQVCHLAAKAAVKFAEQGFPVMEMEGGFKTWTEHKLETEK

    >gi|154706134|ref|YP_001424637.1| thioredoxin reductase [Coxiella burnetii Dugway 5J108-111]
    MNKPQHHSLIILGSGPAGYTAAIYAARANLKPIMITGMEQGGQLMTTTDVDNWPGEAPGLQGPQLMERMQKHAERLDTQF
    IFDHINEADLNQRPFLLKGDNATYSCDALIIATGASARYLGLPSEKAYMGKGVSA
    CATCDGFFYRGKKVAVVGGGNTAVE
    EALYLSHIASHVTLIHRRDKLRAEKMLSAQLIKKVEEGKVAIVWSHVIEEVLGDDQGVTGVHLKHVKEEKTQDLTIDGLF
    IAIGHDPNTKIFKEQLEMDEAGYLRAKSGLQGNATATNIPGVFAAGDVTDHVYRQAITAAGMGCMAALDAERYLDSLNQA


    >gi|154706476|ref|YP_001424719.1| thiol-disulfide isomerase or thioredoxin [Coxiella burnetii Dugway 5J108-111]
    MALTPSKMIPLGTKAPDFNLPDAVSGKKMSLAQLKSNKATVIMFICNHCPFVQHIQEKLVEVAKEYQAKGIQFIAINSND
    IENYPEDSPEKMKITAEEFDYPFPYLFDESQEIAKAYQAECTPDFYVFDKNLACVYRGRFDSATPGRDTPVTGEDLRSAL
    DNILAGNLVDPNQQPSQGCNIKWKK

    >gi|154706004|ref|YP_001424746.1| bifunctional methionine sulfoxide reductase B/A protein [Coxiella burnetii Dugway 5J108-111]
    MDKRSSLPPIVRHITCDQMTEPAFQGEYTDLKETGRYLCRQCGIALFRSQDKFHSGCGWPSFDATIAGTIKRLPDPDGQR
    IEIRCERCGAHLGHVFEGEALTPKNTRY
    CVNSLSLDFVTDSQIRDTEEAIFAGGCFWGVEYYFKRLPGVVKTEVGYTGGH
    KNNPTYEEVCSRTTGHVEAIRVLYDPQQINYEKILHYFFEIHDPTQTDGQGPDLGDQYHSVIFYYDNQQKRMAEMAIKVL
    TEKGYRIATRLAPVSIFWRAEDYHQDYYQKTGKQPYCHHYVKRF

    >gi|154706848|ref|YP_001424790.1| HesB protein family [Coxiella burnetii Dugway 5J108-111]
    MTQAETIIEFTKAAYTHIQSLIKKRTEHSFFRLSIKKTGCSGYMYQPEIVENPKENDVLMKTAIGLSVAIDPKCLHMIKG
    TVVDYVKKDLGQYQLHFNNPNAIGACGCGESFHLKEE

    >gi|154707072|ref|YP_001424824.1| glutaredoxin [Coxiella burnetii Dugway 5J108-111]
    MRVHEEIQQQVTSNPVVLYMKGTPDFPQCGFSGRVVQILRQCKIDFTSFNVLESPELRQGIKEFSSWPTIPQLYVKGEFI
    GGCDIVGELFETGKLQELL

    >gi|154707272|ref|YP_001424950.1| dihydrolipoamide dehydrogenase [Coxiella burnetii Dugway 5J108-111]
    MTKEIKTEVVVLGSGPGGYAAAFRAADLGKKVVLVERYETIGGVCLNVGCIPSKALLHVAKVIDDAKDMSSFGIDFGKAA
    LEIEKIRSWKENVVKKLTGGLKMMAKQRKVEIITGYGKFSSSNELAVENKEKSVTKIKFDQAIIAVGSLPVKLPFIPDDP
    RIMDSTGALELEDVKGHLLVLGGGIIGLEMATVYHALGTKISVVEMMDQLIPGADADVVKPLHQRIQKRYEEILLKTKVT
    KIEPKKDGLYVTFEGENAPKEPKKYDRILVAVGRSPNGKLIDAEKAGVKVDDKGYIAVDKQMRTNVSHIYAIGDVVGQPM
    LAHKATYEGRLAAEVIAGKKHYNDARCIPAVAYTDPEVAWVGLTETQAKEKGIKYEKGVFPWAASGRALSLNRSEGSTKL
    LFDEKGTVIGGGIVGVNAGDLISEVALAIEMGCDAEDVGLTIHPHPTLSETVMMACEMFEGTITDLIPPKKKDK

    >gi|154706298|ref|YP_001424957.1| thioredoxin [Coxiella burnetii Dugway 5J108-111]
    MAIMELTQSNFDNVVSQHDLIIIDFWANWCAPCLTFTKIIEEVEKDYPEVVFGSVNIEKEKSLAEEFNVKSIPAVMILRD
    RVVVFAESGALPREGLRELIEKAKDLNTDILREAQKQKARE

    >gi|154705991|ref|YP_001424971.1| o6-methylguanine-DNA methyltransferase [Coxiella burnetii Dugway 5J108-111]
    MSDAVCYQATVSTPVGKIGVRTSDDHLLGIDYLYDDSILVKPKTILAKETVEQFLCYFADPEFPFEIPIALGLTPFQETV
    LNALRTIPVGTTRTYAQLAEQLDTRARPIGNACRKNPIPIIIP
    CHRVVAATHLGGYSGATKGKLLAVKQWLLQHESASFE
    SNLGEKLKKTK

    >gi|154706612|ref|YP_001425347.1| rhodanese-related sulfurtransferase [Coxiella burnetii Dugway 5J108-111]
    MKEHSPSFVALAKEAKSHIEETDIYTVKKMMDNEEDFELVDVREESEWDEGHLPSAIHLGKGIIERDIEKVIPNRNRKLI
    LY
    CGGGFRSALAAESIKKMGYKNVLSMDGGFRAWREAGFPIIMD

    >gi|154707163|ref|YP_001425487.1| thioredoxin [Coxiella burnetii Dugway 5J108-111]
    MSEHVHTASDENFETEVLQADMPVLVDFWAEWCQPCKMISPVVEEIAKEYAGRVKVFKLNVDENAQTPTKYGVRGIPSLL
    IFREGEVVDRKVGALNKSQLAAFLDESLHFSS

    >gi|209363815|ref|YP_001423936.2| peroxiredoxin reductase (NAD(P)H) [Coxiella burnetii Dugway 5J108-111]
    MKRSEIRERHHNFPYFASLHTGYVRRINMLQTYKDQLPDYAKDLKLNLTQVLSESPSSELSNQQITGVALAVAYATRNRQ
    LIELIFQKAEAELDESTLQAIKAAASIMAMNNIYYRFVHLVKDSEYQRLPANLRMNIIANPGIDKKDFELYSLAVSAING
    CGL
    CIDAHANTLIKAGFSKHSIQHVIRIAAVLNGLAQVSIIENKT