Corynebacterium jeikeium K411 uid58399

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|68535085|ref|YP_249790.1| hypothetical protein jk0023 [Corynebacterium jeikeium K411]
    MGWDIALIGVIGGLVTGLSPCILPVLPIVLAVSADKRRKPWLVATGIGLSFTLVTLLGTLILSALGLPKDLLRWAGVVLL
    VLVGVSMLWPALGDQLERPFARIRIPGWIQRTTRGRGSGFGIGLALGAVYSPCAGPVLAAVTVAGATGQIGWGSVVLAVS
    FAVGACTPLFFFALAGKQIGTRADFVRSHRKGISYGAGALVIVLAVAIAFNAPAALQRALPDWTAGVQEQFNASDRTKNA
    LQQANGGGAGSLESCRNSAPDRLQDCGPVPAFAGLEGWQNTEAPVDPRHPAKVNGKQSITLVDFWAYA
    CINCQRANEHIT
    KLYDRYRDSGLQVVGVHSPEYAFEHEAHNVAAAIRDQGIHYPVAQDNNFTTWRAFNNRYWPAHYLVDHTGKVRQIHEGEG
    AYAETERLVRELLSAANPGIELPSPVEEGGDSSNDATSSRQRNPETYLGTRRAEYFSDPAGKYKNGTHEFAKVQPEALHY
    SLEGKWELAEQSIRPVDKPAVLHLNYQARRVQLVVSGRGEISVAYGDGTTRHFPINSDGTVDILREPEQQQGELSVRAGK
    GVELYSLTFG

    >gi|68535109|ref|YP_249814.1| hypothetical protein jk0047 [Corynebacterium jeikeium K411]
    MARNATKPLDVLIIGGGFAGTAAGIALARAQRTVRIIDSGKPRNRFSAHSHGILGRDGANPMELLDQGRKEFMTFGGEVT
    QGEVTTLEQTGNAWTATTADEQQFPARQILMATGITDELPDVPGLAELWGSRVFH
    CPYCHGYEVRGRDLAVIGGRNPRFT
    THMVHLMRKWTDRVTFFTNGLSLDEADRALFEKRGVALMDAHVTEVQPDPESGTGVLVSIADPNKSGDSVFTTRAFEACF
    TGPEFHPNDQLLLAAGCESENGWVVRQPDGKTSKTGLWTAGNVTSSPDQVSQAMGTGVATAIAIDQFLLHEELQQVRGQT
    HE

    >gi|68535175|ref|YP_249880.1| methionine sulfoxide reductase A [Corynebacterium jeikeium K411]
    MTNFFDRIMALNSKGPYRAERVGPEDALKGGRTPVLENPQPNVVLGTPLTGLEDSYWAEADGLEQPAQIVLGLGCFWGVE
    RMFWGVDGVWGTSVGYAGGYTPNPTYREVCTGRTGHAEVVRVIFDAAAVSLEQLLQIAFENHDPTQGDRQGNDVGTQYRS
    CVYTQDAEQLGRVRQAIAGWQQRFSDAGFGEITTEVAELADIGDGQYYLAEDEHQQYLHKNPGGYCNHGSNGVSCPVGVL
    GD

