Corynebacterium pseudotuberculosis uid50585

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|300857472|ref|YP_003782455.1| hypothetical protein cpfrc_00055 [Corynebacterium pseudotuberculosis FRC41]
    MLELILIGLIGGIVTGISPCILPVLPVVLAVSVDRKPTHVISGLALSFATITLVGTLILGALGLPKDVLRWGGIILLVLV
    GVGMIVPKLGEWIEAPFNRIPRPTSLQLKARNKGGFAIGLALGAVYVPCAGPILAAITVAGATGDIGLSTVILTVAFAIG
    ASLPLLIFALAGNKMGERIDAVRKHRGIVGAIILALALALALNVPEKLQRSLPDWTAGVQERLSDNEAVQNALSNGNGNL
    DSCRRADKGSLQDCGSAPEFEGLTGWFNTDKPVGTHDGKVTLVDFWAYA
    CINCQRAGEHITKLYDTYKDAGLEVVGVHAP
    EYGFEHEAANVRAAAKREGINYPVAQDNDFATWKKFNNRYWPARYLIDTKGNVRHIHEGEGAYAETEQLVRQLLKQANPD
    VQLPDPIETGGGTDSKLTEQRNPETYLGAERARFFNNNNYGLGERDFTYKEPRKGQYSLSGKWDVKNDHIVPVKDAKLSI
    NVHAAKVQLVVSGQGKVKATFPDGSDKTFDVSDGTIDVYDADKPLDGIISLEIEPSVTAYSLTFG

    >gi|300857625|ref|YP_003782608.1| hypothetical protein cpfrc_00208 [Corynebacterium pseudotuberculosis FRC41]
    MKKTIAASFGVFVVMLVFLLAVVPQLLRGDNSGNQNGSTGAEGTEATAQNVQNRPECPIADLGGVSLPCLGAQHRARPMP
    AVTVVSLWAWW
    CEPCRKELPLFDELAAKHPEFSVIGVHADPNAANGAALLNDLGIQMPSLQDNNNNFAASLGLPKVVPIT
    LVFDQNGKLISTIPKPFEHYGELESAVLGKLPATVTPTEAS

    >gi|300857656|ref|YP_003782639.1| dihydrolipoamide dehydrogenase [Corynebacterium pseudotuberculosis FRC41]
    MTEHYDVVVLGAGPGGYVAAIRAAQLGKKVAVVEKQYWGGVCLNVGCIPSKALLKNAEVAHIFNHEAKTFGISGDVSFDF
    GVAHKRSRKVSSGIVKGVHYLMKKNKITEIDGLGSFKDAKTIEISEGKDAGKTVTFDDCIIATGSVV
    CSLPGVEIGGNIV
    SFEEQILKEEAPKSMVIVGAGAIGMEFAYVLANYGVEITIVEFMDRVLPNEDADVSKEIAKQYKKLGVKLLTGHKTTAIR
    DNGQGVEVDVESKDGSKSETIKAERVMVSIGFAPRVEGYGLENTGVKLTDRGAIQIDDFMRTNVDHIYAIGDVTAKLQLA
    HVAEAQGVVAAETIAGAETQELGDYMMMPRATFCNPQVASFGYTEEQAKEKFAGREIKSATFPFSANGKAQGLGESAGFV
    KIVADAEFGELLGAHMVGANVSELLPELTLAQRFDLTAEEIGRNVHTHPTLSEAMKEAAEGIMGHMINL

    >gi|300857683|ref|YP_003782666.1| hypothetical protein cpfrc_00266 [Corynebacterium pseudotuberculosis FRC41]
    MFSIKRPAVLALLIVILLIVGIGAYTLGRGSAAKDGDTSANSAGSSQGAGPSLPPGFTGKTGSSRVSPGTKTDGPVALAN
    GSYDAMIYGPGKELKSAEDILNVHRRNAKDPFALGALDAPVVISEFSDFE
    CPFCAKWSNETEPTIIKEYVEKGFVRIEWN
    DLPINGPDAVSAAKAGRAAAAQGKFNEFRSALFQASKTIKGHPENKLTNFEEFAREAGVKDMARFSREASDATYDSVVDK
    AREYAGSLGINGTPGFVVGTQYVSGAQPTEVFIRAIEAELAKVADGKVAVPSV

