Corynebacterium urealyticum DSM 7109

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|172039801|ref|YP_001799515.1| methionine sulfoxide reductase A [Corynebacterium urealyticum DSM 7109]
    MDLFERMKALNTAGAYRAPRVTAETALAGGRHPVLPNPKPHMVLGTPLTGPWREGQAELVVGMGCYWGAERIFWETQGVE
    STAVGFAGGFTPNPTYRETCTGRTGHTEAVRIVYDPQRVSTAELLRIMFENHDPTQGDRQGNDVGSQYRGAVYALDAEQL
    AQAEKAVEAWQPAFTERGFGPITTEVALLADTPAGEFYLAEDEHQQYLAKNPDGYCNHGPNGVSCQTGVLG

    >gi|172039854|ref|YP_001799568.1| alkyl hydroperoxide reductase subunit [Corynebacterium urealyticum DSM 7109]
    MAKKLLDDNLKAQLSQLVDRITEKVELVYSLDDRSQSADLKQLLEDIAALSDNITARQDDELHERKPSFTIQRAGSDVGV
    SFAGIPMGHEFSSLVLALLQVGGNPIKEEQDLIDQVAALDGDFEFTTYMSLT
    CQNCPTVVQALNAMSVINPRIKHTAVEG
    SLFQDEVNEKGIQAVPTVYLNGEEFASGRMDIQDFVARLDDGHAEREAAKLNEKEPYDVLVVGQGPAGATSAIYVARKGL
    RVGLVGERFGGQVLDTQSIENYSSVPKTDGQSFAANLEAHVNDYEIDVIKAQSATGLTPGKDGELSTVHFGENASLKARE
    VIVATGANWRLMGVPGEDEYRNKGVSF
    CPHCDGPLFKGKDIAVIGGGNSGIEAAIDLAGVVNHLTVLEFADTCRADDVLM
    DTLRSLKNVDIVTSAATKEIIGNGKEVTGLKYEDRTTGEEKTLELSGLFIQIGLLPNTKWLEGSGVELNQMGEIVIDAKG
    KTNVPGVYGAGDCATVPFKQIVIATGTGATAGLSAWEHNAIG

    >gi|172039855|ref|YP_001799569.1| alkyl hydroperoxide reductase subunit [Corynebacterium urealyticum DSM 7109]
    MSLINTEILDFKNPVFHNGEFSEVSKDDVLGKWSVFFFYPGDFTFVCPTELGDLADHYEELQKMGVEVYGVSTDSHFVHK
    AWHESSEEVGKVNYPMIGDSNGDLTRNFQNMREGVGQADRATFLVDPQGIIQYIEQTAEGIGRDASELVRKIKAAQYVAE
    HPGEVCPAKWEEGQDTLTPGIDLVGKI

    >gi|172039856|ref|YP_001799570.1| hypothetical protein cur_0176 [Corynebacterium urealyticum DSM 7109]
    MIITGLALGVVLGWVMQRGRFCVTGMIRDIFLNKTWRGFTALLIVIAVHAVGLAALTTAGVITPDYKEFAPLAVTLGGLL
    FGAGIVLAGG
    CASGTWYRSAEGLIGSWLALIFYAGSAAAMKGGALNSLNEGLRSWTLPLTTINASLGISVWWLVIPFAIG
    VAFLTRHFLAEEAAAPKMATLKPKKTGLAHILAEKPWHFYPTAAIIGVLGVIAWPLSAATGRNDGLGITSPSSNLSKFLI
    SGEDTVDWGVLLVLGLLVGAFFAAKASGEFRLRLPSANQAVRSVVGGILMGVGASAAGG
    CTVGNGMVQTSLFSYQGWVAL
    LFISIGIWAAAKLWLKPTDAVPGQSAQPKQDTPKADATPTVAAPAAQSAEAADLQSAGAQYGFQTAGVALLERPQVATAA
    GSTSVNTGTTTGLELVGDRTYKLDSLGAVCPFPLIDAKAAIAQLEVGDSLQIDFDCTQATDAIPRWAATDGHEVTNFEQT
    DEAGWTITVKKGE

