Corynebacterium kroppenstedtii DSM 44385 uid59411

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|237784684|ref|YP_002905389.1| putative methylated-DNA--protein-cysteine methyltransferase [Corynebacterium kroppenstedtii DSM 44385]
    MPADASAERRDDHCDHLDDRTYRTQRFPTPFGDIDVTINGHAIVAAQYIIGSGTTDPDITDPGATSDMSEAQRHLFTQIG
    EQLDEYFSGTRQAFTLPLDVEDDPTEFTKSVREEMSHISPGDVLTYGELAEAAGRPRAARAVGSVCRTNPIQLFIP
    CHRV
    VAAGGSLGGYMGGARGLILKQQLLEREGVPFTADGKVDFRELGRRQETQFH

    >gi|237784743|ref|YP_002905448.1| Peptide methionine sulfoxide reductase [Corynebacterium kroppenstedtii DSM 44385]
    MGFLFGTRPTPTSIVNREDALPGRDEPILPHPAPHTVLGTPIDGPWKDGQRSVVVGLGCFWGAEKLFWQIDGVESTAVGY
    AGGYTPNPTYREVCTGRTGHAETVRVIYDPQEVSFEDLIRTFFEAHDPTQGFRQGNDVGTQYRSVIYAQTDDEVQKAREI
    AESFSHSLADAGYGGITTDISLLSDTPTKTMYLAEDEHQQYLDKNPNGYCPVHSTGVACR

    >gi|237784785|ref|YP_002905490.1| hypothetical protein ckrop_0153 [Corynebacterium kroppenstedtii DSM 44385]
    MSMPKIVLFYVFTPLADPEAIRLWQKALAEKWNLKGRVIISKDGINATLGGELNDVKRYCRETRSYAPFKNADIKWSEGE
    GDDFPRLSVKVRPELVTFGAGDELKVNEEGVIGGGTHLKPEDLHHLMDERGDDVVFFDGRNAMEAEIGKFRNAVVPNTTT
    TRDFLNEIESGKYDDLKKRPVVTY
    CTGGIRCEVLSVLMKNRGFEEVYQLDGGIVRYGEAYGNDGYWDGSLYVFDKRMHME
    FGSGTESLGHCVECGKPTAQFVNCANNDCRKLFLRCDECTAAHKHQYCGECEPALV

    >gi|237784790|ref|YP_002905495.1| hypothetical protein ckrop_0159 [Corynebacterium kroppenstedtii DSM 44385]
    MLITGLVLGTVLGYVMQRGRFCVTGMLRDIFTLKTWRGFVALLVVIAVHAVGLAALTSLGVITPEVDDFAPFAVIIGGFL
    FGVGIVLAGG
    CASGTWYRSGEGLVGSWIALLTYGLSAAAMKAGALQGINSGLREYTVPLTTIQQSLGVSTWALALPLAVL
    TAFLVAKFVRAEAAQPKIAQLAAKKTGLAHLLAEKPWHVYTTGAIVGVLGVIAWPLSAATGRNDGLGITTPSSDLVRFVT
    TGDATRINWGALLVLGILIGSYLAAKASGEFRVRVPSGTQSVRSVAGGVLMGVGAAWAGG
    CTVGNGMVQTSLFSYQGWVA
    LLFIALGVGFAAKLWLKPAEPINPQDPDGYTLSPSTADATRAASAGGLAVTSAGDADLTPEPSGVESSGVLAESGDRKSP
    EREPVLVGTSAGDGSVADSELGVGGFATAVGLPAVSVLERPADGGPNDVSPKLRGGLRRVGERRFVLDTLGAVCPFPLIE
    AKAAMQQLSSGDELVIDFDCTQATDAIPRWAATDGHEVTNFEATDDAGWTITVRKG

    >gi|237784816|ref|YP_002905521.1| organic hydroperoxide resistance protein [Corynebacterium kroppenstedtii DSM 44385]
    MSDALYTARVTSTGGGRDGHVASDDGHIDLDVRPPKAMGGSGEGTNPEQLVAAGWAACFNSALQLIAKQSGADLDKAPEV
    TVECSLVKDENDGGFRIKAALDVTIFGVSEDQAKDFAEQADAM
    CPYSKAFRGDSETVVTAHAK

    >gi|237784992|ref|YP_002905697.1| putative glutathione peroxidase [Corynebacterium kroppenstedtii DSM 44385]
    MSIYDIPVTTIEGKETTLRSWEGHVLLIVNVASECGFTPQYEALEHIFEEYAARGFFVIGVPCNQFGEQEPGSNEEIKEF
    ASSKFGVTFPLLSKTDVNGDNEHPLYTELKKTADNNGEAGDVKWNFEKFVLSDSGEVLGRFRSDVDPEDDALLDLIEDNL
    PL