    >gi|68535219|ref|YP_249924.1| alkyl hydroperoxide reductase [Corynebacterium jeikeium K411]
    MAKQLLDDNLRKQLGQLVPRITKDIELVYSLDERSASEDLEKLLQDIAELSDKITARRDDDAHERKPSFSIVRTGSDISV
    AFAGIPMGHEFSSLVLALLQVGGNPIKEDKDLIEQVENLDGDYEFVTYMSLT
    CQNCPTVVQALNTMAVLNPRIKHTAVEG
    SLFQDEVNENNVLAVPTIYLNGEEFGQGRTTIEDFVRKLDSGSAAREAKKLNEKDAYEVLVVGQGPAGAAASIYVARKGL
    SVGLIGERFGGQVLDTNSIENFISVPSTEGPKLAAEFEEHVGQYDIDVVKAQAATGLTPATEEGGLHTVHFGDDATLRAR
    ALVIATGAQWRTLGVPGEEEYRNKGVTF
    CPHCDGPLFKGKSVAVIGGGNSGIEAALDLAGVVKHVTVLEFGEACRADDIL
    MQRVEETANIDVITSAATTEIVGDGKNVTGLNYTDRTNDESKSLDVAGVFIQIGLVPNTQWLGESGLELNKMGEIVVDEH
    NATNVPGVYAAGDCTAVPFKQIVIAQGAGANAALGAWQYTVTAPKA

    >gi|68535220|ref|YP_249925.1| alkyl hydroperoxide reductase [Corynebacterium jeikeium K411]
    MSLINTEILDFKNPAFFNGEFTEVSKDDVLGKWSIFFFYPGDFTFVCPTELGDLADHYEELKGMDVEVYAVSTDSHFVHK
    AWHAESEQVGKVNYYMLGDSTGQLTNNFQNMRPGAGQADRATFLVDPEGKIQYIEQTAEGIGRDASELVRKVKAAQYVAA
    HPGEVCPAKWEEGEETLTPGIDLVGKI

    >gi|68535221|ref|YP_249926.1| hypothetical protein jk0156 [Corynebacterium jeikeium K411]
    MIVTGLALGAVLGWVMQRGRFCVTGMIRDIFLNKTWRGFTALLIVIAVHAVGLAALTTAGVITPEYKQFAPLAVVLGGLL
    FGMGIVLAGG
    CASGTWYRSAEGLIGSWLALIFYAGSAAAMKGGSLNALNEGLRSWTLPITTIHGSLGISVWWLVVPFALG
    VAFLARRFLAQEAQTPKMATLKPKKTGLAHLLAEKPWHFYSTAAIIGALGVLAWPLSAATGRNDGLGITSPSSNLSKFLI
    SGEDSVDWGVMLVLGLLVGAFFAAKASGEFRLRVPSAEQAVRSVIGGVLMGVGASAAGG
    CTVGNGMVQTSLFSYQGWVAL
    LFIAIGIGVAAKLWLKPTDVVPGQTSGPKAGPEQSSSLAAQPVAEQKAMAAQLGFQTTGTLLLDRKATAAEGAESSDAGG
    DSDLKLVGDRTYKLDTLGAVCPFPLIDAKAAMADLSVGDSLQIDFDCTQATDAIPRWAATDGHEVTNFEQTTDAGWTITV
    KKGS

    >gi|68535253|ref|YP_249958.1| 6-O-methylguanine-DNA methyltransferase [Corynebacterium jeikeium K411]
    MADLTGQEQTGVGGAVLKFDALKSEVFPRSELLALATERGLVAIEFAHVWQGRELPPAEGAAAQHLEEAARQLGEYLAGE
    RREFTVPVDLSGVTTPFRRRATQALAQIPYGETITYAQLAALAGNPRAVRAAASACARNPLPILYP
    CHRVIRSDGRLGEY
    RGGAETKRALLEMERAL

    >gi|68535305|ref|YP_250010.1| hypothetical protein jk0240 [Corynebacterium jeikeium K411]
    MGHSATDLNETRILLYYCFTPIDDPTAVMLWQRALCEQLELKGRILISKHGINGTVGGSLASCKQYVRRTREFPGFKKME
    FKWSAGSADDFPRLSVKVREEIVAFGAPDELKVDENGVIGGGVHLKPEEVNKLVEERGDEVVFFDGRNAMEAEIGKFKNA
    IVPDVRTTHDFISEIESGKYDDLKDKPVVTY
    CTGGIRCEILSSLMKNRGFEEVYQIDGGIVRYGEKYGDKGLWEGSLYVF
    DGRMHMEFSDDAATLGRCRACGHATNDFHNCVNEQCREQILLCEECAADPESATCGRKECAEVAAEMVG