    >gi|172039903|ref|YP_001799617.1| hypothetical protein cur_0223 [Corynebacterium urealyticum DSM 7109]
    MTDDEKKTVTLLTRATCGSCARVWEQIRPVVAAKNATLERVDVDEDPELKMEFGDRVPVVLIDDEEFACWEVDNEELAAA
    LER

    >gi|172039914|ref|YP_001799628.1| thiol-disulfide isomerase/thioredoxin [Corynebacterium urealyticum DSM 7109]
    MSRRGAHLRSTRPNLRSRSRAALAALLTAAVSIGGLTACGEAATGDDAVAVGGTFEFVSPGGQTSISYPQEERKEVANLT
    GESLMEEGEQINLEDYAGKAVVLNTWGQW
    CGPCRSEADDLERVHEKLEKRGDGTVLGINVRDPSREKPKNFVRTYGITYP
    SIYDPPFKSALRLGGIPASVVPTTIVLDKQHRPAHIFLKEITDDELWKVLEPILNEDDGAAAGEGA

    >gi|172040312|ref|YP_001800026.1| putative mercuric reductase [Corynebacterium urealyticum DSM 7109]
    MPTKYDLAIIGSGGGAFAAAIRASTLGKSVVMIERGTLGGTCVNTGCVPSKTLIAAAGARHVAVDAATRFPGIATTADPV
    DMPALIAGKQALVESLRGEKYADVADSYGWQVLRGDASFVGTPDAPVLDVAGSDGSVETIEAHHYLVATGSRPWAPPIDG
    LEETGYLTSTMAMELTEVPESLLVLGGGYVALEQAQLFARLGSQVTLLVRSRLASKEEPEVSKALQEVFADEGIRVVSRA
    VPTRVSRGTGGEAVVTAALSGGSQEFRADQVLVALGRRPVTDGLNLDAVGVNTGDSGEVVISDRLQSSNPRVWAAGDVTG
    HPEFVYVAAHHGTLVAENAFADADRSVDYARLPRVTFTGPAIGAVGMTEKDVLAAGIRCDCRVLPLHHVPRALVNRDTRG
    FIKIVVNAETNEILGLTAVAKDAGELAAAGVHVLGRTVAEVANAWAPYLTMAEGIRIAAKAFTTDPSLLSC
    CA

    >gi|172040376|ref|YP_001800090.1| molybdopterin biosynthesis protein MoeB [Corynebacterium urealyticum DSM 7109]
    MSSHPVDAAGSASASKRYSRQVTLMGPQAQEKLAASRVAVIGAGGLGSPALLYLAAAGVGRITLIDDDTVELTNLHRQVI
    HSSTAAATGESKAHSARARMTELNPDVHIDPVVERLTWENALTFLEGADLVLDGTDNFDTRHVASHAAARLGIPHVWASI
    LGYQAQLSVFWAGHGPIYEDLFPTPPAPGAVPS
    CSQAGVLGPLVGIVGSAMALEAIKLITGVGRPLLGRLAYYDSLTASW
    EEIPVAANPAVTEQVRTGTPPHGPVEVTEVPPGSTIIDVREPKEFAEFHLPGAINVPLAEILGGYTPPEVENGAVVV
    CAR
    GARSAHAVDALERRGITGLASLRGGLARFR

    >gi|172040477|ref|YP_001800191.1| hypothetical protein cur_0797 [Corynebacterium urealyticum DSM 7109]
    MCFRNSSQPESFNSQRPHTLAAGPPRLEYNFAHQLPELAAPYEPAAPLPEARILVLNEPLAVELGLDVAWLRSPAGVQFL
    LGRGTDSDARPVAQFYAGHQFGSFNALMGDGRAVLLGERRVPDTDELVDLHVKGAGTTVYSRPGSDGKAPLSAALREFLL
    SEFMSAAGVPTARSLAVLTTGEQLRRHRTEPAAAVVRVATSHLRVGTFQAARMRDPESASGLLGRVADMAIQRHFPELAE
    LAAPERYLELYRHVSAAQARLIARWMRLGFVHGVMNTDNTAIGGFTLDYGPAAFVDHFDPQAVFSSIDTHGRYAFGNQPA
    IGGWNLARLAEAMLPLLTPTPGVDSAEANRSAVAEAQEVLDEYSAIYTRALDEEFADALGLDPQQPSHQHVLSEFQALAD
    EHQLDVAQVLRQLTDTEANLVEISSQAWHDTWSASGGLDNNSAALRDVVGWCEQWANANPDRMLLSRTNPVYYPRNAHVE
    ESLASALGGDYSPFEQLWEALRDPFTRRAGLEHWEKPTPSPRGFRTV
    CGT

