Agrobacterium tumefaciens C58 uid57865

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|159184127|ref|NP_353062.2| thioredoxin [Agrobacterium tumefaciens str. C58]
    MATVKVDAANFQSEVLESAEPVVVDFWAEWCGPCKMIAPSLEEISSELAGKVKVAKLNIDENPELAAQFGVRSIPTLAIF
    KGGEVADIKVGAAPKTALSAWISSAA

    >gi|159184146|ref|NP_353102.2| glutaredoxin protein [Agrobacterium tumefaciens str. C58]
    MTVTVYSKPACVQCTATYRALDRIGVPYEIIDISEDTDALDHVRGLGYMQVPVVVAGERHWAGFRPDMIGSIS

    >gi|159184150|ref|NP_353108.2| molybdopterin biosynthesis protein MoeB [Agrobacterium tumefaciens str. C58]
    MDPLSPEEIERYKRHILLPEIGGAGQQRLKAARVLVIGAGGLGAPVLHYLAAAGVGTLGMIDDDVVSLSNLQRQVIHDTG
    TIGELKTESARKTIARLNPHVRTLMYEERFSQVWAHDHLPSFDLLIDGSDNFDTRYAAADAAEAAKRPLVTGAVGRFDGS
    VTVLKPYETNAEGSLLPGYRDLFPAPPPQGLIPN
    CAETGIVGALTGVIGTLMAMEAIKVITGAGEPLIGRLLLYDALSAR
    FETVKYKRRAREK

    >gi|159184170|ref|NP_353160.2| methionine sulfoxide reductase A [Agrobacterium tumefaciens str. C58]
    MFLFDTLSKKTTMPTEETALPGREEALAVPETHFVNGRPLKGPYPDGLEIIYLGMGCFWGAERLFWKTPGVWVTAVGYAG
    GFTRNPTYHETTTGQTGHAEVVKVVYDPAVISLSGLLKIFFEEHDPTQGMRQGNDVGTTYRSAIYATTEGQLQQAQKARD
    AFQQALDEAGHGHAITTEIGPLETFYYAEDYHQQYLAKNPGGYCGLRGTGVSCNIG

    >gi|15887579|ref|NP_353260.1| hypothetical protein Atu0228 [Agrobacterium tumefaciens str. C58]
    MTETKPRIAIRYCTQCNWLLRAGWMAQEILQTFASDIGEVSLIPSTGGLFEITVDGTIIWERKRDGGFPGPKELKQRIRD
    LIDPERDLGHVDRTKHEGLDT

    >gi|15887588|ref|NP_353269.1| oxidoreductase [Agrobacterium tumefaciens str. C58]
    MKFDVIIIGGSYAGLSAALQLGRARKNILLVDAGERRNRFASHSHGFLGQDGKAPGEIIAEARRQIERYPTIHWVEGRVT
    DAKGSFGEFIVEIDGGRRETAGRLILAMGVTDELPEIAGLRERWGSAVFH
    CPYCHGYELDQGKIGVIAASPMAIHHALML
    PDWGETTFFTNGIVEPDADQHALLAARGVRVETTRIREIAGHADVVLADGRSIALAGLFTQPKLRITVDWIEKLGCAVEE
    GPMGSTIVTDPMKQTTARGIFACGDVARPAGSVALAVGDGAMAGAAAHRSILFPEMR

    >gi|15887626|ref|NP_353307.1| hypothetical protein Atu0276 [Agrobacterium tumefaciens str. C58]
    MTVTIYGIKNCDTMKKARSWLELNGIDYSFHDYKAAGIDRAHLETWCDAAGWETVLNRAGTTFKKLDDSQKADLTREKAI
    GLMLDQPSMIKRPVLEAKGKITVGFKPEIYQTVFA

    >gi|159184339|ref|NP_353520.2| hypothetical protein Atu0492 [Agrobacterium tumefaciens str. C58]
    MKTRINYAKASPEAFKAVMALENYVQSSGLEHRFIHLIKLRASIINGCAFCVDMHVKESRHDGLSEQWINLMSVWRESPV
    YTEQERALLGWVDAVTKIAETGAPDDAFETLRAHFSDEEIVKITVAIGAINTWNRIAVGFRSQHPVEAAAKAA

    >gi|15888122|ref|NP_353803.1| peroxiredoxin [Agrobacterium tumefaciens str. C58]
    MTIKIGEKLPSATFKEKTADGPVETTTDALFGGKKVVLFAVPGAFTPTCSLNHLPGYLENRDAILAKGVDDIAVVSVNDW
    HVMGAWAQSSGGQGKIHFLADWDASFTKALGLDADLSGGGLGVRSKRYSMLVEDGVVKSLNVEENPGQATVSAAAAMIEQ
    L

