Corynebacterium glutamicum R uid58897

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|145294065|ref|YP_001136886.1| hypothetical protein cgR_0023 [Corynebacterium glutamicum R]
    MNQQSKKWLVPTLVVIIAVLLIAVVLLMYRGNASETAEGAAATAPAGSDSGSASGTDSGSGAADSDLTSVEARDPSDPVA
    VGDVNAPVGLVVFSDYQ
    CPFCAKWSDETLPQMMKHVEDGNLRIEWREVNIFGEPSERGARAAYAAGLQDSYLEYHNALFA
    NGEKPSEELLSKDGLIELAGELGLDVSKFTEDFQSPETAAAIAQHQQLGIDLGAYSTPAFLLGGQPIMGAQPASVFEAAF
    EQALAAKE

    >gi|145294080|ref|YP_001136901.1| hypothetical protein cgR_0038 [Corynebacterium glutamicum R]
    MAIESIAYTTEALSTGSGRLGQVRTTDGALEFDMTPPKALGGSGEGTNPEQLFAAGYAACFHSAMHSVARSRKITLEDTA
    VGARVSIGPNGAGGFEIAVELEVSIPHLPLAEAQELADAAHQV
    CPYSNATRGNISVTVSVIDEEA

    >gi|145294113|ref|YP_001136934.1| hypothetical protein cgR_0071 [Corynebacterium glutamicum R]
    MLIERIYDEDLAQASYFIGCQAHNTAVVVDPRRDIAIYLDMAKKNGMEIVGVTETHIHADYLSGTRELAAATNATMYVSG
    EGGADWQYEFDAERLYDGGEIRLGNLVLTAVHTPGHTPEHLSFLLKDGAFADEPGFMLTGDFVFAGDLGRPDLLDQAAGG
    VDTRFEGARQMFKSLKEKFLTLPDHIQIFPGHGSGSACGKALGSVPSTTLGYERQFAWWGKYLEADDEQGFIDELLEGQP
    DAPAYFGRMKRQNRQGPAIMGAREPLPQLEASDLHDVIVVDTRSADEVHQGTVAGAVNIPAGNSMAKFGSWTVDPEKDSR
    ALVLLAASQIGAMEMWDHLVRVGIDNVAGFVTNFDGVDLVAPQTVSPDELDKFEYDLLLDVRNRSEVEEGYIPGALHING
    ASVLWNLEKLPRDGKIVSY
    CKSGTRSSIAASTLRNAGFDVVELEGSYDNWVRHNAQ

    >gi|145294115|ref|YP_001136936.1| hypothetical protein cgR_0073 [Corynebacterium glutamicum R]
    MPITITETNKRRNLDQILDVRENFEITEGMIPEAIHIPMGDLSFRFKELDQNRPVIVVCRSGNRSTQVANALKQAGYTAY
    SMTGGMSAWYQNNLPIK

    >gi|145294116|ref|YP_001136937.1| hypothetical protein cgR_0074 [Corynebacterium glutamicum R]
    MTSTQPITSVDAQTLKSWIDKREGLTIIDVRTSHEFSNLHIRGSYNVPLTTLAEHSEEIASRVGEHVVLVCQSGIRAGQA
    QQKLAPLGISTVAVLEGGINSFAKTDGDVVRGTQVWDIERQVRFAAGSLVLAGLAGGKFLSPKVRALSGIIGAGLTFSGV
    SNTCAMGKALSALPWNKTKPVPTKAETLSKLPSPKEN

    >gi|145294166|ref|YP_001136987.1| hypothetical protein cgR_0124 [Corynebacterium glutamicum R]
    MTTPTSPLLPLASDGCGCCAPSTPSATVSAPAVAAATDATPEGPTTYQVTGMTCGHCAGNVTEAVSALPQVDDVQVDLIA
    GGVSIVTVTGSVPLETVHRAIEEAGYTVLS

    >gi|145294175|ref|YP_001136996.1| hypothetical protein cgR_0132 [Corynebacterium glutamicum R]
    MTAPATLKNTTLRSDEFTCPSCVAKIENKLNGLDGVENAEVKFSSGRILITHDPQKVSVRDLVTAVAEVGYTAKPSAI

    >gi|145294181|ref|YP_001137002.1| hypothetical protein cgR_0138 [Corynebacterium glutamicum R]
    MITPSSANSHRAKIIVWTVLAIIVIAGIVIFVVNRSDSSQSATPETMASDAGQIVRENSRVLSQAPNEKAVLVEFLDFEC
    EACRAAYPLVEELREEHSDTVTFVNRYFPLPGHRNSLTAATAVEAAAQQGQYEAMYQKMFETQDQWGESAEDKSAVFRGF
    AQELGLDMAAYDTAVADPATEERIRLDVADGTALGVSGTPTFFLDGQPLLPESLEQFRAEVAAAATD