    >gi|68535337|ref|YP_250042.1| hypothetical protein jk0272 [Corynebacterium jeikeium K411]
    MSEFETVQPTDVPAGAQLIDIREVDEYNQWHAEGATNLPLSELQARYGELDLNEDIYLICLSGGRSARACQWLEQNGIDA
    INVANGTAGWRDAGLPIVGQPHN

    >gi|68535546|ref|YP_250251.1| glutaredoxin-like protein NrdH [Corynebacterium jeikeium K411]
    MITVYTKPACVQCNATKKALDKAGLEYELVDISLDDEARDYVMALGHLQAPVVVAGEDHWSGFRPDRIRSLTAKAA

    >gi|68535573|ref|YP_250278.1| bacterioferritin comigratory protein [Corynebacterium jeikeium K411]
    MTDNNSTTANQPLRLEVGDKAPEFTLPSDSGKNVSLADYAGRKVIVYFYPKADTPGCTTEACDFRDSLTELNGQGVDVVG
    ISPDKVEALEKFRDKYELTFPLLSDADKSVMESYGAFGEKKNYGKIVQGVIRSTFVIDEEGKIAVAKYNVKATGHVARIA
    KEL

    >gi|68535587|ref|YP_250292.1| hypothetical protein jk0516 [Corynebacterium jeikeium K411]
    MSAYTYNVTGMSCGHCENAVKEEVSNLPGVSNIEVSADKGLLTFEHDGAVGELTDQQIIDAVDEAGYEATRA

    >gi|68535612|ref|YP_250317.1| hypothetical protein jk0540 [Corynebacterium jeikeium K411]
    MARVGDMTATQNNNQNQTVTMFFDAICPFAWVTSRWLMEVQEVRDVEVKFQPMSLSVLNEGRDLDPAYREKMDAAWAPAR
    VATAIWQQHPEKLSAWYTAMGTKIHNEERADATDPHGYDELIAEALEEAELPAELAQVGHLAADDEGSVDALLRESQDKA
    IELVGDEVGTPVVQLGDVAFFGPVITRIPRGEDAGKLFDASVTLAANPHFFELKRSRTEAPVAE

    >gi|68535710|ref|YP_250415.1| putative cation-transporting P-type ATPase [Corynebacterium jeikeium K411]
    MTVIDLDITGMTCASCANRIEKKLNKQEGVTATVNYATEKAHIETGEGAAADADSYIAIVEKLGYGGSVPKPEKPAGDDP
    AAKELRGLKRRLVVAIALATPVILLAMIPPLQFDYWQWVSFALATPVILWAGWPFHKATWVNLKHGAATMDTLITVGTSA
    AFLWSLYALFFGHAGDPGMRHGWSILNHAGDPMGDIYFEVAAGVVTFVLAGRYFEKRSKQRAGDAIRALTDMGAKQVTVL
    RDGGETLLPIEQLQIGDHFLARPGEKIATDGRIVDGLSAIDQSMLTGESVPVDVGPGDEVTGATINTSGRLVVEATRVGE
    QTKLAQMAKLIDEAQSGKADVQRLADKVSGIFVPVVIAIALVTLLFAGFSNAVAVLIIACPCALGLATPTALLVGTGRGA
    EQGILIRGPEVLEGAHAITTVVMDKTGTVTTGTMRVVDVAPTGAAREEVLRAAAAVEAYSEHPIGRAIAEAGREEFGSLP
    EVSGFRNLPGHGVEGTVDGQVIRVGRGDEGASTNKATTVSVSADGRAIGTISVADTVRSTSAEAVRKMHEMGLKTVLLTG
    DNQQVADAVAREVGIDEVIAGVMPEDKVAHIRSLENVAMVGDGVNDAAALASADLGIAMGSGTDAAIEAADITVMRDDLL
    AVADALRLARKTLRTIKMNLFWAFAYNVAAIPLAAFGLLNPMLAGAAMALSSVFVVSNSLRLKGFK