    >gi|15888143|ref|NP_353824.1| hypothetical protein Atu0800 [Agrobacterium tumefaciens str. C58]
    MHFPELTISRRSLLGGVALAAIATALPFAFTPGIAEAQELPESTGDVDMAAVMKPGPLPEAALGDANAPVKIVEYMSMTC
    PHCANFHNKTFEEIKKKYIDTGKVYFVLREFPFDPRAAAAFMLARCAPEGQYFPFVSMLFKQQQSWAVAQDARAALLQMS
    KMAGFSQESFEACLTNQKLLDDVNATMQRGATEFGVNSTPTFIINGKKYAGDMSVETMSAVIDKLL

    >gi|159184493|ref|NP_353865.2| P type cation (metal) transporter, ATPase component [Agrobacterium tumefaciens str. C58]
    MNISTRGSLNGESEELTFKVGGMDCGSCAAKIETALSRLPGVADVKVSVARERLNLSLAENKTPVEKIEDTLRKLGFKPA
    LLPRDKAPEAKAADHHDHSTCGGHHHDEAEIPAEKNNALIFSVGGMD
    CGSCAAKIETALSRLPGVGDVKVSVARERLNLS
    LAENKTPVEKIEDTLRKLGFKPALLPQEKTAREKTPEQNHDHDHATCGGHHHDHDHSGHDHAAHDHSGHDHQSCKGHDHD
    HSDHDHSGHDHSGHDHAGQSHAAAPAAASQSAEIGHAHGADEKGAWWRSAKARNTFTGTVLVAIAYAAELTFPAWGSYAF
    IVATLATLFPIARNAFNAARFGAVFTIEMLMTIAAIGAIIIGEAEEAAIVVLLFSVGELLEGFAAARARSGIKALGSLLP
    KTALVEENGSLRQIAADQVRIGQVVVARPGDRIAADGVVMEGQSSVDESPMTGESIPVAKEKGARVFAGSINHDGSLRIR
    VDRAPEDNTIARIITLVEEAQDARAPTERFIQSFSRYYMPLIVAISALTIVVPPLVGLGDWDTWIYRGLALLLIGCPCAL
    VISVPAAIASSLSAAARHGMLVKGGAVIEMLARTETVAFDKTGTLTLGEPVVTDVVALDGNEAELIAQAATIENESSHPL
    ARAIVSHANKAGVIPLPGSEIKAISGRGMQGNVGGKRLFIGAPRFATDVGTVSNELAERISALESEGKTVAVVMAEGVAS
    GLFAMRDEPRKDAAEGIKALKDMGISSLMLSGDNARTARAIGNKLGLEARGELLPQNKVEEIRKLAEKKTVVMVGDGIND
    APALAAASVGVAIGSGTDVAMEAADAALMRNNVGDAARLIGLSRATMSNIRQNVTIALGLKAVFLVTTVTGVSGLWLAVF
    ADTGATVLVTANAMRLLGYFNGRKT

    >gi|15888188|ref|NP_353869.1| organic hydroperoxide resistance protein [Agrobacterium tumefaciens str. C58]
    MPILYTTKASATGGRAGNAKSEDGVLDVTLTVPKELGGDGARGTNPEQLFAAGYSACFLGALKAVAGKHKVKIPEDTTVT
    ATVGIGPREDGTGFGIEVTLKVNIPGLEREKAEELVAAAHIV
    CPYSHAMRTSTEVPVSVA

    >gi|15888240|ref|NP_353921.1| 6-O-methylguanine-DNA methyltransferase [Agrobacterium tumefaciens str. C58]
    MPVFRRHASQNCASIPPMMLFKRPDTETLYFALVNKDPAYEGVAYVCVTSTKIFCRFTCTARKPKIENCRFRETITECLE
    AGFRPCKRCKPMLSYGTPDGTVTALLTALENEPARRWREEDVVALGHDPSTVRRSFKRRFGMSFLEIARLRRVGDAAESL
    ASGEAVIGAQIDAGYESGSGFRSAINQLFGTSPAAMKGRGFLKGDWIDTPIGPMLAVADDHALHLLEFADRPALPAELKR
    LKARTGADMVLGRTAVTGQIAAELAAYFAGRSGSFETRLAGHGTPFERDVWRNLREIPAGEIVSYSSLATAMERPTAVRA
    VARANGANQLAIVVP
    CHRVLGADGSLTGYGGGLWRKKWLIEHERRMARGQMLGMPLAS

    >gi|15888246|ref|NP_353927.1| methionine sulfoxide reductase B [Agrobacterium tumefaciens str. C58]
    MSDLTSPKVNKSDADWREQLTPEQYHILREHGTERPFTGPYWNSTEKGLYRCAACDEPLFLSDTKFDAGCGWPSYFEPVK
    PGAVTEHRDSTHGMVRTEIRCANCGGHLGHVFPDGPPPTGLRY
    CINGHSMVFEPV

