Coxiella burnetii CbuG Q212 uid58893

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|212211688|ref|YP_002302624.1| outer membrane protein [Coxiella burnetii CbuG_Q212]
    MKNRLTALFLAGTLTAGVAIAAPSQSSFSPQQVKDIQSIVHHYLVNRPEVLVEASQALQKKTEAQQEEHAQQAIKENAKK
    LFNDPASPVAGNPHGNVTLVEFFDYQ
    CGHCKAMNSVIQAIVKQNKNLRVVFKELPIFGGQSQYAAKVSLAAAKQGKYYAF
    HDALLSVDGQLSEQITLQTAEKVGLNVAQLKKDMDNPAIQKQLRDNFQLAQSLQLAGTPTFVIGNKALTKFGFIPGATSQ
    QNLQKEIDRVEK

    >gi|212211733|ref|YP_002302669.1| thioredoxin peroxidase [Coxiella burnetii CbuG_Q212]
    MAVLVGREAPDFTVPAVLANGDIVENFNLAEAIQNKYGLVFFYPLDFTFVCPSELIALDKAIADFQKRRVEVIGVSIDSQ
    FTHNAWRNTPVEKGGIGPVRYPLASDVTHSICRSYGVEHVAGVALRGAFLVDKQGIVRSQIVNDLPLGRSIPELLRLVDA
    LQFTEEHGEVCPANWKKGDPAMQASPDGVAKYLAENADNL

    >gi|212211767|ref|YP_002302703.1| thiol:disulfide interchange protein [Coxiella burnetii CbuG_Q212]
    MSLKKPPKGTSFWHGCRNDVRKRAPVVHFIVEMCLDKSMIRRLITLLVLFFLPIYALSEQPVPVDQAFQFSAMAKDYQTV
    ISLWNIKPGFYLYRNRIHFSSLKSADYLGEPLWPRVDTVKDYPGIGKLPVYQGQLRISVPVIKAMNQTLYLKVDYQGCSE
    KGFCYPPTTKTVAIDLAGNYMQPVAPLAIDIAPGKTAGPKAAPPITQQDRVTQLLTHKNLFFVLLSFFGFGLLLSFTPCV
    LPMIPVLSGIIVGQQKYPKRAFGLSLMYVLGMAITYAIAGVIFGFIGSTVQAAFQNPWLIGLFSLLFIAMALSLFGLYDL
    QLLPQRWQTRLAQASDRQKHGTYLGTALMGALSTLILSPCVTPALVGVLGYISHTGNASLGGVALFTMGLGMGAPLLLLG
    AFSRKWLPKAGPWMTVIKHILGVLMLAVAVWLLARILPGTVTMFLWAALAVGSAIALGALSTTQTKMQKIGKTLGLFLLV
    YGIVLATGGLSGNTNPLRPISLASLPEKGEGPSFTAVYTLPDVEHQLKMATTKGQPTMIDFYADW
    CISCKQMEQFTFANQ
    NVQKALAGFRLLRADVTRNDQGSTVLEKHFGVVAPPTVLFLDPQGKEIPNSRIVGEMSAFRFLKHLENLRS

    >gi|212211903|ref|YP_002302839.1| iron-sulfur cluster insertion protein ErpA [Coxiella burnetii CbuG_Q212]
    MDNLLMNALAQKTPSPPTLVFTEAAARKVKGLIDEENNPYLNLRVFITGGGCSGFQYGFTFDEAINSDDLVIEKQLEEED
    DDEGGTGQMALVKLLVDPLSLQYLQGAEIDYREDVSGAQFVIRNPNAKTTCGCGSSFAA

    >gi|212212119|ref|YP_002303055.1| rhodanese-related sulfurtransferase [Coxiella burnetii CbuG_Q212]
    MVTMEQLPEFIARHWLLVAAFIVALMALLIVEARSKGLSGKYRLTPQHAIRLINSEKAVIVDIRDANAYSKGHITNAINI
    PATELDKHPQRLEQYKQQPIILV
    CAMGQKSGPLRNKLHKKGYEKVYLMIGGMNAWNSANMPIVK

    >gi|212212120|ref|YP_002303056.1| glutaredoxin [Coxiella burnetii CbuG_Q212]
    MAKIEIYTTARCPYCVRAKALLDRKGLDYMEIRIDEAPEKRDEMLSRSEGRRTVPQIFINGRGIGGFDELWELEQSKKLD
    ELLKT