    >gi|237785074|ref|YP_002905779.1| hypothetical protein ckrop_0459 [Corynebacterium kroppenstedtii DSM 44385]
    MSEVIQKNNPSGNETAATIYYATWCPFCKKLIENLDRTETPYSLIDIDQSEEAGQWVESVNDGNRVVPTVKYSDDTTATN
    PPAGDVRRKVEELSS

    >gi|237785305|ref|YP_002906010.1| hypothetical protein ckrop_0706 [Corynebacterium kroppenstedtii DSM 44385]
    MTAPEKTTGVILTDAAAAKAKSLLSQEQNDELALRIAVQPGGCAGLRYQLFFDDRTLDGDLVDDYDGVNLVVDRMSAPYL
    TGATIDFADTIEQQGFTIDNPNAKGSCACGDSFN

    >gi|237785406|ref|YP_002906111.1| putative thiosulfate sulfurtransferase [Corynebacterium kroppenstedtii DSM 44385]
    MLASPQIDSARFCSISYDGIMNNELPWVVSVQELQKLQHDSAAHANQRKAQREAARRKSEWIERALAHPDDLSEAERRRL
    EEYLREEEEAKDLYRSQPLASCPVVVADVRWHLDGRSGYDAYKKGHIPNSVFIDLDSMLAGLASKEEGRHPLPLEESFAA
    AMEVSGIADDTIVVAYDDAGGASASRLVWLLRASGHRAAVLDGGLNAWIEYCEQAHKTDETGQGSTQLAEHFLDDGDDVT
    EPEEAGAFTAEPFNAEWLVSIDDAAASAAEGIVIDARASERYRGDNEPIDSSAGHIPGALNLFHGDLVDDKGYFLDSDQI
    VSRLNDAGVEKREGQSLEESPIVY
    CGSGVTATHEIVALAHAGIQARLYPGSWSQYSATDRPISQGAAR

    >gi|237785636|ref|YP_002906341.1| peptide methionine sulfoxide reductase [Corynebacterium kroppenstedtii DSM 44385]
    MTDKDEQHEDFRRLTDDEWRARLTNAEYRVLREAGTEAPFTGEYTDTETEGVYRCRACGSELFRSREKFHSHCGWPSFFS
    PLAGDRIIEVADNSHGMHRVEVKCAKCHSHLGHVFEGEGYDTPTDLRY
    CINSISLTLEPATKD

    >gi|237785668|ref|YP_002906373.1| alkyl hydroperoxide reductase subunit [Corynebacterium kroppenstedtii DSM 44385]
    MALLTIGDQFPDFELTALKGGDLREVNANQPEDYFEEINNQSYEGKWRVIFFYPKDFTFVCPTEIAAFGKLNDEFEDRDT
    QILGGSVDNEFSHFNWRATHPDLKTIPFPMISDIKHDLIKALGVENADGVADRATFIVDPDNVIQFVSVTPDAVGRNVDE
    VLRVLDALQSEEVCACNWQKNDPTKNIDKMDVLNEELK

    >gi|237785669|ref|YP_002906374.1| alkyl hydroperoxidase subunit [Corynebacterium kroppenstedtii DSM 44385]
    MALDNLKEGLPEYAKDLKLNLGTLSRSTELSEQQLWGTFLATAAATRNDTIISEIAEEASQHLSDEYVNAAYGAASIMAM
    NNVAYRAKSFLGSDYAQVRMGLRMNIINKSGIDKVDFELMALAVSTINGCHD
    CTKAHEKTVTSEGLTKEQVFEAVKIAAT
    IQGVAQAIQIEAAR

    >gi|237785739|ref|YP_002906444.1| putative mycothiol reductase [Corynebacterium kroppenstedtii DSM 44385]
    MAATSTAERNNPVIPQPVHNGPEAPTRHYDLMIIGTGSGNMIPGPEFGDKRIAIVEKGTFGGTCLNVGCIPTKMYVYAAD
    IAEAARESERYGVHAHVDGVDWPAIVRRIFERRIDPIARGGEEYRRGDENPTVDVYDQFARFIGPRTLATGQGDQPVTIT
    ADRIIVAAGSRPFIPSVITDSDVPYHTNEDILRIPDLPSSMIILGGGVIAAEFAHVFSALGVDVTVINRSPHLLKRFETD
    LSERFTEIASERWTTYLGRTVTKAERKTENTEGVTLTLDDGTTVSAETLLVAMGRTPNGDLLNVTEAGMDLDGGGRIVVN
    KYGETTAPGVWALGDVSSPYQLKHVANHEAKVVKHNVLLDMGLLESPDEARAGMGEIATSGPDAGKQAFHHTYVPAGVFT
    HPQIATVGMTEDEARNWADENDTTVAVKTQNYGDVAYGWAMEDTTGFVKLIADTTSKRLLGAHIIGPQATTLIHQFITMM
    EQKLTVPEVAEGQYWIHPALSEVNENALLGLEL