    >gi|159184538|ref|NP_353957.2| copper transporting ATPase [Agrobacterium tumefaciens str. C58]
    MTCASCVRRVETAAAKVPGVASSSVNFATKKLTVEPAEGFSARTLGAAIKKVGYDIAPERQEFAVDGLHGEAEAERLKAV
    LNAVATTVNVKVDAAAGKVAVETIGGRRERDALVETAKLAGFALKTPKPHGHSAHHDHGQHHAHHQGHSQMTAAGESGGH
    DHMQHAGEEGALKRDLTIAAILTAPLFVLEMGGHIYEPMHHWLMGIIETQNLYYIYFVLATAVIFGPGLRFLKAGFPALL
    RGAPEMNSLVALGVTAAYLYSVVATFAPDLLPAEAQFVYYEAATVIVTLILTGRLLEARASGRTGDAIRKLMSLQAKTAR
    VERDGATIDISPDDLVAGDIIVIRPGERLAVDGEVVEGSSYVDESMISGEPVPVEKTVGATVVGGTINKTGAFKFKATKV
    GADTMLSQIIRMVEEAQGSKLPIQLLVDRVTALFVPVVIAIAVLTFIVWAIFGPEPAYTFALVNAVAVLIIACPCAMGLA
    TPTSIMVGTGRAAELGVLFRKGQALQELRSAQIVVVDKTGTVTKGRPELTDLVVAEGFADNEVLALVAAVEGRSEHPIAE
    AIVRAAEEKNVATPAGLAPTTVENFESVTGYGIAATVNGRKVEVGADRYMAKLGHSVDIFAEAAARLGDEGKTPLYAAID
    GRLAAAIAVADPLKPSSVTAIKALQAMGIEVAMVTGDNERTANAIARQVGISRVVAEVLPEGKVKAIHEMRAGGKVLAFV
    GDGINDAPALAEADIGIAVGTGTDVAIESADVVLVGGDLLGAVNAIEMSRATMRNIKENLFWAFGYNVALIPVAAGVLYP
    AFGITLSPMIGAGAMALSSVFVLANALRLKRAKVVHREVTS

    >gi|159184545|ref|NP_353965.2| hypothetical protein Atu0945 [Agrobacterium tumefaciens str. C58]
    MKFDNSYAHLPERFSAAVLPTPVKAPRLIAFNRTLAEELLLDVADLDDDRLAAIFSGNVVPQGAEPLAMAYAGHQFGGFV
    PQLGDGRAILLGEVIDVNGRRRDIQLKGSGPTPFSRRGDGRAALGPVLREYIVSEAMFALGIPATRALAAVLSGDRVQRE
    VGLPGGVFTRVAASHIRVGTFQFFAAREDDEAIRSLADYVIDRHYPDAKNTENPYLALLRGIAERQCALIARWMMVGFIH
    GVMNTDNMAVSGETIDFGPCAFLDEYHPNKVFSSIDAQGRYAYNNQPGIAQWNIARLAECLLPLLDPEVEKAAELANAVL
    ADFAAAFPQRWLTGMREKLGLTTEEEGDMDLIQSLLSLMQASEADFTLTFRRLSHAANGDAEPFRGMFIDIAGADAFLTR
    WRERAGREGISDSERSAAMLSINPAIIPRNHRIEELIEAAVEDGDFEPFHAMLTAIATPFEERPDNFVYMQPPMSHERVF
    RTF
    CGT

    >gi|15888531|ref|NP_354212.1| heavy-metal transporting P-type ATPase [Agrobacterium tumefaciens str. C58]
    MRMSQMEIRASHQIAIDGMTCASCVGRVEKAIARVPGVLKASVNLATERADISFSGPPDVPAVIAAVRHAGYGVEEKTVE
    LDIEGMT
    CASCVGRVEKALKAVSGVSDASVNLATERAAIRVAGNAASAATLAEAIKRAGYQAKEIVADKAGDAEQDRRAA
    DMRSLKISLAVAVVLTLPVFVLEMGSHLVPAIHDFVMETVGMRKSWYLQFVLTTLVLFGPGLRFFKKGIPALMRLAPDMN
    SLVVLGTAAAWGFSVVATFLPEILPRGTANVYYEAAAVIVTLILLGRFLEARAKGRTSEAIKRLVGLQAKSARVLRDGET
    IDVPLQDVRTGDVIVVRPGEKVPVDGLVLNGSSYVDESMITGEPVPVTKTEGSEVVGGTVNRNGSFTFRATKVGSDTLIA
    QIIRMVEEAQADKLPIQALVDKVTNWFVPAVMLAALVTFAVWFVFGPDPALTFALVNAVAVLIIACPCAMGLATPTSIMV
    GTGRAAEMGVLFRRGDALQTLRDADVIAVDKTGTLTLGKPKLVHFNTTQGFDADEVLRLVASLENRSEHPIAEAIVEAAK
    HGGLTLAEAEAFEATPGFGVAATVDGRRVEAGADRFMVKLGYDVGAFATDAERMGREGQSPLYAAVDGRLAAIIAVADPI
    KQTTPEAIAALHALGLKVTMITGDNRRTAEAIARRLGIDEVVAEVLPDGKVEAVKRLAAGGRRVAFVGDGINDAPALAAA
    DVGLAIGTGTDVAIESADVVLMSGDLRGVANAIALSKATIRNIRQNLFWAFAYNAALVPVAAGILYPVNGVLLSPVLAAG
    AMALSSVFVLTNALRLKSFRAPLVDRSSDLQLAAAE