    >gi|172040506|ref|YP_001800220.1| dimethyl sulfoxide reductase chain B [Corynebacterium urealyticum DSM 7109]
    MAKKNASQENQRLGFYFDQSLCNGCKACQIACKDKHDTPLGTNWRRVVEYSGGDWNLANGVFNHDTFTYYTSISCNHCED
    PICAKVCPTTAMHKGEDGIVTVDPDKCIGCRYCEWACPYSAPQFNPETKQMSKCDLCADLRAEGEEPACVTACPSRALDW
    GPIDELREKYGDISAVAPLPDPSITKPNLVIRPHRDAKEWDTNHGEIMNRQEI

    >gi|172040520|ref|YP_001800234.1| mycothione reductase [Corynebacterium urealyticum DSM 7109]
    MNNVNAEHTTAPGEIQDFDIIIVGTGSGNTIPAPINDEKKIAIVEKGVFGGTCINVGCIPTKMFVHTADVARSFRTADKL
    SLTGSLDNVDWKGIQQRVFGDRIDPIAEGGAAYRAGDETPNITLFHGDAASFVAPRTLRIGDGADAPVIRGKDVVLATGT
    RPWIHPVLADSGVRYRTNEDIMRLEAQPESLIILGGGIVAVEFAAIFDALGTKVTVVNRSKRLLRKLDAEISEAFTEQAR
    KQWETHLGVEPRSARETNNGQVELTLDDGTVLVADEILAAQGRISNADTLALEAAGVDKKANGKIKVDEFGRTTAEGVWA
    LGDASNDFDLKHVANQEAKVVQHNLAHPEDLRANDYRAVPSGVFTHPQIAVVGMTEADAQATGRELTVKVQAYADVAYGW
    AMEDTTGFCKVIADRKTGEILGAHIMGPEASTLIQSFVTAMTFGIDARRFATEQYWPHPALTELVENALLGLEFD

    >gi|172040597|ref|YP_001800311.1| peptide methionine sulfoxide reductase [Corynebacterium urealyticum DSM 7109]
    MTEDFQNLSAEQWRQRLNPEEFQVLRLAGTERPHTGEYVDTETEGVYRCRGCGSEIFRSSEKFHSGCGWPSFFDPADSDA
    VVLREDLSLGMRRVEVLCATCHGHLGHVFEGEGYDTPTDLRY
    CINSIALTLEPREL

    >gi|172040789|ref|YP_001800503.1| thiamine biosynthesis protein ThiF [Corynebacterium urealyticum DSM 7109]
    MAESAHTPSPDAAGTGQAFPAGDFVSLPYREQRRTARHLNLPGFGAAEQQRLHDARVLVVGAGGLGCPAMQSLASAGVGT
    IVLYDDDTVDVTNLHRQILFSAEDVGRAKVDAASDALKRIQPDIRVETHRCRLDTENIVEAFRQVDLVIDGSDNFDTKFL
    VADAAEISGTPLVWTTVLRFAGQISVFNSTASGERGIGLRDLFPEKPSGDSIPD
    CASAGVLGATTAVMGALAATEAIKWV
    TGVGQPLLGTVVSYDALTARTQSFRIAPDPSRQPVVALSPNDGPASSTTACAVQSPEDSHTTPDQDPGPRPAKAPSNAAL
    HELVRTGKAFTVDVREYHETLLAQPSFIGEQGADEHLAMSALADPAGTLDVASPAVAEAFARHQGTDAVVYCASGVRSQH
    FVEKYGQAASEYGITLHNLPGGVRG