    >gi|237785955|ref|YP_002906660.1| hypothetical protein ckrop_1377 [Corynebacterium kroppenstedtii DSM 44385]
    MADKQRVDFWFDVSCPFCWVTSRWIKEVEKVRDITVVWHPMSLSVLNENNDDLPDDYKKMMKQTWGPARVAALIADENPE
    KLDAYYTAMGTRIHDKKEVDAHAGEGFDDVLRDALEEIGLPASYLEVAHSTEQDDSLRRHHQGAMDAVGDDVGTPVLKLG
    DNAFFGPVITRVPRGEDAGRIFDGAVALAAFPHFFELKRSRTEMPENKTAELP

    >gi|237785972|ref|YP_002906677.1| bacterioferritin comigratory protein [Corynebacterium kroppenstedtii DSM 44385]
    MSGSKSHTQPSAEQNSSAPRRLEKGDPAPQFSLTSDAQTQVSLSDYSGKKVLVYFYPRANTPGCTKEACDFRDNLSVLAD
    AGIDVVGISPDSPEKLTKFKEKYELPFPLLSDPDKEVMKAWGAFGEKKNYGKLIHGVIRSTFVVGEDQTIELAKYNVRAT
    GHVVRILKDLGLSGK

    >gi|237785991|ref|YP_002906696.1| glutaredoxin-like protein NrdH [Corynebacterium kroppenstedtii DSM 44385]
    MAVTVYTKPACVQCTATKKALDRAGVDYETVDITMDSDARDYVMALGYLQAPVVVAQDEHWSGFRPDRIKSLVTSAA

    >gi|237786108|ref|YP_002906813.1| thiosulfate sulfurtransferase [Corynebacterium kroppenstedtii DSM 44385]
    MAAPLDPHPLLQDYAHPEKVVTSQWLGAKLGTPDVRVVESDEDSLLYDLGHIPTAIRIDWRRDLSDPITRNVISPEAFAQ
    LMRDKGIRREDTVVIYGDHSNWWAAFAFWVFTLYGHPDVRLLNGGRDAWIRAERETTFAVPENPESTYPVPDVCTTGLIS
    VGDLRESYESSQIIDVRTPAEYRGGTSDNASSTAKSTLRTGHIPGAVNIPWDSTVYPNSNFRSMDELREIFGALDSSNPT
    VTY
    CVTGERSAHTWFVLRYLLGWDDVKSYYGSWAEWGNMVGMPIVRGDRPL

    >gi|237786113|ref|YP_002906818.1| dihydrolipoamide dehydrogenase [Corynebacterium kroppenstedtii DSM 44385]
    MAKRIVIIGGGPAGYEAALAGAKYGAEVTVVEDRGMGGSCVLHDCVPSKSFIAATGIRTDMRRADAMGFHAGYDGKRLPY
    AEVNKRVKHLAQTQSDDVQRQMIASEIRLIPGTARLNDYEPGRTIHRVLVEQADGSEETIECDLVLLATGATPRILPGAK
    PDGNRILTWRQIYDLEEVPEHLIVVGSGVTGAEFVSAFTELGVEVTMVASGDQILPHEDSDAARVLENVLDERGVHLVKR
    GRCKAVEYTDNGIKVILNDGREVEGSHALMTVGSVPNTRDLGLDKVGVDLTRSGHIKVDRVSRTSVPGIYAAGDCTDLFP
    LASVAAMQGRIAMYHALGEGVTPIRLRTVASAVFTRPELATVGVSQKQIESGEVSARIETYSLKGNPRAKMRSLNHGFVK
    VFCRKNSGIVIGGVVVAPSASELILPIAIAVTNRLTVEDLSRTFSVYPSLSGSVTEAARHLVAHDDLD

    >gi|237786226|ref|YP_002906931.1| hypothetical protein ckrop_1663 [Corynebacterium kroppenstedtii DSM 44385]
    MESVTVHDIPDGAQFVDVREADEYADGHAAGAINIPLSELMGRYQELDFDQPAYIICLSGGRSTRACQFLEQNGLDVINV
    KDGTLAWREANLPMETGSGD