    >gi|15888551|ref|NP_354232.1| thiosulfate sulfurtransferase [Agrobacterium tumefaciens str. C58]
    MSTDKSRFVVSADWVEKQLGTAGFRVVDASWYLPAHKRNGAEEYAAGHLPGAVFFDQDKIADHTTGLPHSLPSPEFFAQE
    AGELGLSENDTIVVYDGPGFFSAPRVWWMLRVMGVRKAYVLDGGLDGWKREGRPLETGTPEIEPATFTPDFNDKRVTSLS
    TMRGIVDSGEKQIADARGAGRFTGDEAEPRAGMRSGHMPGARSLPAMAFSDNGHFKDLTAIRKMVTDAGIDLSKPVVTS
    C
    GSGVTAAVVTLALESLGHHDNSLYDGSWSEWGGLEDTPVVTGAADPLPVISHGPLKAHVTQLEMTAPPKVSLPIPVNLQT
    ALMRVNNIPLHFYRYLYWRVGKRWHWQKRMRMSDAELSAILRDPKNSVTVLYMNGAPAGFFELNKASDEVTELSYFGLLE
    EAIGAGVGKWFLLQALYAAWQDNPQRVTVTTNTLDHPRALQLYQMMGFSPVGTYEAWVEPLADTELLEISLRN

    >gi|159184670|ref|NP_354237.2| methylated-DNA--protein-cysteine methyltransferase [Agrobacterium tumefaciens str. C58]
    MTNHYGYIVFPTALGHCGLAWGRRGIARLQLPSPDAGETEKLLLRRLPSSTIAVPETRTREVIAMITRYFGGEAIDFTTV
    ELDLAGQERFFLDVYAVARQIGWGRTTTYGGIVKDLGLSMEKARDVGQAMAKNPVPLIIP
    CHRVLAAGGRLGGFSAPGGT
    TTKLRMLDLENAGRSRADEAQGSLF

    >gi|159184716|ref|NP_354339.2| outer membrane protein [Agrobacterium tumefaciens str. C58]
    MAHFLRSTLLASVTALSTVFACLPAHALDEQQKKEMGEFIKQYLIENPEIMLEVQDALERKQYASRNAKAAEAVADNKKA
    IFESKYDLALGNPDGDVTLVEFFDYN
    CGYCKRAMGDMDNILKGDKKVRVVLKEFPILGPESVAAHRVSNAVKLLAPAKYA
    EFQRTLLGGRGRANEDSAMEVATSLGLKEADIRKSMADNPNDAQVQETYKLATSLGITGTPSYIVGDEAVFGAVGADPLK
    EKIANMRSCGKATCS

    >gi|15888759|ref|NP_354440.1| dihydrolipoamide dehydrogenase [Agrobacterium tumefaciens str. C58]
    MAQSYDVIIIGSGPGGYIAAIRAAQLGMKVAVVEREHLAGICSNWGCIPTKALLRTADVMHTATHAKDYGLTLEGSIKPD
    VKAIVARSRGIAARMNNGVGFLFKKNKVDIIWGEAKITKPGEIVVGKSTKPVVQPQGPVPKNTLGEGTYTAKHIIVATGA
    RPRALPGIEPDGKLIWTYFEAMKPEELPKSLLVMGSGAIGIEFASFYRTMGVDVTVVEIMSQVMPVEDAEISAFAKKQLE
    KQGIKIHLETKVSKVEKAANSVTATLEKKDGSSEKIIADRMISAVGVVANVEGIGLEAAGVKTDRGFIIIDGYGKTNVPG
    IYAIGDVAGPPLLAHKAEHEAVICVEKIAGLPNVHPMDKLKIPGCTYCNPQVASVGLTEAKAKEQGRDIRVGRFSFAANG
    KAVALGEDQGMVKTIFDKKTGELLGAHMVGAEVTELIQGFVVAMNLETTEEDLMHTIFPHPTISESMKESVLDAYGRVLN
    A

    >gi|15888804|ref|NP_354485.1| hypothetical protein Atu1480 [Agrobacterium tumefaciens str. C58]
    MSLRINDIAPDFTAETTQGPVRFHDWIGDGWAVLFSHPKNFTPVCTTELGAMGGLQPEFEKRGVKIIGISVDPVESHEKW
    KADIRTATGFNVDYPLIGDKDLKVAKLYDMLPAGAGDSSEGRTPADNATVRSVFVIGPDKKIKLVLTYPMTTGRNFDEIL
    RAIDSIQLTSKHQVATPANWKQGEDVIITAAVSNEDAIARFGSYDTVLPYLRKTKQPG