    >gi|300857686|ref|YP_003782669.1| hypothetical protein cpfrc_00269 [Corynebacterium pseudotuberculosis FRC41]
    MSGVASAREVELMTRKTCGSCQRVAEQIIPVVAAAGAKLSIVDVDMDRLLAAEYGDRVPVVVIDGEEFACWEVDNEELAA
    ELAS

    >gi|300857698|ref|YP_003782681.1| thiol-disulfide isomerase/thioredoxin [Corynebacterium pseudotuberculosis FRC41]
    MKRTLAATMISSLLVLSACSSEDTAGTDAVAIGGTFQFHSPGGQTEIFYEEADRAPVKNISGESLSSDAKISLDDYKDQV
    VVLNAWGQW
    CAPCRSESDDLQTVQEYLEKEQRGTVLGINVRDYSKQIAQDFVKDNGLTYPSLYDPPFKSAAQLGGVPAAV
    VPTTIILDKQHRPAAVFLREITAKDVIDVVERIV

    >gi|300857899|ref|YP_003782882.1| thiosulfate sulfurtransferase [Corynebacterium pseudotuberculosis FRC41]
    MPAPYDPHPLFQDYAHPEKLVSASWLSARLGTKGLRVVESDEDSLLYDIGHIPGAVRIDWAKDLNNKTIRDYITGEDFAA
    LMSAKGIARDDTVVIYGDKSNWWAAFTLWIFELFGHEDVRILNGGRDAWMAEERDTSYAVPEYPATDYPVIKRADHPDRI
    YVQELLEKLGTPKLIDVRSPEEYNGTADADSPSSGVLRRGHVPTAVNIPWEKSVHPNSRFRSAEELSALYAEIPKDAETV
    VY
    CQVGDRAAHTWFVLKHLLGYDFVRNYDGSWAEWGNMVKMPIATGDEPGQV

    >gi|300858049|ref|YP_003783032.1| hypothetical protein cpfrc_00631 [Corynebacterium pseudotuberculosis FRC41]
    MKEQHVTVYAADWCPFCQRLISALNRTNTPFVLVDVEADDQASEWVKSVNNGNRIVPTVKYSDGSTATNPPASDVRRKLE
    ELTA

    >gi|300858182|ref|YP_003783165.1| hypothetical protein cpfrc_00764 [Corynebacterium pseudotuberculosis FRC41]
    MGRHRRTGTCPMITIYHNSHCSKSRAALEFLQDRGGEDVQIINYLSSPPSEDALRELLRKAGLTPHQAIRTNEQLYQELG
    LSPETSDDELIATMVKHPQLIQRPFVSTDKGVRLARPMEVIEEIL

    >gi|300858584|ref|YP_003783567.1| thiol peroxidase [Corynebacterium pseudotuberculosis FRC41]
    MGEQIKRFSLAGSDLADLSEVTFAGKRIVFNIFPSVDTDVCAASVRRFNELASGMDNTVVLCVSMDLPFALSRFCAAEGL
    DNVIPASAFRSTFGKDFGIVLEGSPLKGLFGRAVVVTDEQGVVHHQELVSEITEEPDYDAALAALR

    >gi|300858613|ref|YP_003783596.1| peptide methionine sulfoxide reductase [Corynebacterium pseudotuberculosis FRC41]
    MTDFKLISDDQWRQRLNAEEYRVLRQAGTEAPHVGKYTNTKTEGVYSCRACGTELFRSTEKFDSHCGWPSFFSPLAGDKI
    IERSDTSLGMVRTEVLCATCNSHLGHVFAGEGYSTPTDLRY
    CINSICLELEEKPID

    >gi|300858643|ref|YP_003783626.1| alkyl hydroperoxide reductase [Corynebacterium pseudotuberculosis FRC41]
    MALKGGDLHDVNASQPEDYFETISLDKYEGKWKVVFFYPKDFTFVCPTEIAAFGKLDEEFQDRDTQILGGSIDNEFSHFN
    WRATHPELKTVPFPMFSDIKHELIRELGVENAAGVADRATFIIDPDGIIQFVSVTPDAVGRNVDEVLRVLDALQSEEVCA
    CNWQKNDPTKSIDKFEVVQESLK