    >gi|68535788|ref|YP_250493.1| hypothetical protein jk0713 [Corynebacterium jeikeium K411]
    MTAPEKVTGVELTEAAQQKASALLAQEGRDDLSLRIAVQPGGCAGLRYQLFFDDRSLDGDLVDEYEGVNLVVDRMSSPYL
    MGAKIDFADTIESQGFTIDNPNATGSCACGDSFS

    >gi|68535924|ref|YP_250629.1| thiamine biosynthesis protein ThiF [Corynebacterium jeikeium K411]
    MAGSSHTSSPRTAGTDQAFPAGDFVSLPYREQRRTARHLNLPGFGPTEQQRLHDARVLVVGAGGLGCPAMQSLASAGVGT
    IVLYDDDTVDVTNLHRQILFSAEDVGRAKVDAATDALKRIQPDIRVEAHRYRLDANNIVEAFQQVDLVIDGSDNFDTKFL
    VADAAEISGTPLVWTTVLRFAGQISVFNSTASGERGIGLRDLFPEKPSGDSIPD
    CASAGVLGATTAVMGALAATEAIKWV
    TGVGQPLLGTVVSYDALTARTQSFRIAPDPSRQPVVALSPNDNAAASITACAVQPPEASHTTPDQDPGSHPAKAPGNAAL
    HELVRTGKAFTVDVREYHETLLAQPSFIGEQGADEHLAMSALADPAGTLDVASPAVAEAFARHEGTEAVVYCASGVRSQH
    FVEKYRQVASEYGITLHNLPGGVRG

    >gi|68536149|ref|YP_250854.1| peptide methionine sulfoxide reductase [Corynebacterium jeikeium K411]
    MAELNPTADFRKLTDEQWRERLTPEEFAVLRQAGTEAPFKGEYTDTETEGVYACKGCGAELFRSTEKFHSHCGWPSFFDP
    KDSDAVITRVDDSLGMRRIEVLCARCESHLGHVFEGEGYATPTDLRY
    CINSIALTLKPATPRS

    >gi|68536226|ref|YP_250932.1| hypothetical protein jk1150 [Corynebacterium jeikeium K411]
    MAIQPTPTMGSTMNTFAEQFPELALPCTGEAFPDPQILVLNEPLAAELGLDPQWLRSPEGIAFLTGQHGGHALGYAGHQF
    GQFNPRMGDGRALLLSEHTDPQGEVWDIHAKGTGRTPFSRGGDGHYPLDAALKEYAFAESLHALGVPTSRSLAVLSTGRT
    VQRHRLHPGAVGVRVASSHIRIGTFQYAALMGPQVTERLVDYTLARHFPDASSPLDLFDATVSRQAQLVASWMRFGFIHG
    VMNTDNIAISGETIDFGPCAFMDYFATDTVYSSIDTRGRYAYAQQPAVMMWNLARLAEALVPLVDEGVKKFTERLQRFQL
    QYAAAWDEQMAAALGAPNCAEQLLDLLQVAAPDYCALLANLTPGEIPQGLEHTPGAAEWTERWTAQHPQPRNPIYLPRNH
    GMQAALEQAEAGDLSRYTLALEALRSPFEWDDKYEKLGLHAAVPREEAEFTTY
    CGT