    >gi|159184779|ref|NP_354496.2| arsenate reductase [Agrobacterium tumefaciens str. C58]
    MDVTIFHNPSCGTSRNTLALIRAAGIEPTVAEYLQEPPTRERLAKIIADAGLTVREAIREKGTPYAERGLDNPALTDDQL
    LDAMMETPILINRPFVITPLGTRLARPSEVVLDILPETFKGPFFKEDGEQVLDNEGKRIA

    >gi|15888852|ref|NP_354533.1| nitrogen fixation protein FixI [Agrobacterium tumefaciens str. C58]
    MSCCAPGTEGSLELGEPLNPPSSEELLLASRDLGQGLRQTDLSVPGVYCGACITTIETALGRLGQVERARVNLSSKRVAV
    VWKEEVNGVRTDPADIARAILATGYRIHLFASGQDASYALRSQLIRAVALCGFASANIMLLSVSVWSGADAATRDMFHWI
    SAMIAAPALIYGGRFFYQSAWNALKHGRTNMDVPIALAITLSYAVSLWETIHHGEHAWFDATVSLLFFLLIGRTLDHIMR
    DKARSAIAGLARLSPRGATVIDADGVRDYRPLADIEPGMSIAIAAGDRVAVDAVVVCGSSDLDMSIVNGESAPRRVVAGD
    SLQAGTLNLTGSLVARVTASAKDSFLSEVIGLMEAAEGGRARYRRIADRAASYYSPVVHLLALVTFLGWGIFGGDWKQAM
    LIAIAVLIITCPCALGLAVPVVQVVAAGRLFRRGIMVKEGSAMERLSEIDTVLFDKTGTLTVGKPRLVETADVKPAIMAI
    AAGLAAHSRHPLSKALHAAYNGALPAYEAVREIPGSGVEAETEAGTYRLGNRRFACPDETRINNGDARSEVVLSLDGRHL
    ASFGFEDNPRAGAIAALRSLSVRGLAQEIVSGDRAAAVSAMAQRLGIGNWRADLSPKDKAARCAALAGEGHRVLMVGDGI
    NDAPALAAAHVSMAPATAADIGRQAADFVFMQEDLDAVPFAIETSQRAGNLIRQNFALAIGYNIIAVPIAIAGYATPMIA
    AIAMSTSSLIVVANALRLAGAADTILPQKEAKSGFTGEGAQLA

    >gi|159184837|ref|NP_354605.2| glutathione reductase [Agrobacterium tumefaciens str. C58]
    MTAYDYDLFVIGGGSGGVRSGRVAASLGKRVGIAEEYRYGGTCVIRGCVPKKLFVYASQFPEYFEDAEGFGWSVGERRFD
    WKKLIAAKDKEITRLEGLYRKGLENAKADIFDSRAELVDAHTVKLTKTGETYTAERIVIAVGGTPNEHKALPGHELTISS
    NEAFDLEEPPKSILIAGGGYIAVEFANIFHGLGVETTLIYRGKEILSRFDHDMRKGLHEAMEAKGIRIILEDIIEEVSKD
    GAGGFVARTKQGSSLHVGLVMLALGRDPNTKGLGLENAGVKVDARGAIIVDDYSRTNVPSIFALGDVTDRVQLTPVAIHE
    AMCFIETEYKNNPTKPDHELIATAVFSQPEIGTVGLSEEEAGKKYRELEVYRAQFRPMKATLSGRQEKTIMKLIVNASDR
    RVVGVHILGHEAGEMAQLLGITLKAGCTKDDFDRTMAVHPTAAEELVTMYAPSYRVVNGERV

    >gi|15888936|ref|NP_354617.1| pyridine nucleotide-disulphide oxidoreductase [Agrobacterium tumefaciens str. C58]
    MQRRTLLKLAALSTIGVPYTKATASPSLSLLPSVHNKESITMNDVIIIGGSFAGLAAALQLGRARRKVIVLDTGLQRNRF
    AGRSHGMLGHDDKPPSAILAEARQQLARYPAIRIVNARADSISGTIDNFSVLTGDGETLSARRLILSYGVVDQMPDVSGF
    AENWGTSVIP
    CPYCDGFEVADQHWGLVWSGPQSMNQVRLFHDWTDRLTVFGNGHDITPDIRADLESRKVPVVDGRINEIA
    RHGSHGATIKLDTSPDVEVDILFAHPRNKPSASLHDALGLATVNTPTGIALKTDERRETSMPGIYAAGDLANPGIPSVTT
    ATWQGAMAGIFAQQSMLV

    >gi|15889020|ref|NP_354701.1| hypothetical protein Atu1713 [Agrobacterium tumefaciens str. C58]
    MENSDITLSEAAAKRIAQIVAADAGKQALRVSVEGGGCSGFSYKFDLAENPADDDIVIARGDAKVLIDSMSVIYMAGSEI
    DFVDNLLGQSFQIKNPNAVASCGCGTSFSI