    >gi|172040834|ref|YP_001800548.1| methylated-DNA--protein-cysteine methyltransferase [Corynebacterium urealyticum DSM 7109]
    MTSWALISDAMDANFSSGGVTPRRRYTVLASPVGRLWLIAEGEFLVGCWFDQPDRIPDLTGVVEVPAESDAVLGSAASIL
    SRFFDGDVVALDEARDLPLAPSGTAMQQAVWQELRRIPVGQTRSYLEVARSIGRPKAARPVGQAVGHNPISILVP
    CHRVV
    GSNGSLTGFGGGLERKIELLTREGVRL

    >gi|172040921|ref|YP_001800635.1| hypothetical protein cur_1241 [Corynebacterium urealyticum DSM 7109]
    MTAPEKVTGVELTDAAVAKASSLLAQEGRDDLALRIAVQPGGCAGLRYQLFFDDRSLDGDLKDEYEGVNLVVDRMSAPYL
    MGAKIDFADTIESQGFTIDNPNASGSCACGDSFS

    >gi|172040993|ref|YP_001800707.1| putative cation-transporting P-type ATPase [Corynebacterium urealyticum DSM 7109]
    MPLVWLFACPFPSAANLAIYPRGYRVGGGKEVENLSQHQDSSATEVGAIGAAQPVLDLDYQITGMTCASCANRIERKLNK
    LDGVTASVNYATEKAHVEQDGAAEAVTDEQIREIIADMGYEAQLSQPLASQPAAGDPQGGAGEQGAADAIQPGGEPTSQT
    PAEQAAERELEGLRNRLIGSLWLAIPVIVLAMIPNLQFTNWQWLSLTLAAPVIVWAGYPFHRATWLNIKHGAVTMDTLIT
    VGTGAAFLWSLVALFFGTAGEPGMSHTWNLFNAHSDPMGDIYLEVAAGVIMFVLAGRYYEKRAKHRAGEALRALSELGAK
    DVAVVDDAQGGNERRIPIGQLAEGMYFVVRPGEKIATDGRVVAGSSAVDESMLTGESVPVEVAPGDGVTGATVNASGRLI
    VEATRVGSDTQLAQMAKLVEQAQSGKADVQRLADRVSAVFVPVVIALAVITLVAWLLITGDVGAAMASAVAVLIIACPCA
    LGLATPTALLVGTGRGASMGVLIRGPETLEQTRGVDAIILDKTGTITTGEMTATEAWLAPAADKIEDGSGKVGITEAELW
    RIAGAVENHSEHPIAQAIAERARTEIGGELPEAEDFESVPGRGVTATVDGVTVQVGRGFETSDGTTVGAEIVERSGLGGT
    VVPVLVAGQLAGAVAVEDAVKPDSAEAIAQLEELGLEPMLVTGDNEQVAREVAGLVGINPDNVRAGVMPADKVTAVKDLQ
    AEGKRVAMVGDGVNDAAALAQADLGIAMGTGTDVAIEAADITLVRAEMSAVVDSIRLSRKTLRTIKMNLFWAFAYNVAAI
    PLAAFGLLNPMLAGAAMALSSVFVVSNSLRLRGFKSIQPEVEEK

    >gi|172041063|ref|YP_001800777.1| hypothetical protein cur_1383 [Corynebacterium urealyticum DSM 7109]
    MYTVARRRKEAKGKEPAVATTNELNMYFDVTCPFAWVTSRWLLEVEKVRDVKVNFIPMSLSVLNDGRDLDPAYMDRMEAA
    WAPALAAAAIYAKHPDQIADYYTLMGEAIHNENRGERDYIGCYDDLIAEVVEKLDLPEGFIDRIGLRPHAENAFLDELKE
    THRRGLSLVGDEVGTPIVDIDGRGFFGPVLTRVPTGEQAGELFDASVTLGSYPHFFELKRTRTENPSATETAVG

    >gi|172041130|ref|YP_001800844.1| bacterioferritin comigratory protein [Corynebacterium urealyticum DSM 7109]
    MTKNNDTANIRLAEGDEAPGFALTSDKGETIDLKDYRGKKVLVYFYPRANTPGCTKEACDFRDNLAQLNDQNIDVVGISP
    DKPESLAKFRDKYELTFPLLSDPDKAAMTAYGAFGEKKNYGKIVQGVIRSTFLVDEKGKIALARYNVKATGHVVRIMKEL
    EA