    >gi|300858708|ref|YP_003783691.1| methylated-DNA--protein-cysteinemethyltransferase [Corynebacterium pseudotuberculosis FRC41]
    MHASEKPQALTLTTPDGALSIIGNSGFVLASGWTDDIAALSSLVHKDFALGADGQVIDRVEVDDAHAVLQDASAAVSAYY
    AGSADGVQQIPVKQLSGPFRMRAWDVLREVQPGETLTYAEYAGRCGNEKAARAAASACAMNAVALFIP
    CHRIVRSDGTLG
    GFRYGIKIKESLLARESSILVN

    >gi|300858715|ref|YP_003783698.1| mycothiol reductase [Corynebacterium pseudotuberculosis FRC41]
    MSEQAHKHYDLIIIGTGSGNSIPGPEFHDKSIAIVEKGAFGGTCLNVGCIPTKMFVYASEIALAVRESERYGISAEVSAV
    DWPSIVNRVFRDRIDPISASGEEYRRGPKTPNIDVYDQHASFVAPKTIRTGQGDKEAIISGDRIVIATGSRPFIDQKVID
    SGVHYYTNETIMRLESLPTSMVVMGGGYIAMEFAHVFDALGVKVTVVNRSQKLLRQLDSDISDRFTEITKEKLDCRLGRT
    IQSITENDGTVTLTLDDGSTAEGEVFLVATGRIPNGDLMDLDNAGVEMDGRRIKVDQYGRTTAPDVWALGDVSSPYLLKH
    VANAEMRAVKHNLLHPEDLQSMPHENVPAAVFTHPQIGTVGLTEDEARAAGYNITVKIQNYGDVAYGWAMEDTEHFVKLI
    ADKDTGLLLGAHFIGPQASTLVQQLITVMAFKLDVRDVATKQYWIHPALPELTENALLGLDFS

    >gi|300858847|ref|YP_003783830.1| hypothetical protein cpfrc_01430 [Corynebacterium pseudotuberculosis FRC41]
    MTAPTTSNTGVILSAAAAAKAKALLEQEGRTDLSLRIAVQPGGCSGLRYQLYFDDRDLDGDKADVVDGVRLVVDKMSVPY
    LTGATIDFADTIESQGFTIDNPNAGSSCACGDSFN

    >gi|300858982|ref|YP_003783965.1| hypothetical protein cpfrc_01565 [Corynebacterium pseudotuberculosis FRC41]
    MIATGLLLGAVLGVVLQRGRFCVTGMLRDIYLLKTWRGFVALLIVISVHAVGLSALRTLGVITTPVDAFAPLAVVIGGFI
    FGIGIVLAGG
    CASGTWYRSGEGLVGSWFALLFYGISAAAMKTGILHGGATWLKGFTINATTIPDTFGLSPWWFAIGLSLL
    TVYSVWYYRSKDGASVATLGRTGWKRPLSLNTAGLLVGILGVIAWPLSAATGRNDGLGITTPTAHLTSWLTTGDAKFLNW
    GTLLVVGILVGSFASAKATGEFRVRVPDATTSIRSIAGGTLMGIGAALAGG
    CTVGNGMVQTSLFSYQGWVALLFIGLGVA
    AAAKAWLKPTQKTRVNSTFEVAPAGVKVGVDKQGLRAVAPGTYVIDTLGAVCPFPLIDAKTAINQLSDGEALVIDFDCTQ
    ATETIPRWAADDGHAVTDFHEVGSAGWQITVVKHGALLRT

    >gi|300859028|ref|YP_003784011.1| hypothetical protein cpfrc_01611 [Corynebacterium pseudotuberculosis FRC41]
    MTEQVTFWFDVSCPFCWVTSRWIKEVEQVRDIQVEWVPMSLSVLNEGREELPEDYKEKMKANWGPARVFAAVAAQYPEKL
    DELYTAMGTEIHNNGQGGKTGFGAYDAIIKDAVSEVGLDPALAEVANTETWDKKLREYHHGAMELVGNDVGTPVIKLGET
    AFFGPVITRVPRGEEAGKLFDASIALGSYPYFFELKRSRTENPRFD

