Coxiella burnetii CbuK Q154 uid58895

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|212217704|ref|YP_002304491.1| outer membrane protein [Coxiella burnetii CbuK_Q154]
    MKNRLTALFLAGTLTAGVAIAAPSQSSFSPQQVKDIQSIVHHYLVNHPEVLVEASQALQKKTEAQQEEHAQQAIKENAKK
    LFNDPASPVAGNPHGNVTLVEFFDYQ
    CGHCKAMNSVIQAIVKQNKNLRVVFKELPIFGGQSQYAAKVSLAAAKQGKYYAF
    HDALLSVDGQLSEQITLQTAEKVGLNVAQLKKDMDNPAIQKQLRDNFQLAQSLQLAGTPTFVIGNKALTKFGFIPGATSQ
    QNLQKEIDRVEK

    >gi|212217853|ref|YP_002304640.1| iron-sulfur cluster insertion protein ErpA [Coxiella burnetii CbuK_Q154]
    MDNLLMNALAQKTPSPPTLVFTEAAARKVKDLIDEENNPYLNLRVFITGGGCSGFQYGFTFDEAINSDDLVIEKQLEEED
    DDEGGTGQMALVKLLVDPLSLQYLQGAEIDYREDVSGAQFVIRNPNAKTTCGCGSSFAA

    >gi|212217953|ref|YP_002304740.1| thiol:disulfide interchange protein [Coxiella burnetii CbuK_Q154]
    MSLKKPQKGTSFWHGCRNDVRKRAPVVHFIVEMCLDKSMIRRLITLLVLFFLPIYALSEQPVPVDQAFQFSAMAKDYQTV
    IGLWNIKPGFYLYRNRIHFSSLKSADYLGEPLWPRVDTVKDYPGIGKLPVYQGQLRISVPVIKAMNQTLYLKVDYQGCSE
    KGFCYPPTTKTVAIDLAGNYMQPVAPLAIDIAPGKTAGPKAAPPITQQDRVTQLLTHKNLFFVLLSFFGFGLLLSFTPCV
    LPMIPVLSGIIVGQQKYPKRAFGLSLMYVLGMAITYAIAGVIFGFIGSTVQAAFQNPWLIGLFSLLFIAMALSLFGLYDL
    QLPQRWQTRLAQASDRQKHGTYLGTALMGALSTLILSPCVTPALVGVLGYISHTGNASLGGVALFTMGLGMGAPLLLLGA
    FSRKWLPKAGPWMTVIKHILGVLMLAVAVWLLARILPGTVTMFLWAALAVGSAIALGALSTTQTKMQKIGKTLGLFLLVY
    GIVLATGGLSGNTNPLRPISLASLPEKGEGPSFTAVYTLPDVEHQLKMATTKGQPMMIDFYADW
    CISCKEMEQFTFANQN
    VQKALAGFRLLRADVTRNDQGSTVLEKHFGVVAPPTVLFLDPQGKEIPNSRIVGEMSAFRFLKHLENLRS

    >gi|212217972|ref|YP_002304759.1| thioredoxin peroxidase [Coxiella burnetii CbuK_Q154]
    MAVLVGREAPDFTVPAVLANGDIVENFNLAEAIQNKYGLVFFYPLDFTFVCPSELIALDKAIADFQKRRVEVIGVSIDSQ
    FTHNAWRNTPVEKGGIGPVRYPLASDVTHSICRSYGVEHVAGVALRGAFLIDKQGIVRSQIVNDLPLGRSIPELLRLVDA
    LQFTEEHGEVCPANWRKGDPAMQASPDGVAKYLAENADNL

    >gi|212218356|ref|YP_002305143.1| molybdopterin biosynthesis MoeB protein [Coxiella burnetii CbuK_Q154]
    MTLTSNDIQRYARHLPLIGREGQAHLFAARILCVGAGGLGASVLQYLAAAGIGTIGIVDGDQVELSNLQRQVIFSPEDIG
    KNKALVASRYLSRFNPSLKTIVREEFLNEDNATKILKDFELVIDCSDNYRTRYLLNDICIQLKKPLISASIYQFQGQCSV
    FNYKEGPCYRCLYEEPPPEELIPN
    CALGGVLGVLPGILGCIQATEALKIILDKGEVLSGRLLTIDALSMRTREFRVPKNP
    QCPCCYEGKSALDLFLNTDNSKKIREIEAQKLAQWLENQNDNLLLIDVREPYEREICHIGGQHIPLRELDARQANLPRNK
    FIICY
    CKSGQRSRRAVQLLMDNGFTNVSSLQGGIMAWISSIDHSLTKY