    >gi|68536230|ref|YP_250935.1| mycothione/glutathione reductase [Corynebacterium jeikeium K411]
    MPDFDLIIVGTGSGNSLPSPANEHQRIAIVEKGTFGGTCINVGCIPTKMFVHTADVARSFSEASRLSLTGELQHVDWKDI
    QRRVFADRIDPISESGADYRAGDETPNITLFEGTARFVGPRTLQIGDGPTITGANIVLATGGRPRIHPALADVRYRTNED
    IMRLDELPKSLIVVGGGIVAVEFAAMFSGLGTQVTLINRSEKLLRKLDADISDTFTTQAKQQWTNHLGCNITAAEETDDG
    QITLTLDDGTTVTAEEVLVAMGRVNNSDTLDCETGGVKTRKDGLIEVDEYGRTSADGVWALGDACNDFELKHVANAEARV
    VAHNLAHPNDLRKFNHDVVPSGVFTHPQIGVVGLTEQEARETGRPLTVKIQKYSDVAYGWAMEDTTGFCKVIADRSTGEI
    LGAHIIGPEASSLIQCFVTAMTFGISARDFAEKQYWPHPALTELVENALLGLDIEN

    >gi|68536528|ref|YP_251233.1| putative mercuric reductase [Corynebacterium jeikeium K411]
    MPTKYDLAIIGSGGGAFAAAIRASTLGKSVVMIERGTLGGTCVNTGCVPSKALIAAAGARHVAVDAATRFPGIATTADPV
    DMPALIAGKQALVESLRGEKYADVADSYGWQVLRGDASFVGTPDAPVLDVAGSDGSVETIEAHHYLVATGSRPWAPPIDG
    LEETGYLTSTTAMELTEVPESLLVLGGGYVALEQAQLFARLGSQVTLLVRSRLASKEEPEVSKALQEVFADEGIRVVSRA
    VPTRVSRGTGGEAVVTAALSGGSQEFRADQVLVALGRRPVTDGLNLDAVGVNTGDSGEVVVSDRLQSSNPRVWAAGDVTG
    HPEFVYVAAHHGTLVAENAFADADRSVDYARLPRVTFTGTAIGAVGMTEKDVLAAGIRCDCRVLPLHHVPRALVNRDTRG
    FIKIVVNAETKEILGLTAVAKDAGELAAAGVHVLGRTVAEVANAWAPYLTMAEGIRIAAKAFTTDPSLLSC
    CA

    >gi|68536758|ref|YP_251463.1| thiosulfate sulfurtransferase [Corynebacterium jeikeium K411]
    MGIEYDPSPQLKQYAHPNKLVTNAWLGAKLGTPGLKVVEVDADSLLYDIGHIPTAMRLKWYEDLSDPVWRDLIGPKEFEE
    LMGRLGITREDTVVFYGDHANLWAVYALWVFELFGHPDVRILDGGRDAWMQEEREISYAVDEVSPRPVYSVPSHRNDHTH
    RIFVDELRTKFDGTQVIDLRNAEEYTGEVTLPGYPIRRNGHVPGAKNLRADSSLLANSRFHPAEAIQAIHAELQLDPHRE
    TVVY
    CNNGARAALEWFVLRFLLGWENVRVYDGSWVEWGNMMRVPIERG

    >gi|68536987|ref|YP_251692.1| thiol-disulfide isomerase/thioredoxin [Corynebacterium jeikeium K411]
    MRKKLTAVLAATLLASGAALTACGEESTAGKDAVASGGTFEFVAPGGQTSIHYEPEERKEVADFTGTNLDDGDDINLSDF
    EGQVVVLNAWGQW
    CGPCRSESDDLQRVQEKLEKHGGGTILGINVRDNVKEKAQDFVKDNGITYPSIYDPPFKTALALGGV
    PASVIPTTIVLDKQHRPAHIFLKEITDKELWEQVEPLLNEDE