    >gi|159184912|ref|NP_354759.2| polyketide biosynthesis associated protein [Agrobacterium tumefaciens str. C58]
    MERIVVDVVSDMVCPWCYLGKARLDLAIAEVQDEISVDVNWRPYRLNPDYPPEGVDQKAALEEKLGKDRLEQAHASLVEL
    GKQVGINYDFDAIKIGPNTLDAHRLSLWAHAEGRDVQERIVTALFKANFEEGRNIGDHAVLTDIAGKAGMDAKVVARLLA
    SDADKDTVIAEIDAAQQMGVSGVPFFIVDQKYAISGAQTPDVLIAALRDIAKIKSDEHKSMN

    >gi|15889122|ref|NP_354803.1| hypothetical protein Atu1819 [Agrobacterium tumefaciens str. C58]
    MGFAIMTMTGAAASRVKAIVDNSGPGAMGVRVGIKKGGCAGMEYTIDLVTEADAKDDLVEFDGAKVWVQPSAVLYLLGTQ
    MDFEVTKMRSGFTFNNPNQTSACGCGESVELKPADLAALAKQREAEASV

    >gi|15889133|ref|NP_354814.1| bacterioferritin comigratory protein [Agrobacterium tumefaciens str. C58]
    MTDLTIGSPAPDFTLPRNGEGTVTLSKLQGKAVILYFYPKDDTSGCTVEAIDFSALGGEFEAANAVVIGISPDSVKSHDK
    FAAKHSLSVMLASDEERKVLEAYGVWKEKSMYGKKYMGVERTTVLIAPDGKIAEIWNKVKVAGHAQAVLEAAKKL

    >gi|159184947|ref|NP_354836.2| glutaredoxin-related protein [Agrobacterium tumefaciens str. C58]
    MSGIHDIIDSEVKSNDIVLFLKGTPQFPQCGFSGQVVQILDYLGVEYKGVNVLADADIRQGIKDYSNWPTIPQLYIKGEF
    VGGCDIVKEMFQSGELQSHFQEQGISVRGAA

    >gi|15889342|ref|NP_355023.1| hypothetical protein Atu2056 [Agrobacterium tumefaciens str. C58]
    MSTVTKTQNPEADPRVKAVFDDIRATRKSDFINNMWLYLAFDPDLLEKTWAEVKAVMATPSALDPLVKEMLYIAVSVTNG
    CSY
    CAHSHTAAAKAKGMTNEQHADLMRVIALAAKTNQLAVALQVPVDTAFDADRQA

    >gi|159185092|ref|NP_355146.2| thioredoxin reductase [Agrobacterium tumefaciens str. C58]
    MSARHTKVLIIGSGPAGYTAAIYAARAMLKPVLIAGMEQGGQLMITTDVENYPGFADPIQGPWLMDQMLKQATHVGAEIV
    SDLVTEVETNVRPFVVRTDSGQVWTADTLIIATGAKAKWLGIESEQHFQGFGVSA
    CATCDGFFYRNKDVIVVGGGNSAVE
    EALYLAHIAKSVTVVHRRDSFRSEKILQERLFAKENVKILWNTEIAEITGAPAKPPMPPSVSGVRLRDTKTGAISDTPID
    GVFVAIGHAPAVELFKGKVKLKDNGYMWTAPDSTATDVEGIFAAGDVTDDIYRQAITAAGMGCMAALEAERYLTAQQPLA
    VAAE

    >gi|159185196|ref|NP_355351.2| hypothetical protein Atu2399 [Agrobacterium tumefaciens str. C58]
    MLGKKVPAVTFRTRVRDEAVGGPNPFRWQDMTSDDYFKGKKVVLFSLPGAFTPTCSTYQLPDFEKLAGEFRALGVDEIYC
    LSVNDAFVMNAWAKGQNLENVKVIPDGSGEFTRKMGMLVAKDNLGFGMRSWRYAAVINDGLVEQWFEEEGYSDNCESDPY
    GVSSPQNILENLKSRAAA

    >gi|15889887|ref|NP_355568.1| dihydrolipoamide dehydrogenase [Agrobacterium tumefaciens str. C58]
    MAYDVVVIGTGPGGYVCAVKAAQLGLKVAVIEKRATYGGTCLNVGCIPSKALLHASETFAHVAHGVDTLGIEVAAPKLNL
    EKMMGHKDGVVKANVDGVAFLFKKNKIDAFQGTGKVVSAGKVSVTNDKGETQEIEAKNIVIATGSDVAGIPGVKVDIDET
    VIVSSTGAIALSKVPEKLIVVGGGVIGLELGSVWSRLGAKVTVVEYLDNILGGMDGEVSKQSQRLLAKQGLDFKLGAKVT
    AVEKTAAGAKVVFEPVKGGAAETLEADVVLISTGRKPYTEGLGLAEAGVVLDSRGRVEIDGHYKTNVDGIYAIGDVVKGP
    MLAHKAEDEGVALAEILAGQRGHVNYDVIPAVVYTQPEIASVGNTEEELKAAGVAYKVGKFPFTANGRARAMQVTDGFVK
    ILADKETDRVLGGHIVGFGAGEMIHEITVLMEFGGSSEDLGRTCHAHPTMSEAVKEAALATFFKPIHM