    >gi|212218367|ref|YP_002305154.1| thiol:disulfide interchange protein [Coxiella burnetii CbuK_Q154]
    MSAIALALSKPAALKATTIDTKGQPTLGNPAAPVHIVAFEDLKCPNCARFNVEVLPAIKKKYINTGVAKYILITLAFLPG
    SPPAGNAALCLYKQNKNYFFPFVSYLYQHQPDETQNWATIPRLLQFARNSVPQANMKQLSNCIFSSRYSGALQKNLKIAE
    KTMNPVATPAVYVNGVNVEPLTQKRLEALIKGARSRAKN

    >gi|212218435|ref|YP_002305222.1| biotin synthesis protein [Coxiella burnetii CbuK_Q154]
    MMVNSLKKRIQRSFNKAFDTYDDHASIQREICKQLLKPLKEMRIQTKIIADFACGTGISTKAVADSFPYQNLYAIDFCEK
    LLIQAKSKLKESNVEFILADFETNVFLCNSLDLIFCNMGFQWALDLKQTFFSLFSQLKAFGVLAFSVPLLGTFCELRND
    C
    RNPFLTLQSIFQLLKAVGFELLTADEKIFTDSFESPLDAIRSIKSIGANCLLYPKRNKGLSPMPIEKNNTDTTLTYHIGF
    FIAKKIIQ

    >gi|212218469|ref|YP_002305256.1| thioredoxin peroxidase [Coxiella burnetii CbuK_Q154]
    MPYLIPYCKFDSTFSQFLLRRKTMSIEVGQKAPIFTLPTDEGEMLSLDDLKGKKVILYFYPKDDTPGCTKEACGFRDVWS
    QLSKAGAVVLGISKDSVKAHQSFKQKYNLPFTLLSDKDNTVCEQYGVMVDKNRFGKKYKGIERTTFLIDEEGVISAVWPK
    VKVDGHVAEVVGRL

    >gi|212218480|ref|YP_002305267.1| rhodanese-related sulfurtransferase [Coxiella burnetii CbuK_Q154]
    MLETEKCTKIFLSFSLNSRRIIMNLSLTQDPQKAKEFFEKKMAFTTGPVEVSGMLKKNAKIQVVDVRAAEDYKKGHVPGA
    INLPSNEWEKAAEKLDKEKTNIIY
    CYSQVCHLAAKAAVKFAEQGFPVMEMEGGFKTWTEHKLETEK

    >gi|212218618|ref|YP_002305405.1| thioredoxin reductase [Coxiella burnetii CbuK_Q154]
    MNKPQHHSLIILGSGPAGYTAAIYAARANLKPIMITGMEQGGQLMTTTDVDNWPGEAPGLQGPQLMERMQKHAERLDTQF
    IFDHINEADLNQRPFLLKGDNATYSCDALIIATGASARYLGLPSEKAYMGKGVSA
    CATCDGFFYRGKKVAVVGGGNTAVE
    EALYLSHIASHVTLIHRRDKLRAEKMLSAQLIKKVEEGKVAIVWSHVIEEVLGDDQGVTGVHLKHVKEEKTQDLTIDGLF
    IAIGHDPNTKIFKEQLEMDEAGYLRAKSGLQGNATATNIPGVFAAGDVTDHVYRQAITAAGMGCMAALDAERYLDSLNQA


    >gi|212218692|ref|YP_002305479.1| thiol-disulfide isomerase and thioredoxin [Coxiella burnetii CbuK_Q154]
    MALTPSKMIPLGTKAPDFNLPDAVSGKKMSLAQLKSNKATVIMFICNHCPFVQHIQEKLVEVAKEYQAKGIQFIAINSND
    IENYPEDSPEKMKITAEEFDYPFPYLFDESQEIAKAYQAECTPDFYVFDKNLACVYRGRFDSATPGRDTPVTGEDLRSTL
    DNILAGNLVDPNQQPSQGCNIKWKK