    >gi|172041164|ref|YP_001800878.1| glutaredoxin-like protein NrdH [Corynebacterium urealyticum DSM 7109]
    MITVYTKPACVQCTATQRALDKAGLEYEMVDISLDDEAREYVLALGHLQAPVVVSGEEHWSGFRPDRIKALSAAAA

    >gi|172041388|ref|YP_001801102.1| hypothetical protein cur_1709 [Corynebacterium urealyticum DSM 7109]
    MSSDMTLSSPDPGNVKIRLTLGHIPAPQPWGSRGVASSMAGMSDFESMRAEDVPEDVQLVDVREANEFAEWHAKGAENLP
    LSELQLRYGELDLDQDLYII
    CLSGGRSAKACQWLELNGIDAINVSNGSIGWRDAGRTIIVNGEETTNPA

    >gi|172041439|ref|YP_001801153.1| hypothetical protein cur_1760 [Corynebacterium urealyticum DSM 7109]
    MAVSATDLKESRILLYYCFTPIADPTAIMLWQKQLCESLGLTGRILISEHGINGTVGGSLHACKQYARRTREYPGFKGME
    FKWSQGGAEDFPRLSVKVRDEIVSFGAPGELKVDENGVIGGGTHLKPEEVNKLVEERGDDVVFFDGRNAMEAEIGRFKNA
    VVPDVETTHDFIKELESGKYDWMKDKPVVSY
    CTGGIRCEVLSALMKNRGFEEVYQIDGGIVRYGEKYGDKGLWEGSLYVF
    DKRMHMEFSEEAKQLGFCKNCGAATNTFHNCENSECREQILLCEDCAADPAVTCGEC

    >gi|172041520|ref|YP_001801234.1| dihydrolipoamide dehydrogenase [Corynebacterium urealyticum DSM 7109]
    MAEHYDVVVIGAGPGGYVAAIRAAQLGLKTAVVEKQYWGGVCLNVGCIPSKALIRNAELAHTITKEAKTFGITGDNISMD
    FGAAHKRSRKVSSSIVKGVHYLMKKNKIQEINGRGEFVSDKEISIVDGDDKGKKITFDNAIIATGSVVKSLPGVEIGGNI
    VSYEEQILDENAPKSMVIIGAGAIGMEFAYVLSNFGVDITVVEFMDRVLPNEDKDVSREIAKQYKRLGVNLKTGHKTTEV
    RDLGEGKGVEVDIESADGKKSETLKADRVMVSIGFAPRTEGLGLDKAGVELGERGEIVIDERMRTSAKNIYAIGDVTAKL
    QLAHVAEAQGVVAAETIAGAETQELGDYQMMPRATFCNPQVASFGYTEEAARKKAEEDGREIKVATFPYTANGKAQGLGN
    AVGFVKLIADAEFGELLGGHMVGPDVSELLPELTLAQRFDLTADEISRNVHTHPTLSEAMKEAAHGIGGHMINL

    >gi|172041544|ref|YP_001801258.1| putative secreted protein [Corynebacterium urealyticum DSM 7109]
    MAVRTNPAHSPSSRPNRAWSAAPARSPVLQVTPAARVTRTRTPAPNSQLASKNPRNCPAPGSGAHPAPDSELTGIELPCL
    SSGKNETADLGAALAGKPTIINVWAWW
    CEPCRRELPHFDKLAKQHPEWNVAGVHLDKKSQAGADFLDELNVTTMPVYADR
    SHRFDTATSLPKVVPITVVYRADGTRAQMYPQVFRDYEELEAAVNAALNGQN

    >gi|172041562|ref|YP_001801276.1| organic hydroperoxide resistance protein [Corynebacterium urealyticum DSM 7109]
    MSKALYNAKALSTGGGRDGHVATSDRQIDLDVRPPKELGGSGEGTNPEQLVAAGWAACFNGALQKQMKDNGVDLSKAPEV
    LVECTLNSVDEGFRITSRIEATLFGVEQAQADELVQAAHAF
    CPYSKAMRGDTDVEVVAKVA