    >gi|212212127|ref|YP_002303063.1| rhodanese-related sulfurtransferase [Coxiella burnetii CbuG_Q212]
    MKIVNIAAYKFVTILNESLPTLQKQLREKALECNLKGTILLSTEGVNLMMAGQREAIEIYKQFLADKKEFKDLTYKKSFS
    SFYPFEKLVVRIKKEIITMHCADINPEKETAPHLSPEILHRWYEEKQEMVILDTRNRFEFVMGTFANAIDLNLTSFSDFP
    QAVDSLPESFKEKPVVTF
    CTGGIRCEKASALMLKKGFKKVYQLDGGILNYFEKCGGEYFKGKCFVFDDRIALEAGSS

    >gi|212212132|ref|YP_002303068.1| copper-exporting ATPase [Coxiella burnetii CbuG_Q212]
    MLMNTTKHQLTLKNMHCASCVASIESALKNVAGVKSVSINFATKQAEVEGDVDVKTILKAIKDQGYEAEIAGDDEEAQNE
    AQSHFRDLLKKAIFAAVVGFPLMINEFWAWLPSVNQPRIQWVWVIIGVLSFFVLYYCGGHIYRGAWRAFLKRQTNMDTLV
    AMGTGTAWLYSFIVVLIPMWIPPMARHAYFDTSTILIAFITFGAALEIRARGKTGEAIKRLIGLQPKTARVIRDDQEIDI
    PIAEVQIDDHLRVRPGEKIPVDGKIIKGASPIDESMLTGEPLPVVKSQDDEVIGGTINKSGTFIYRATRVGKDTALAQII
    ALVKRAQNSKPKIGRIVDKVSAVFVPVVIIVAILTAIGWLNFGPEPKAAFVLITTVAVLVIACPCALGLATPISIIVGVG
    KGAEMGVLIRNGDALQMASQLTAIILDKTGTVTEGKPMLSDFYTADGFDEKKLLSIAASVEKGSEHPLANAIIEGAKKYN
    IPLANATQFESIAGHGVKAKIENQSILLGNLHLMKNEKVELGGAPAHAERMADQGQTPIYIALDGKIAGIVSIVDPIKPD
    SQKAIADLQRAGLKVVMVTGDNPLTANAVAKQVGIEQVIAEVLPEDKAKKVKLLQQQGERVAMVGDGINDAPALAAADVG
    FAIGTGTDVAIESADIALISGSLTGVVNAISISKATLRNIKQNLFGAFIYNTLGIPIAAGVFYPLTGLLLSPIIAGAAMA
    LSSVTVVANANRLRFFRRRKRT

    >gi|212212159|ref|YP_002303095.1| peroxiredoxin [Coxiella burnetii CbuG_Q212]
    MIKIGEQFPSFSLKAVISNDVNKAFTEINEKSYANKWLVLFFWPKDFTFVCPTEIAEFGRLNGEFADRDAQVLGASVDSE
    FVHLAWRREKEELSQLPFPMLSDIRRDLSQRLGILNEKEGVAERATFIVDPNHIVRFVMVNDLNVGRNPQEVLRVLDALQ
    TDELCPCNWQQGEETIVVA

    >gi|212212270|ref|YP_002303206.1| HesB protein family [Coxiella burnetii CbuG_Q212]
    MTQAETIIEFTKAAYTHIQSLIKKRTEHSFFRLSIKKTGCSGYMYQPEIVENPKENDVLMKTAIGLSVAIDPKCLHMIKG
    TVVDYVKKDLGQYQLHFNNPNAIGACGCGESFHLKEE

    >gi|212212313|ref|YP_002303249.1| bifunctional methionine sulfoxide reductase B/A protein [Coxiella burnetii CbuG_Q212]
    MDKRSSLPPIVRHITCDQMTEPAFQGEYTDLKETGRYLCRQCGIALFRSQDKFHSGCGWPSFDATIAGTIKRLPDPDGQR
    IEIRCERCGAHLGHVFEGEALTPKNTRY
    CVNSLSLDFVTDSQIRDTEEAIFAGGCFWGVEYYFKRLPGVVKTEVGYTGGH
    KNNPTYKEVCSRTTGHVEAIRVLYDPQQINYEKILHYFFEIHDPTQTAGQGPDLGDQYHSVIFYYDNQQKRMAEMAIKVL
    TEKGYRIATRLAPVSIFWRAEDYHQDYYQKTGKQPYCHHYVKRF