    >gi|237786273|ref|YP_002906978.1| dinucleotide-utilizing enzyme involved in thiamine biosynthesis [Corynebacterium kroppenstedtii DSM 44385]
    MPSSSTDAAGSGAGLPPLIPDERLAPLPHNERVRTARHLALFDEAVQQRFAAARMCVIGAGGLGSPLLYALAAAGVGTNG
    HITVCDDDVVDFTNLQRQTLFGVDDVGRPKADVARERMHALNPSMRIRTEGRFGPDNAEQLCHEHDLLIDGSDNFATRFV
    AADAAEMTETPLVWGAVLRYEGQVSVFWAPHGPGLRDLFDGPPTKPVLT
    CAEAGVLGATTAVIGNLMATEALKIMGSIGE
    PLVGRVLTYNATSATTRTLRLRRDPSREPATTIRDTAALSNAEAVCEVGCEASAGNPLVEGSSEGELRNRRDQPQDHTHE
    SGDLAPSDLPGFLADENHVLLDVREDHERLIERITLDGDVESGGTAPADANPRDIHVPLGVVKADAASVRIPKSATAVAV
    YCARGARSQQVADILRETLSIPVYSLAGGITAMKTVAK

    >gi|237786456|ref|YP_002907161.1| thiol-disulfide isomerase/thioredoxin [Corynebacterium kroppenstedtii DSM 44385]
    MVKKTTSASPKVAAHGGASVDTSARPRKVTHRHGWVLSVRHSVASALVACAIAAVGATTLTACGSDETAGKDAVAVGGNF
    SFVSPGGQLVIKYDQKDRKPVKDLSGPSLMESDKTIKLSDFDNQIVVLNAWGQW
    CAPCRTEVDDLQEIQDDLQKGPGNGA
    DGSDDSGTSKGGPAGTVLGINVRDFNKQAAQDFVKDNDITYPSIYDPSFKSAISLGGIPASVVPTTIVLDKQHRPAAVFL
    REVNAKEIMDVVNDLEKE

    >gi|237786466|ref|YP_002907171.1| hypothetical protein ckrop_1915 [Corynebacterium kroppenstedtii DSM 44385]
    MYMHQVELMIRQSCGSCRRVAEQIRPICQRWGAEFVVTDVDSDTSLAMEFGDRVPVVLVDDDEIACWEIDDEDLIAALEA


    >gi|237786493|ref|YP_002907198.1| putative heavy metal-associated transport protein [Corynebacterium kroppenstedtii DSM 44385]
    MITSPPRLLPMASHGCSCCGPASRADTASIPAASDSSAGGSSPSYQVTGLTCGHCAKSVTQALQALPQVDDVQIDLAAGG
    VSTVTVTGVVPPEMVRQAIEEAGYTVLS

    >gi|237786516|ref|YP_002907221.1| dihydrolipoamide dehydrogenase [Corynebacterium kroppenstedtii DSM 44385]
    MAEHYDVVILGAGPGGYVAAIRAAQLGKKVAIVEKKYWGGVCLNVGCIPSKALLRNAELAHTFTHDAKTFGISGDVSFDF
    GAAHKRSRKVSSNIVKGVHFLMKKNKITEVHGQGTFTDAHTIEVSDGDDAGKTLTFDNCIIATGSVVKTLPGIELSSNVV
    SYEEQILNDELPESMVIVGAGAIGMEFAYVLANYGVDVTIVEFMDSVLPNEDKDVSKEIAKQYKKLGVTVLTGHKTTAVR
    DKGDSVEVDIEKKDGSKQQTLTVDRVLVSVGFAPRVEGYGLDKTGVELTDRGAIAIDDFMRTNVDGIYAIGDVTAKLQLA
    HVAEAQGVVAAETIAGAETETLGDYMMMPRATFCNPQVASMGYTEAAAKEKFSDRDIKVASFPFTANGKAQGLGEPAGFV
    KIVTDGEYGEILGAHMVGSNVSEMLPELTLAARYDLTAEEIGRNVHTHPTLSEAIKEAAEGTLGHMINL