    >gi|145294206|ref|YP_001137027.1| hypothetical protein cgR_0163 [Corynebacterium glutamicum R]
    MPTKYDLAIIGSGGGAFAAAIRASTLGKSVVMIERGTLGGTCVNTGCVPSKALIAAAGARHVAVDAATRFPGIATTADPV
    DMPALIAGKQALVESLRGEKYADVADSYGWQVLRGDASFVGTPDAPVLDVAGADRSVETIEAHHYLVATGSRPWAPPIDG
    LEETGYLTSTTAMELTEVPESLLVLGGGYVALEQAQLFARLGSQVTLLVRSRLASKEEPEVSKALQEVFADEGIRVVSRA
    VPTRVSRGTGGEAVVTAAVSGGSQEFRADQVLVALGRRPVTDGLNLDAVGVKTGDSGEVVVSDRLQSSNPRIWAAGDVTG
    HPEFVYVAAHHGTLVAENAFADADRSVDYARLPRVTFTGPAIGAVGMTEKDVLAAGIRCDCRVLPLHHVPRALVNRDTRG
    FIKIVVNAETNEILGLTAVAKDAGELAAAGVHVLGRTVAEVADAWAPYLTMAEGIRIAAKAFTTDPSLLSCCA

    >gi|145294332|ref|YP_001137153.1| molybdopterin biosynthesis protein MoeB [Corynebacterium glutamicum R]
    MGRPVKNLDIARYRRQIMLGEIGQQKQQSLFDAKVSVIGAGGLGSPALLYLAGAGVGHIHIIDDDLVDLSNLHRQVIHTT
    AGVGTPKAESAREAMLALNPSVKVTVSVRRLDWSNALSELADSDVILDGSDNFDTRHLASWAAAKLGIPHVWASILGFDA
    QLSVFHAGHGPIYEDLFPTPPPPGSVPS
    CSQAGVLGPVVGVMGSAMAMEALKIITGVGIPLIGKLGYYSSLDGTWEYIPV
    VGSPEVLERVLGSAGVSGISGGFGEVLDVPRVSALVDGVSLIDVREPSEFSAYSIPGAHNTPLSAIREGAIPPDVSAGKE
    VIVY
    CAAGVRSAQAIAILESAGYTGMSSLDGGIEGWLDSLG

    >gi|145294425|ref|YP_001137246.1| hypothetical protein cgR_0380 [Corynebacterium glutamicum R]
    MTSSAKWSIVGVVAILAVIVALIPQLVGGESAEEAQGETSTSKITTRPDCVASGAAGVDLPCLGGANGVGNELATVVNLW
    AWW
    CEPCRAELPIFDEFATTHPELNVIGVHADQNAANGAALLEDLGVNLASYQDDSNLFAGALGLPGVVPITIVVSPDGN
    VVDTFPQPFETIDDLETAVAGALQNA

    >gi|145294484|ref|YP_001137305.1| dihydrolipoamide dehydrogenase [Corynebacterium glutamicum R]
    MTEHYDVVVLGAGPGGYVSAIRAAQLGKKVAVIEKQYWGGICLNVGCIPSKSLIKNAEVAHTFTHEKKTFGINGEVTFNY
    EDAHKRSRGVSDKIVGGVHYLMKKNKITEIHGLGNFKDAKTIEVTDGKDAGKTVTFDDCIIATGSVVNTLRGVEFSKNVV
    SFEEQILDPVAPKKMVIVGAGAIGMEFAYVLGNYGVDVTVIEFMDRVLPNEDAEVSKVIAKAYKKMGVKLLPGHATTAVR
    DNGDSVEVDYQKKGSDKTETLTVDRVMVSVGFRPRVEGFGLENTGVKLTERGAIDIDDYMRTNVPGIYAIGDVTAKLQLA
    HVAEAQGIVAAETIAGAETQALGDYMMMPRATFCNPQVASFGYTEEQAKQKWPDREIKVASFPFSANGKAVGLAETDGFA
    KIVADAEFGELLGGHLVGANASELINELVLAQNWDLTTEEISRSVHIHPTLSEAVKEAAHGISGHMINF