    >gi|172041654|ref|YP_001801368.1| thioredoxin [Corynebacterium urealyticum DSM 7109]
    MNTHRAGQIPRAENTTHSAKGKIMATKEITGENFQETVGKEGIVLLDFWAEWCGPCKRFGPIFEATSEEHPEVTFGKVDT
    EANQELAAALQIQSIPTIMMFRDGVLLAREAGMLPKEALNDLISQAEQLDMDEVRKQVEEQMKQAEAQQEG

    >gi|172041694|ref|YP_001801408.1| hypothetical protein cur_2017 [Corynebacterium urealyticum DSM 7109]
    MSQPFLQANVGIGVNKAGDAAAAATPADTPDTSASSGGTHDPAEKIHNVIIVGSGPAGYTAAIYAARAELEPIVFEGMDF
    GGLLMQTTEVENFPGFAKGIQGPELMDEMRNQAERFGADLRMEDVEKMDLTGEIKKVWVDGEEYQARAVILATGAAPRYL
    NIPGEQEMIGRGVSA
    CATCDGFFFKDRKIAIVGGGDSAMEEADFLTKFGETVTLIHRRDEFRASKIMQERARQNPKIEFL
    MNSKVTAVHGESAVTSLTVEDTVTGESQEMEFDALFVAIGHDPRVSVFEGQVELKEDGYVKVDEPSTATSLPGVFAAGDL
    VDSHYQQAITAAGSGCRAALDAEHYLAALPANES

    >gi|172041695|ref|YP_001801409.1| thioredoxin [Corynebacterium urealyticum DSM 7109]
    MSNIITVTQQTFKSTVVESDLPVLVDFWAQWCQPCLRMNPSLEELAEEMDGRAVVAKVNVDEERALAAMFQVMSIPALMV
    FKDGKKVAEFTGLQPKGTLVEKLESLA

    >gi|172041301|ref|YP_001801015.1| phosphoribosylformylglycinamidine synthase II [Corynebacterium urealyticum DSM 7109]
    MTNNLNNGSGAAADSGAVKVHNDTVANAEQTPDLVQPWADLGLKEDEYARIKEILGRRPTEAELAVYSVMWSEHCSYKSS
    KVHLRYFGETTTEEMNSKMLAGIGENAGVVDIGDGWAVTFKVESHNSPSYIEPYQGAATGVGGIIRDIMAMGARPVAVMD
    QLRFGAADAPDTQRVLPGVVAGIGGYGNSLGLPNIGGETVFDSSYGGNPLVNALGVGVLPAEDLKLAFASGTGNRVVLFG
    ARTGLDGIGGVSVLASENFEEGAERKLPAVQVGDPFAEKVLIECCLDLYNAGVVVGIQDLGGAGLSCAVSELAAAGDVGM
    HVVLDNVHQRAKGMTGAEILSSESQERMCAVVEPEKLDEFMEICRKWDVIASDIGEVTDTGRLICEHQGEVILDAPPKTI
    ADEGPVYERPYQRPADQDELQKQADLPRPNNLPELRQQLLDLVASPALCSRAFITEQFDRYVRGNTVLAKDADAGMLRID
    EKTNRGIAVSADASGRYAQLDPRMGAKLALGEAYRNVATTGATPVAVSNCLNFGSPEDPEVMWQFREAVHGLADGCVDVQ
    IPVTGGNVSFYNQTGDTPILPTPVVAVLGTIDDATTRLPQQIAEGSEYELILAGAMTKDELGGSIWQQVVHDNLSGLPPQ
    IDLHAEERLGNALSALRGVAAAATDLSEGGLAQTIVELAIQSNTGVTVNPAMNLEPSLAASEDLHEQLFVGLFSETATRV
    VLAVPKASYAKAMEILADHEVPAAWIGRTGSVDAEGRPEVCFEVGATGNLPGDQPEPAEQDASEDGEVARLVFNVEELRN
    VWEATLPALFGHATGANSTV