    >gi|212218719|ref|YP_002305506.1| bifunctional methionine sulfoxide reductase B/A protein [Coxiella burnetii CbuK_Q154]
    MDKRSSLPPIVRHITCDQMTEPAFQGEYTDLKETGRYLCRQCGIALFRSQDKFHSGCGWPSFDATIAGTIKRLPDPDGQR
    IEIRCERCGAHLGHVFEGEALTPKNTRY
    CVNSLSLDFVTDSQIRDTEEAIFAGGCFWGVEYYFKRLPGVVKTEVGYTGGH
    KNNPTYEEVCSRTTGHVEAIRVLYDPQQINYEKILHYFFEIHDPTQTDGQGPDLGDQYHSVIFYYDNQQKRMAEMAIKVL
    TEKGYRIATRLAPVSIFWRAEDYHQDYYQKTGKQPYCHHYVKRF

    >gi|212218761|ref|YP_002305548.1| HesB protein family [Coxiella burnetii CbuK_Q154]
    MTQAETIIEFTKAAYTHIQSLIKKRTEHSFFRLSIKKTGCSGYMYQPEIVENPKENDVLMKTAIGLSVAIDPKCLHMIKG
    TVVDYVKKDLGQYQLHFNNPNAIGACGCGESFHLKEE

    >gi|212218793|ref|YP_002305580.1| thiosulfate sulfurtransferase [Coxiella burnetii CbuK_Q154]
    MMYKQISHLEAWELVKKRDIVIADVRDQDSYEEEHIANALHLSMAKLQEYSEKADKEKPVLVYCYHGISSQSVAQHLVEQ
    GFKEVYSLIGGFETWKAHHPTSDANKN

    >gi|212218797|ref|YP_002305584.1| glutaredoxin [Coxiella burnetii CbuK_Q154]
    MRVHEEIQQQVTSNPVVLYMKGTPDFPQCGFSGRVVQILRQCKIDFTSFNVLESPELRQGIKEFSSWPTIPQLYIKGEFI
    GGCDIVGELFETGKLQELL

    >gi|212218928|ref|YP_002305715.1| dihydrolipoamide dehydrogenase [Coxiella burnetii CbuK_Q154]
    MTKEIKTEVVVLGSGPGGYAAVFRAADLGKKVVLVERYETIGGVCLNVGCIPSKALLHVAKVIDDAKDMSSFGIDFGKAA
    LEIEKIRSWKENVVKKLTGGLKMMAKQRKVEIITGYGKFSSSNELAVENKEKSVTKIKFDQAIIAVGSLPVKLPFIPDDP
    RIMDSTGALELEDVKGHLLVLGGGIIGLEMATVYHALGTKISVVEMMDQLIPGADADVVKPLHQRIQKRYEEILLKTKVT
    KIEPKKDGLYVTFEGENAPKEPKKYDRILVAVGRSPNGKLIDAEKAGVKVDDKGYIAVDKQMRTNVSHIYAIGDVVGQPM
    LAHKATYEGRLAAEVIAGKKHYNDARCIPAVAYTDPEVAWVGLTETQAKEKGIKYEKGVFPWAASGRALSLNRSEGSTKL
    LFDEKGTVIGGGIVGVNAGDLISEVALAIEMGCDAEDVGLTIHPHPTLSETVMMACEMFEGTITDLIPPKKKDK

    >gi|212218935|ref|YP_002305722.1| thioredoxin [Coxiella burnetii CbuK_Q154]
    MAIMELTQSNFDNVVSQHDLIIIDFWANWCAPCLTFTKIIEEVEKDYPEVVFGSVNIEKEKSLAEEFNVKSIPAVMILRD
    RVVVFAESGALPREGLRELIEKAKDLNTDILREAQKQKARE

    >gi|212218949|ref|YP_002305736.1| o6-methylguanine-DNA methyltransferase [Coxiella burnetii CbuK_Q154]
    MSDAVCYQATVSTPVGKIGVRTSDDHLLGIDYLYDDSILVKPKTILAKETVEQLLCYFADPEFPFEIPIALGLTPFQETV
    LNALRTIPVGTTRTYAQLAEQLDTRARPIGNACRKNPIPIIIP
    CHRVVAATHLGGYSGATKGKLLAVKQWLLQHESASFE
    SNLGEKLKKTK