    >gi|145294504|ref|YP_001137325.1| hypothetical protein cgR_0459 [Corynebacterium glutamicum R]
    MAQTPAKIPAALNFIDVDLGVTGMTCTSCSARVERKLNKLDGVEATVNYATESAQVSYDPSKVSPEQLIKTVEDTGYGAF
    TMASAAAESEEDNAPADSGQSRIDAARDHEAADLKHRVIVSALLSVPVVLVSMIPALQFNNWQWAVLTLVTPIFFWGGSP
    FHKATWANLKHGSFTMDTLVSLGTSAAYLWSLWALFIGNAGHPGMKMEMHLLPSASTMDEIYLETVAVVITFLLLGRWFE
    TKAKGQSSEALRKLLDMGAKDAVVLRNGAEVRVPVNQLKLGDVFITRPGEKIATDGEVVEGSSAVDESMLTGESIPVEVT
    KGSKVTGATLNTSGRLMVKVTRIGADTTLSQMAKLVTDAQSKKAPVQRLVDQISQVFVPVVIVIAIVTLIAHLVFTDAGL
    APAFTAAVAVLIIACPCALGLATPTALLVGTGRGAQLGLLIKGPEILESTKKVDTIVLDKTGTVTTGTMSVTDVTAINYS
    ETEILEFAAAVESASEHPIAQAIAKATDHEQVTDFQNTAGQGVTGVVRGHEVRVGRPSSTLIDALLHPFQHAQKIGGTPV
    VVTIDGVDSGIITVRDTVKDTSAEAIRGLKELGLTPILLTGDNEGAAKSVAAEVGIDQVIANVLPHEKVQNIEALQAQGK
    NVAMVGDGVNDAAALAQADLGLAMGAGTDVAIEASDITLMNNDLRSAVDAIRLSRKTLGTIKGNLFWAFAYNVALIPVAA
    IGLLNPMLAGIAMAFSSVFVVSNSLRLRGFKARSN

    >gi|145294535|ref|YP_001137356.1| hypothetical protein cgR_0487 [Corynebacterium glutamicum R]
    MSIVSMVKLSGRIRSRRVAKCEGVGATMGHSVEIIVRDNCGSCVRVKAQILPIVGAAGIKLTERNVDQDASLKLEFGDRV
    PVILVDDEEFACWEVDNDELANALL

    >gi|145294558|ref|YP_001137379.1| hypothetical protein cgR_0509 [Corynebacterium glutamicum R]
    MRLTKLAATIGCVTLSGLALVACSSDSTAGTDAVAVGGTFQFHSPDGKMEIFYDEADRQQLPDIGGDSLMEEGTQINLSD
    FENQVVILNAWGQW
    CAPCRSESDDLQIIHEELQAAGNGDTPGGTVLGINVRDYSRDIAQDFVTDNGLDYPSIYDPPFMTA
    ASLGGVPASVIPTTIVLDKQHRPAAVFLREVTSKDVLDVALPLVDEA

    >gi|145294866|ref|YP_001137687.1| hypothetical protein cgR_0813 [Corynebacterium glutamicum R]
    MSSHDLVDVVVVGAGAAGLAAAVALGRSLRSVTVIDAGQPRNRYAHAAHNVLGQEGIAPAELLERGRAEARSYGVTIAPG
    RVAKVERTGSTFAITLDDASLLHSRRIILAHGAVDDLPEVEGLSDFWGTEVLH
    CAYCHGFEARDSEIVVVGTSPMAAHQA
    LMFSQLSKTVSLVGTIDIDEHTSERLDSAGVKVLGTNAVRVSAEGDGLSVELSEGDHLSCDNIVVASRPLVDGTLYTQLG
    GQMEENPMGRFIPGTQTGRTPIEGVWAAGNAQAPMAMVYGSAAQGVMAGAEINFDLILEDTSVASAQS

    >gi|145294874|ref|YP_001137695.1| hypothetical protein cgR_0821 [Corynebacterium glutamicum R]
    MAAPFDPFPAFEEYAHPERIVSASWLSARLGSPGLKVVESNEDSLLYDIGHLPGAVRIDWAKDLNDPLTRDFIDGEAFAE
    LMNRKGIARDDTVVVYGDKSNWWAAFTLWVFELFGHSDVRLLNGGRDAWMAEERDTSYVVPEYPSANYPVVERVDENQRA
    FVAEVLGSLTQSGGMTLVDVRTPSEFSGLDEHGNPTSNTGVLRGGHIPGAINLDWSDAVLPNGNFRTRAELDKLYADLNP
    ADDTVVY
    CQVGDRAAHTWFVLKYLLGFNNVRNYDGSWAEWGNMVRMPIETGENTKK

    >gi|145295013|ref|YP_001137834.1| hypothetical protein cgR_0957 [Corynebacterium glutamicum R]
    MSNVTIYATDWCPYCRSLLKGLDGQEYDLIDVDQDEEAGEWVKSVNDGNRIVPTVRYSDGTHATNPPAAEVIAKIEALA