    >gi|300859061|ref|YP_003784044.1| bacterioferritin comigratory protein [Corynebacterium pseudotuberculosis FRC41]
    MTEQARLSLGDMAPDFDLPNDKGGTTALRDFRGSRVLVYFYPRANTPGCTKEACDFRDSLSQLESLGINVVGISPDKVSK
    LSDFRNDHELNFPLLSDESKEVMKAYGAFGEKKNYGKVVQGVIRSTFLVEPDGTLGLALYNVRATGHVARVLRDLLASE

    >gi|300859090|ref|YP_003784073.1| glutaredoxin-like protein [Corynebacterium pseudotuberculosis FRC41]
    MSITVYTKPACVQCNATKKALDRAGLDYTLVDISIDDEARDYVMALGYLQAPVVEVNGEHWSGFRPERISSLVAQVA

    >gi|300859147|ref|YP_003784130.1| glutathione peroxidase [Corynebacterium pseudotuberculosis FRC41]
    MTNFFDIPVTLNDATETTMNDWAGHCLMIVNTASRCGLTPQYEALEELYRDYAPRGFFVIAMPCNQFAEEEPGTNKQIAE
    FCKREYGVTFPILEKADVNGENTHPLYQFLKGDGPDIEWNFEKFVVSTEGKVVGRFAPNMEPDDLKIIECLEDNVVL

    >gi|300859214|ref|YP_003784197.1| hypothetical protein cpfrc_01797 [Corynebacterium pseudotuberculosis FRC41]
    MEVSVRDIPEGAQLIDVREADEYAEVHALGAVNIPMSEFTVRLDEVDTEQDVYVICKSGGRSARVVEYLTARDIKAINVA
    EGTDGWVGAGLPTE

    >gi|300859260|ref|YP_003784243.1| hypothetical protein cpfrc_01843 [Corynebacterium pseudotuberculosis FRC41]
    MTNKKRVIILLAAIVVVLGAIYMVQKPQEDTVTVDNTSGKTIRLGEEAPNFKSLDIKGHPFDLAALKGKPIWIVFNATWC
    SN
    CRAEIPEIQELAKEDSIAVVSIYLNENSTQVRQYAEKLGLTYTQIPDARGTISASYGVSAVPSHVVIDEHFKVKWIKA
    GTITGQDIKKALEG

    >gi|300859414|ref|YP_003784397.1| peptide methionine sulfoxide reductase [Corynebacterium pseudotuberculosis FRC41]
    MGWLFGSSPKMVADNEALKGGSQPVLSQPRPHAVLRTPITGPWKEGQEVVYVGIGCYWGAEKMFWETPGVESTSVGFAGG
    ITPNPTYREVCTGRTNHTEIVEIVYDPAVVSFDQIVIKALEAHDPTQGYRQGNDVGTQYRSAIYTAGPYAAEQAARAREI
    VNAYGPKLEAAGFGPMTTEVMELAQTPSGHYYRAEDMHQQYLHKNPAGYCPHHSTGVACGIPGA

    >gi|300859443|ref|YP_003784426.1| thioredoxin [Corynebacterium pseudotuberculosis FRC41]
    MATIDVTEDTFEQTVTTDGIVIVDAWASWCGPCRAFAPTFEKASENHTDVVFAKLDTEANQGLSAALQIQSIPTLMIFRE
    GILVYREAGALPAAALEDLIGQVKGLDMEDVKRQVAEQNNNN

    >gi|300859444|ref|YP_003784427.1| hypothetical protein cpfrc_02027 [Corynebacterium pseudotuberculosis FRC41]
    MTKNYFVEGMTCAHCVASVTEEVNEIPGTQGVEVDLETGRLTVTGEDFTDADVAAAVKEAGFSIKEQ