    >gi|212219051|ref|YP_002305838.1| thioredoxin reductase family protein [Coxiella burnetii CbuK_Q154]
    MPIERVDVAIVGGSFSGLSAALLLGNSLRNVIVIDDNQPRNLKSAHAFNLLGNEQTKPLTFLKRARKEVQQLETAQVISG
    NIKSISGINNRGFTLQLQNGPRIESRKIILAKGVVDELPAIKGIETFWPDNIFH
    CPYCIGYAVKNEPLAVYSTEEEAYVL
    ALIIHKWTSDFILFTDGHEVLSDPQLEHLKDLGIRVYSQKISQFTGVRGKFIVAHLSDQQQIKRRGIFMHLKFKQRAPNL
    IADLGCSYNEENLLHVNEFFKTSVDGVYAIGDMALKVQKITTAIASGSVAAFAVDELTDEMAVFA

    >gi|212219201|ref|YP_002305988.1| peroxiredoxin [Coxiella burnetii CbuK_Q154]
    MIKIGEQFPSFSLKAVISNDVNKAFTEINEKSYANKWLVLFFWPKDFTFVCPTEIAEFGRLNGEFADRDAQVLGASVDSE
    FVHLAWRREKEELSQLPFPMLSDIRRDLSQRLGILNEKEGVAERATFIVDPNHIVRFVMVNDLNVGRNPQEVLRVLDALQ
    TDELCPCNWQQGEETIVVA

    >gi|212219230|ref|YP_002306017.1| rhodanese-related sulfurtransferase [Coxiella burnetii CbuK_Q154]
    MKIVNIAAYKFVTILNESLPTLQKQLREKALECNLKGTILLSTEGVNLMMAGQREAIEIYKQFLADKKEFKDLTYKKSFS
    SFYPFEKLVVRIKKEIITMHCADINPEKETAPHLSPEILHRWYEEKQEMVILDTRNRFEFVMGTFANAIDLNLTSFSDFP
    QAVDSLPESFKEKPVVTF
    CTGGIRCEKASALMLKKGFKKVYQLDGGILNYFEKCGGEYFKGKCFVFDDRIALEAGSS

    >gi|212219238|ref|YP_002306025.1| glutaredoxin [Coxiella burnetii CbuK_Q154]
    MAKIEIYTTARCPYCVRAKALLDRKGLDYMEIRIDEAPEKRDEMLSRSEGRRTVPQIFINGRGIGGFDELWELEQSKKLD
    ELLKT

    >gi|212219239|ref|YP_002306026.1| rhodanese-related sulfurtransferase [Coxiella burnetii CbuK_Q154]
    MVTMEQLPEFIARHWLLVAAFIVALMALLIVEARSKGLSGKYRLTPQHAIRLINSEKAVIVDIRDANAYSKGHITNAINI
    PATELDKHPQRLEQYKQQPIILV
    CAMGQKSGPLRNKLHKKGYEKVYLMIGGMNAWNSANMPIVK

    >gi|212219467|ref|YP_002306254.1| rhodanese-related sulfurtransferase [Coxiella burnetii CbuK_Q154]
    MKEHCPSFVALAKEAKSHIEETDIYTVKKMMDNEEDFELVDVREESEWDEGHLPSAIHLGKGIIERDIEKVIPNRNRKLI
    LY
    CGGGFRSALAAESIKKMGYKNVLSMDGGFRAWREAGFPIIMD

    >gi|212219584|ref|YP_002306371.1| thioredoxin [Coxiella burnetii CbuK_Q154]
    MSEHVHTASDENFETEVLQADMPVLVDFWAEWCQPCKMISPVVEEIAKEYAGRVKVFKFNVDENAQTPTKYGVRGIPSLL
    IFREGEVVDRKVGALNKSQLAAFLDERLHFSS

    >gi|212219202|ref|YP_002305989.1| peroxiredoxin reductase (NAD(P)H) [Coxiella burnetii CbuK_Q154]
    MKRSEIRERHHNFPYFASLHTGYVRRINMLQTYKDQLPDYAKDLKLNLTQVLSESPSSELSNQQITGVALAVAYATRNRQ
    LIELIFQKAEAELDESTLQAIKAAASIMAMNNIYYRFVHLVKDSEYQRLPANLRMNIIANPGIDKKDFELYSLAVSAING
    CGL
    CIDAHANTLIKSGLSKHSIQHVIRIAAVLNGLAQVSIIENKT