    >gi|159185328|ref|NP_355625.2| thiol:disulfide interchange protein [Agrobacterium tumefaciens str. C58]
    MLYDQDVNGLDISAIPSALIGTKAPALSLPPLEGSNLPALTDAAIKGKLTLVNVFASWCIPCRQEHPLLQELSKDSRITV
    VGINYKDKSDNALRFLGELGNPFAAIGIDPNGKAAIDWGVYGIPESYLVGADGTILYKKVGPFDARSIELDLLPAIAAAT
    GK

    >gi|159185750|ref|NP_357142.2| hypothetical protein Atu3467 [Agrobacterium tumefaciens str. C58]
    MLLGLASILLFVFNGRIAGISGIMGKALSGERRFADLAFLSGLLAGPYLYAAVFGRFPAVTVVTPWPLIIIAGLLVGFGT
    RMGSG
    CTSGHGIMGLARFSRRSIAATATFLISGICAATIVGVLS

    >gi|15891427|ref|NP_357099.1| glutaredoxin [Agrobacterium tumefaciens str. C58]
    MTLSCVLPHVCEALNNMAPVTIYTRDFCGYCARAKALLDMKGVDYAEYNATTTPEYRQEMIEKSGGTTFPQIFINGQHVG
    GCDDLHALERAGKLDAMLAG

    >gi|15891342|ref|NP_357014.1| thiol:disulfide interchange protein [Agrobacterium tumefaciens str. C58]
    MTEKTPFRLPSAKLVAIAAVAGVLAGAGAVGFRHIGSESPVQGAAVAEGGLCEGAANRIASLKPFLKGQVAAMSAADKPR
    VIPLSFEGPEAKDMTLADLKGKAILLNLWATW
    CVPCREEMPALNALEKEKGGDKFEVVAVNIDVGADEKPKAFMDEYKID
    ALKHYRDSSMGVFNVLKKEGLAFGLPATLLLDENGCLLGAMNGPAAWDSEDAKALVTAATAK

    >gi|159185845|ref|NP_356960.2| antioxidant enzyme [Agrobacterium tumefaciens str. C58]
    MGNNFVTSLIPHDDGAAKHLPGMEMPDVTLAATDGTTVDLRGPGLSVVYAYPRTSPPGGNAIDGWEEIPGARGCTPQSCA
    FRDHFAELRGLGASNLFGLSTQTSEYQREAAERLHLPFPLLSDHSLSLAKSLSLPMFEAGGLTLLKRLTMVIEDGRIKHV
    FYPVDPPDKNADAVIVWLKTNCHSKAHG

    >gi|159185865|ref|NP_356920.2| putative thioredoxin [Agrobacterium tumefaciens str. C58]
    MSDTNNPYGGSYGGQMTASAHHNGELNGAASGHIKDTTTAGFSKDVLEESRRQPVLVDFWAPWCGPCKQLTPVLEKVINE
    ANGRVKLVKMNIDDHPSIPGQLGIQSIPAIVAFADGRPVDGFMGAVPESQIRQFIDKIAGPDAGDPKAEIEAALSEAKQL
    LADGDFNGAAQLFGAVMQADPENPAAIAGIAECMIAAGQYERASELLSSLPAELNDDAGIQLVSKKIAQYEEARKIGDPV
    ALERDLAQNPDHHEARVKLAKVLNAQGRRDEAADHLLYVMRKDRTFDDDGARRQLLEFFESWGFKDPASIAGRRKLSAIL
    FS

    >gi|15890525|ref|NP_356197.1| 6-O-methylguanine-DNA methyltransferase [Agrobacterium tumefaciens str. C58]
    MNANIMLNEDITPIGSDYDTVRGVIELLTLDYREQPSLEAIAARLGQSPTQLQKTFTRWAGLSPKAFLQAVTLDHAKRLL
    REEDLPLLETSIEVGMSGPGRLHDLFVTHEAMSPGEWKAKGGGLTIRYGFHASPFGLALVMITDRGLAGCAFADPGDERA
    CFEDMAGRWPNADYVEDREATAPYAARIFEPAMWTADKPLRVVLLGTDFQVRVWKSLLKIPMGRAVTYSNIACDIGQPTA
    SRAVGAAVGANPVSFVVP
    CHRAVGKSGALTGYHWGLTRKRAMLGWETGKA