    >gi|237786549|ref|YP_002907254.1| putative secreted protein [Corynebacterium kroppenstedtii DSM 44385]
    MGRQQRWTILIIAVLTGLVICAVPLMLRSTSSHNDAHSGAAISDNPAGQGSGSNDSSEGADSPASNPTTGRPACPTEGSD
    TAATSAEGSGNSEDSGSSEGSDDANSPLGSVTLPCLGNSASEAGAQPLSRNLAGKPTVINLWAFW
    CQPCKKELPIVDKVA
    QSHPEWNVVGVHADKNGDAGVGVLSDLHVDHLASFQDSGGDVARALKLPSVIPITAVLTPNGEVAKVYPQTFTSTSELES
    AVTAALS

    >gi|237786590|ref|YP_002907295.1| putative cation-transporting P-type ATPase [Corynebacterium kroppenstedtii DSM 44385]
    MPQSVTTSPDTTSQGAIDGVTIPEGSVIELDIGGMTCASCANRVERKLNKLDGVQATVNLATEKAKVTAPPTVTADDLIQ
    TVEKAGYTAALDQPATPAHESIDDSTADDDRAPRSGAAGSAQSESPIERETANFRQRLIVSAWLAIPVIAMAMIPALQFR
    NWQWLSLTLAAPVIVWGALPFHKAAWTNLKHGATTMDTLISMGTLVAFAWSLYALFFGKAGEPGLKHTFTMMASHTDASA
    NIYLEVASGVTLFILAGRYFEKKSKRESGAALRALLNMGAKEVTLLDDGQEKRIPVEQLQVGDMFVVRPGEKIATDGDIV
    SGSSAIDESMLTGESVPAEVGSGDHVTGATVNTSGRLVVRATRVGSDTQLAQMARMVEDAQTGKAQVQRLADRISGVFVP
    TVISIALLTLIVWLVLGHGFAASMTAAVAILVVACPCALGLATPTALLVGTGRGAQMGVLIKGPEVLESTRNIDTVVLDK
    TGTVTTGTMALTSVHAGSTSSDDEVLAIAGAVEDSSEHPIAQAIAQAAKSKGLEAHEVTDFQNKEGRGVRAVVDGRDVLV
    GKESLLNEAGVPLDDELRRAKNDAEHAGKTAVAIAWDGEARGILVVADTVKPTSATAISQLKGLGLNPVLLTGDNKVVAQ
    RIAKEVGIDDVKADVFPADKVQVIRGLQDQGKTVAMVGDGVNDAPALAQADLGLAMGTGTDVAIEAADITLVRGDLTSAV
    DAVRLSRATLATIKTNLFWAFAYNVAAIPVAALGLLNPMIAGAAMAFSSVFVVGNSLRLRRFTSVNRNVGTHADKTDRNA
    TAHTVEEERAK

    >gi|237786591|ref|YP_002907296.1| hypothetical protein ckrop_2049 [Corynebacterium kroppenstedtii DSM 44385]
    MIAHVPAWTSVNNSNIEEIVMTTRKYKISGMSCSHCERAVRDEVSEIPGVHVDEVSAETGMLTVSSDDDIKDMKVLEAVE
    EAGYSGTRL

    >gi|237786608|ref|YP_002907313.1| thioredoxin [Corynebacterium kroppenstedtii DSM 44385]
    MATVTVTKDNFTDTVSNGVVALDFWAEWCGPCRMFGPIFEEVSEQFPDVTFGKVDTESNQEIAGSLGIQSIPTLMVFRDN
    VLVYRHAGVHSAGQVKDVIEQTKNLDMDEVRKQIAEQEAKESEE

    >gi|237786643|ref|YP_002907348.1| Thioredoxin reductase [Corynebacterium kroppenstedtii DSM 44385]
    MPCSIARMSVHDVIIVGSGPAGYTAAIYAARANLKPLVFEGIEYGGLLMQTTEVENYPGFHDGIMGPSLMEEMRQQAERF
    GAELKQDMVESMDLTGDIKIVRSEGEEYQARAVIIATGAAPRYLGVKGEQEHLGLGVSA
    CATCDGFFFKDKPIVVVGGGD
    SAMEEADFLTKFGSSVTIVHRRGEFRASNIMVQRAKDNPKINFEMNAVVTEVCGDGPVDHLILEDTQTGEQRTLTASALF
    VAIGHDPRSEMVRDVIDTDDKGYILVQEPSTRTSIPGVFAAGDVVDSHYQQAITAAGSGCRAALDVEHYLVDLRG

    >gi|237786644|ref|YP_002907349.1| thioredoxin [Corynebacterium kroppenstedtii DSM 44385]
    MTSPVNVTTDSFRSTVVDSDKPVLVDFWATWCGPCRTMNPVLEEIADEYDGKAVIAKVNVDENAPLASMFQVMSIPTMLL
    FKDGKKVEEIHGAHPKSHITTALEKLL