    >gi|212212337|ref|YP_002303273.1| thiol-disulfide isomerase and thioredoxin [Coxiella burnetii CbuG_Q212]
    MALTPSKMIPLGTKAPDFNLPDAVSGKKMSLAQLKSNKATVIMFICNHCPFVQHIQEKLVELAKEYQAKGIQFIAINSND
    IENYPEDSPEKMKITAEEFDYPFPYLFDESQEIAKAYQAECTPDFYVFDKNLACVYRGRFDSATPGRDTPVTGEDLRSAL
    DNILAGNLVDPNQQPSQGCNIKWKK

    >gi|212212417|ref|YP_002303353.1| thioredoxin reductase [Coxiella burnetii CbuG_Q212]
    MNKPQHHSLIILGSGPAGYTAAIYAARANLKPIMITGMEQGGQLMTTTDVDNWPGEAPGLQGPQLMERMQKHAERLDTQF
    IFDHINEADLNQRPFLLKGDNATYSCDALIIATGASARYLGLPSEKAYMGKGVSA
    CATCDGFFYRGKKVAVVGGGNTAVE
    EALYLSHIASHVTLIHRRDKLRAEKMLSAQLIKKVEEGKVAIVWSHVIEEVLGDDQGVTGVHLKHVKEEKTQDLTIDGLF
    IAIGHDPNTKIFKEQLEMDEAGYLRAKSGLQGNATATNIPGVFAAGDVTDHVYRQAITAAGMGCMAALDAERYLDSLNQA


    >gi|212212564|ref|YP_002303500.1| biotin synthesis protein [Coxiella burnetii CbuG_Q212]
    MMVNSLKKRIQRSFNKAFDTYDDHASIQREICKQLLKPLKEMRIQTKIIADFACGTGISTKAVADSFPYQNLYAIDFCEK
    LLIQAKSKLKESNVEFILADFETNVFLCNSLDLIFCNMGFQWALDLKQTFFSLFSQLKAFGVLAFSVPLLGTFCELRND
    C
    RNPFLTLQSIVQLLKAVGFELLTADEKIFTDSFESPLDAIRSIKSIGANCLLYPKRNKGLSPMPIEKNNTDTTLTYHIGF
    FIAKKIIQ

    >gi|212212600|ref|YP_002303536.1| thioredoxin peroxidase [Coxiella burnetii CbuG_Q212]
    MPYLIPYCKFDSTFSQFLLRRKTMSIEVGQKAPIFTLPTDEGEMLPLDDLKGKKVILYFYPKDDTPGCTKEACGFRDVWS
    QLSKAGVVVLGISKDSVKAHQSFKQKYNLPFTLLSDKDNTVCEQYGVMVDKNRFGKKYKGIERTTFLIDEEGVISAVWPK
    VKVDGHVAEVVGRL

    >gi|212212612|ref|YP_002303548.1| rhodanese-related sulfurtransferase [Coxiella burnetii CbuG_Q212]
    MLETEKCTKIFLSFNLNSRRIIMNLSLTQDPQKAKEFFEKKMAFTTGPVEVSGMLKKNAKIQVVDVRAAEDYKKGHVPGA
    INLPSNEWEKAAEKLDKEKTNIIY
    CYSQVCHLAAKAAVKFAEQGFPVMEMEGGFKTWTEHKLETEKSY

    >gi|212212660|ref|YP_002303596.1| thiol:disulfide interchange protein [Coxiella burnetii CbuG_Q212]
    MSAIALALSKPAALKATTIDTKGQPTLGNPAAPVHIVAFEDLKCPNCARFNVEVLPAIKKKYINTGVAKYILITLAFLPG
    SPPAGNAALCLYKQNKNYFFPFVSYLYQRQPDETQNWATIPRLLQFARNSVPQANMKQLSNCIFSSRYSGALQKNLKIAE
    KTMNPVATPAVYVNGVNVEPLTQKRLEALIKGARSRTKN

    >gi|212212671|ref|YP_002303607.1| molybdopterin biosynthesis protein [Coxiella burnetii CbuG_Q212]
    MTLTSNDIQRYARHLPLIGLEGQAHLFAARILCVGAGGLGASVLQYLAAAGIGTIGIVDGDQVELSNLQRQVIFSPEDIG
    KNKALVASRYLSRFNPSLKTIVREEFLNEDNATKILKDFELVIDCSDNYRTRYLLNDICIQLKKPLISASIYQFQGQCSV
    FNYKEGPCYRCLYEEPPPEELIPN
    CALGGVLGVLPGILGCIQATEALKIILDKGEVLSGRLLTIDALSMRTREFRVPKNP
    QCPCCYEGKSALDLFLKTDNSKKIREIEAQKLAQWLENQNDNLLLIDVREPYEREICHIGGQHIPLRELDARQANLPRNK
    FIICY
    CKSGQRSRRAVQLLMDNGFTNVSSLQGGIMAWISSIDHSLTKY