    >gi|68537030|ref|YP_251735.1| dihydrolipoamide dehydrogenase [Corynebacterium jeikeium K411]
    MAKEHFDVVVLGAGPGGYVAAIRAAQLGLKTAVIEKQYWGGVCLNVGCIPSKALIRNAELAHTITKEAKTYGITGDNISM
    DFKVAHQRSRKVSGNIVKGVHFLMKKNKIQEIHGRGNFVDDKTIEVSDGDDAGKTITFDNCIIATGSVVKSLPGVELGGN
    IVSYEEQILDENKPDSMVIIGAGAIGMEFAYVLSNFGVDITVVEFMDRVLPNEDKDVSKEIAKQYKKLGVTLKTGHKTTA
    VRDLGEGKGVEVDIESADGSKNETLKADRVMVSIGFAPRVEGFGLENTGVKLTERGAIDIDDEMRTSVPHIYAIGDVTAK
    LQLAHVAEAQGVVAAEVIAGEETELLGDYQMMPRATFCSPQVASFGYTEEAAKKKAEEEGREVKVATFPYTANGKAQGLG
    HAVGFVKLVADAEYGELLGAHMVGPDVSELLPELTLAQRFDLTAEEISRNVHTHPTLSEAMKEAAHGIAGGHMINL

    >gi|68537065|ref|YP_251770.1| putative secreted protein [Corynebacterium jeikeium K411]
    MSAPVEHSARTRAIIIAVTLVVGIAILCVPLIAALRDDSADDAGAPASSMEEDAPSAPADDGPVEVANEVRCPAGEDEGG
    GERGAAVSPEAELKDVRLPCLTEGGTGGDTAKSQTSLAERLAGKPTVVNVWAWW
    CAPCREELPVVQELAEQHPEWNVVGV
    HLDAKGQAGADMLRDLGVDKLPSFQDSNHIFDSAANLPKVVPLTVVYNPDGTRAHLYAQTFHSAAEMEKAVQEVL

    >gi|68537088|ref|YP_251793.1| organic hydroperoxide resistance protein [Corynebacterium jeikeium K411]
    MSEALYTAKALSTGGGRDGHVATDDRQIDLDVRPPKAMGGSGEGTNPEQLVSAGWAACFNGALQKTIKEAGVDMSQSPEV
    AVETTLNKVPEGFRLSAKITATVFGVDQAKADELVADAHAF
    CPYSKAMRGEIDVEAVAVVG

    >gi|68537152|ref|YP_251856.1| thioredoxin [Corynebacterium jeikeium K411]
    MATIEITGANFQDTVQGDGIVVLDFWAEWCGPCKRFAPIFEQVSDEHPEAVFGKVDTEANQELSAALQIQSIPTLMLFRD
    GVLLARESGLLPAKALNELIAKAEELDMDEVRKQIEAEQAKEQ

    >gi|68537188|ref|YP_251893.1| hypothetical protein jk2093 [Corynebacterium jeikeium K411]
    MNQPFLQASGILNNDSKGAADADNASATSAAGAAEAEAGKVHDVIIIGSGPAGYTAAVYAARAELNPVVFEGVEYGGLLM
    QTTEVENFPGFQKGIMGPDLMEEMRAQAERFGADLRQEDVEKVDLTGEIKKVWAYGEEYQARTVILATGAAPRYLHVPGE
    QEMLGRGVSA
    CATCDGFFFKDKQIAVIGGGDSAMEEADFLTKFGETVTIIHRRDEFRASKIMEERARNNPKIKFLTNAKV
    VEVKGDKSVETLVVEDTQNGEQKDVAMDAMFVAIGHDPRTAVFEGQVELQDNGYVKVEEPSTRTSLPGVFAAGDLVDSHY
    QQAITAAGSGCRAALDAEAYLATL

    >gi|68537189|ref|YP_251894.1| thioredoxin [Corynebacterium jeikeium K411]
    MSDIVNVTQTTFRSEVVESTQPVLVDFWAEWCRPCLAMTPILDELAAEFDGKAKIAKVNVDEERMLGAMFQVMSIPALMV
    FKDGEKVAEFTGAQDRDTLRSAIEAQL