    >gi|159186461|ref|NP_395949.2| polyketide biosynthesis dithiol-disulfide isomerase [Agrobacterium tumefaciens str. C58]
    MLKIDLYTEITCPWCIIGHHRLDKVLAGRFPELDADIRQHPDLLLPDAPAEGLYIPDLLLSRYGVTDPKALFARPEAEAR
    ASGLDLDLSRQPWTYRTQAAHGLIFAARARGTQHQLAVAITDAYFLEAKNISDADVLADIAVAYGFEREEARAIALDPEQ
    HRRVEQEAARSMAAGVRSVPYFVFGGRIAINGGRSEDEIASAIREAIGVAASA

    >gi|16119655|ref|NP_396361.1| hypothetical protein Atu5427 [Agrobacterium tumefaciens str. C58]
    MSQPVHEFTLDALEWHPYVKPVDLATATPEQLSALKVTPSNTKVSAYVLVLANEAEALNERTPLFNDIMYSDGGLSRGGR
    EIGALAASFVNHCIY
    CAAVHANRYIQLEKRPEVVDAIYKNGLDADLPDFEQALFNFGVDLTAHPDNVGVYQFYHLREIGL
    DDLEILDLIHSIAIFGWANRLMHTLGEPHRKE

    >gi|16119768|ref|NP_396474.1| mercuric reductase [Agrobacterium tumefaciens str. C58]
    MKEYDAIFIGAGQAGPFLAARMAAMGRKVVLIERKFLGGTCVNAGCMPTKTLVASAKTAQVARRASEFGVRIDGEPVVDM
    KAVAARARKVTLDARSGLASWFDSLETMDVVYGHARFVGAKVVSVGGSLYTAPQIFINVGARPHIPDVPGLANVPYLTST
    SVIALEELPKHLVVLGGSYIGLEFAQMYRRFDAQVTVIERGQYLASREDEDISQAIADILTRDGIKVLLSHKIVSVTTDS
    AEITVRTDQGDVRGSHVLVAVGRQPNTDDLGLDQAGVETDRRGYITVDERLQTNVEGIWALGDCNGRGAFTHTSYNDFEI
    AAANLLDGGDRKVSDRILGYGLYIDPPLGRVGMTERQAKEAGHRIKVATRPMNRVGRAVEKGETLGLMKLVTEADTDRVL
    GAAFLGVGGDEAVYGVLDAMNLGATTEKLRWAVPIHPTVGELVPTLISDLKET

    >gi|16119879|ref|NP_396584.1| hypothetical protein Atu6065 [Agrobacterium tumefaciens str. C58]
    MSQATARHSVTSSPVSTGQLEEPISRLRVPTEDELPQKLRDIHMRIRKKFGFVPNFLTALSANPGTALRIMAFYEHLFDQ
    SNSHLSASERELIAVVTSVATGCSY
    CVFNHRPALAAALGDRVLADRIARNHNDVTLAPRERALADLAQKLAATPHSVGSD
    DFARLRAIGFSEPAILEVLEVSAFFSYGNRLTIALNVLPDPQFFVSA

    >gi|16119881|ref|NP_396586.1| hypothetical protein Atu6067 [Agrobacterium tumefaciens str. C58]
    MTTIDGLARSQRISRLRIPDESELPEDIQALVDRHHHENWVRALSLNPDTARRFTGHFEHLFAATGRRLPLQDRELIAVV
    VSATNGCGV
    CEIHHTRAFGDLLNDPGFARRVALDYHLADLSKRQRALADLAVKVTLSPKTISQADFEKLRDLELSDEELL
    EAVETASWFNHTNRVTISLGILPDDKFFS

    >gi|16119903|ref|NP_396608.1| hypothetical protein Atu6089 [Agrobacterium tumefaciens str. C58]
    MSAPITKHSLRYDEVRQHLLARSEILLADVREEDPFAQGHPLWAANFPIARLELDAWRRIPQRDTLIVLYGHDGIRDLAP
    IAVEKLKSLGYTNVHILEGGLEAWKADGGELFIDVNVPSKSFGELVEAKRHTPLWDATKVKALLDEGANAVVFDARRFDE
    YQTMSIPKGINVPGGELVLRARDLAPDPETLVIVN
    CAGRTRSIIGTQSLINAGIPNKVVGLRNGTIGWTLAGQTLEQGAS
    RSFADVEARDRSEAQKSAAAVAARAGVRSIALSDIGSLQTPDRTTYLIDVRTEPEYLEGHLPGFMHVPGGQLVQETDHYA
    PELFKIGGLPFGFQFFGLGFGGLFQGEPRRGKTPTRMCQLCPSISGVADNRSHLIGVHLIGWHEVDEALGVLSPF

    >gi|15891403|ref|NP_357075.1| hypothetical protein Atu3538 [Agrobacterium tumefaciens str. C58]
    MANATTADNSRTLAALGVTAGMIFTVGSALGFQHIGGYTPCALCLLQRDPYYYAIPLGILAIATSIFKLPTQITRLLLAL
    IGVAMLIGAGLGVYHAGVEWGFWAGPIT
    CATGAPSITTNAGDLLGNLNAIKAPSCNDAALRVLGLSFAGWNVIASIALAA
    VAFFGASRKSR