    >gi|212212922|ref|YP_002303858.1| thiosulfate sulfurtransferase [Coxiella burnetii CbuG_Q212]
    MMYKQISHLEAWELVKKRDIVIADVRDQDSYEEEHIANALHLSMAKLQEYSEKADKEKPVLVYCYHGISSQSVAQHLVEQ
    GFKEVYSLIGGFETWKAHHPTSDANKN

    >gi|212212926|ref|YP_002303862.1| glutaredoxin [Coxiella burnetii CbuG_Q212]
    MRVHEEIQQQVTSNPVVLYMKGTPDFPQCGFSGRVVQILRQCKIDFTSFNVLESPELRQGIKEFSSWPTIPQLYIKGEFI
    GGCDIVGELFETGKLQELL

    >gi|212213052|ref|YP_002303988.1| dihydrolipoamide dehydrogenase [Coxiella burnetii CbuG_Q212]
    MTKEIKTEVVVLGSGPGGYAAAFRAADLGKKVVLVERYETIGGVCLNVGCIPSKALLHVVKVIDDAKDMSSFGIDFGKAA
    LEIEKIRSWKENVVKKLTGGLKMMAKQRKVEIITGYGKFSSSNELAVENKEKSVTKIKFDQAIIAVGSLPVKLPFIPDDP
    RIMDSTGALELEDVKGHLLVLGGGIIGLEMATVYHALGTKISVVEMMDQLIPGADADVVKPLHQRIQKRYEEILLKTKVT
    KIEPKKDGLYVTFEGENAPKEPKKYDRILVAVGRSPNGKLIDAEKAGVKVDDKGYIAVDKQMRTNVSHIYAIGDVVGQPM
    LAHKATYEGRLAAEVIAGIKHYNDARCIPAVAYTDPEVAWVGLTETQAKEKGIKYEKGVFPWAASGRALSLNRSEGSTKL
    LFDEKGTVIGGGIVGVNAGDLISEVALAIEMGCDAEDVGLTIHPHPTLSETVMMACEMFEGTITDLIPPKKKDK

    >gi|212213059|ref|YP_002303995.1| thioredoxin [Coxiella burnetii CbuG_Q212]
    MAIMELTQSNFDNVVSQHDLIIIDFWANWCAPCLTFTKIIEEVEKDYPEVVFGSVNIEKEKSLAEEFNVKSIPAVMILRD
    RVVVFAESGALPREGLRELIEKAKDLNTDILREAQKQKARE

    >gi|212213073|ref|YP_002304009.1| O6-methylguanine-DNA methyltransferase [Coxiella burnetii CbuG_Q212]
    MSDAVCYQATVSTPVGKIGVRTSDDHLLGIDYLYDDSILVKPKTILAKETVEQLLCYFADPEFPFEIPIALGLAPFQETV
    LNALRTIPVGTTRTYAQLAEQLDTRARPIGNACRKNPIPIIIP
    CHRVVAATHLGGYSSATKGKLLAVKQWLLQHESASFE
    SNLGEKLKKN

    >gi|212213403|ref|YP_002304339.1| rhodanese-related sulfurtransferase [Coxiella burnetii CbuG_Q212]
    MKEHSPSFVALAKEAKSHIEETDIYTVKKMMDNEEDFELVDVREESEWDEGHLPSAIHLGKGIIERDIEKVIPNRNRKLI
    LY
    CGGGFRSALAAESIKKMGYKNVLSMDGGFRAWREAGFPIIMD

    >gi|212213530|ref|YP_002304466.1| thioredoxin [Coxiella burnetii CbuG_Q212]
    MSEHVHTASDENFETEVLQADMPVLVDFWAEWCQPCKMISPVVEEIAKEYAGRVKVFKLNVDENAQTPTKYGVRGIPSLL
    IFREGEVVDRKVGALNKSQLAAFLDESLHFSS

    >gi|212212156|ref|YP_002303092.1| peroxiredoxin reductase AhpD (NAD(P)H) [Coxiella burnetii CbuG_Q212]
    MLQTYKDQLPDYAKDLKLNLTQVLSESPSSELSNQQITGVALAVAYATRNRQLIELIFQKAEAELDESTLQAIKAAASIM
    AMNNIYYRFVHLVKDSEYQRLPANLRMNIIANPGIDKKDFELYSLAVSAINGCGL
    CIDAHANTLIKAGFSKHSIQHVIRI
    AAVLNGLAQVSIIENKT