    >gi|300859445|ref|YP_003784428.1| hypothetical protein cpfrc_02028 [Corynebacterium pseudotuberculosis FRC41]
    MFMRIGIGKPPQSLNKTSGHRNEVKHPEMTSTTPISPVTIELGVTGMTCTSCSGRVQRKLNKLDGVEASVNFATETAQVS
    FDPSGVTSTQLIDVIRGAGYDAFILAENQDSVENAPQTAIDATEAARGHHAEELKNRLVYSAVLAIPVFAMSMIPALQFD
    NWQWLSFALASPVFFWGGAPFHKATLANLKHASFTMDTLITLGTSAAYAWSVWALFVGNAGEPGMRMHMSFSAHAHGGMD
    EIYLESVAVVIVFLLLGRWFETRAKGQSSAALHELLSMGAKDAAVLRDGHEVRVPIGELAVNDIFVVRPGEKISTDGVVV
    EGHSAVDESMLTGEPVPVEALPGATVTGATLNTSGRLLVRATRVGTETTLAQMGRLVSDAQARKAPVQKLVDRISQVFVP
    CIVIIALITLAVHLWIGNPTADSFAAAVAVLIIACPCALGLATPTALLVGTGRGAQLGLLIKGPEILESTRKIDTIVLDK
    TGTLTQGKMAVTHVSPVGQWTSEEVLRFAGAVENASEHPIARAITSASQQSIATPLPTVSNFSSTPGSGVQGLVLDREGV
    EREVRVGRLENVTPQSSKEVLDLVVAAESAGGTAVVVAVDGQPSGVITVKDEIKESAAEAVDKLRSLGLTPVLLTGDNPG
    AANAVASQLGISKVIAGVLPEGKVTTVRTLQEQGKVVAMVGDGINDAAALAQADLGLAMGTGTDVAIEAADITLMNSDPR
    AIVDAILLSRATLGTIKGNLFWAFAYNVILVPVAAFGLLNPLFAGAAMAFSSVFVVSNSLRLRSFRGSVH

    >gi|300859461|ref|YP_003784444.1| hypothetical protein cpfrc_02044 [Corynebacterium pseudotuberculosis FRC41]
    MCMAYCASLNTIFAFSTSVLQSTMTFVSQSKILLYYKFTPIADPKALMLWQRDMCELLGLKGRILISEHGINGTVGGDME
    ACKRYIRKFREYPGFRGTEFKWSDGGAEDFPKLSVKVRDEIVAFGAPGELKVDKRGVIGGGVHLKPEEVNKLVEERGDDV
    VFFDGRNSMEAQIGKFKNAVVPDVNTTHDFIRELESGKYDWMKDKPVVSY
    CTGGIRCEILSSLMKNRGFKEVYQIDGGIV
    RYGEKYGNDGLWEGSLYVFDKRMHMEFGNGVQDPGFIQLGHCVQCGKATNKFEHCINEDECRDLVLMCPECYENPATRNC
    GRDHCVEVAQEAALA

    >gi|300859517|ref|YP_003784500.1| thioredoxin reductase [Corynebacterium pseudotuberculosis FRC41]
    MSEAPNATTVHDVAIIGSGPAGYTAALYAARAELKPIVFEGIEFGGSLMTTTEVENFPGFPEGIMGPDLMDNMRSQAERF
    GADLRMELVTKVELEGEIKKIWVDDQEFHARSVILATGSAPRYIGAEGEQTLLGRGVSA
    CATCDGFFFRDHDIAVIGGGD
    SAMEEATFLTKFAKSVTIVHRREEFRASAIMLERAKNNDKIKFLTNNTVSKVLGENTVSGLELTDTATGETSILDVTAMF
    VAIGHDPRSDLFRGVVDTNDAGYVRVEEPSTRTNVPGVFAVGDLVDAHYQQAITAAGSGCRGAIDAENYLAALDA

    >gi|300859518|ref|YP_003784501.1| thioredoxin [Corynebacterium pseudotuberculosis FRC41]
    MNAPIALTEATFKTTVIDSDKPVLVDFWAEWCGPCKKLGPIINEIAAEMGDEVVVGKVDVDAERNLGAMFQIMSIPTVLI
    FKDGQKVAEFVGVRPKSEIVAKLRSHQ