    >gi|145295072|ref|YP_001137893.1| hypothetical protein cgR_1015 [Corynebacterium glutamicum R]
    MSSLDNAPLLELDVQEWVNHEGLSNEDLRGKVVVVEVFQMLCPGCVNHGVPQAQKIHRMIDESQVQVIGLHSVFEHHDVM
    TPEALKVFISEFGIKFPVAVDMPREGQRIPSTMKKYRLEGTPSIILADRKGRIRQVQFGQVDDFVLGLLLGSLLSETDET


    >gi|145295228|ref|YP_001138049.1| thiol peroxidase [Corynebacterium glutamicum R]
    MAKTHFQGNETATSGELPQVGDNLAEFNLVNTELGEVSSKDFQGRKLVLNIFPSVDTGVCATSVRKFNEAAASLENTTVL
    CISKDLPFALGRFCSAEGIENVTPVSAFRSTFGEDNGIVLEGSPLKGLLARSVIVVDENGKVAYTQLVDEISTEPDYDAA
    LAALN

    >gi|145295236|ref|YP_001138057.1| hypothetical protein cgR_1177 [Corynebacterium glutamicum R]
    MKVTIFHNPRCSTSRNTLAYLRDKDIEPEIVQYLKDTPTASELKELFNTLGIPVHDGIRTREAEYTELGLSPETPETELI
    DAIVAHPRLLQRPIVVTAKGARIARPKIDVIDSIL

    >gi|145295315|ref|YP_001138136.1| hypothetical protein cgR_1255 [Corynebacterium glutamicum R]
    MTSPNTLKQTTLRSDEFSCPSCVSKIENKLNGLDGVDNAEVKFSSGRILVDHDPSKVSIKDLVAAVAEVGYTAKPSAI

    >gi|145295451|ref|YP_001138272.1| hypothetical protein cgR_1385 [Corynebacterium glutamicum R]
    MLFERIYEEGLAQASYFIGCQREGKAIVVDARRDIQTYLDLAAKNNMVISAVTETHIHADYLSGTRELAAATGAEIFLSG
    EGGADWQYGFTGTTLMHNSTIKLGNITITAKHTPGHTPEHLSFLITDGAVSKDPGFMLSGDFVFVGDVGRPDLLDEAAGG
    VDTRFAGAQQLFHSLKEQFLTLPDHIQVYPGHGAGSPCGKALGAIPSTTVGYEKANAWWAPYLRSDDEAGFVEELLDGQP
    DAHAYFARMKKQNKQGPAVLGTLSPLVKLEAEEVVEKLGSEAVFVDTREQNQVHLGTVVGALNIPRGAKASNFAAWVIDP
    QKDAQDLIVLAPDANTAADFRDALLRVGIDTVRYFTNSIDGLPTFVPELISPAELAETNYDALIDIRAKSEFAAGSVPGA
    QQLSGGSAMWRLNELPAGGTLVTF
    CQSGARNTVVANALRRAGFTVIELEGSYAAWEKSAANPKNLQTAV

    >gi|145295558|ref|YP_001138379.1| hypothetical protein cgR_1485 [Corynebacterium glutamicum R]
    MTSLKVTSSTDATNNNDAHFPEGPVVTVDWLSHNLDRDDVIVLCATMEDDEIARQAGIPGAFLADLEGDFSDPHSELPHT
    APPNLVGLLESYGISTDSTVVVYDLHGLMVAPRVWWLLRIAGLSSIGVLDGGLPAWVDAGLPTEPLSLPTGGGRISAEPQ
    PDLLVGASGVERAIARSSKAVIDARNASRFAGVEEEPRPGLRKGSIPGSVNIPFTDISDEHGFVRPAEELKELIFSRTNG
    AQSLVFS
    CGSGVTACVDAYAAVIAGYDDVVVYEGSWAEWGNPANQKPIA

    >gi|145295802|ref|YP_001138623.1| hypothetical protein cgR_1727 [Corynebacterium glutamicum R]
    MTDFKLISDTEWRERLTPQEFHVLREAGTEPPHVGEYTNTTTEGVYSCRACGEELFRSTEKFESHCGWPSFFSPLAGDKI
    IEKEDLSLGMRRVEILCANCGSHMGHVFEGEGYDTPTDLRY
    CINSISLKLEEKPVS

    >gi|145295907|ref|YP_001138728.1| mycothione reductase [Corynebacterium glutamicum R]
    MSEQPASIKHYDLIIIGTGSGNSIPGPEFDDKSIAIVEKGAFGGTCLNVGCIPTKMYVYAADIAQEIQESARLGIDATVN
    SVDWPSIVSRVFDKRIDLIAQGGEAYRRGPETPNIDVYDMHASFVDSKTISTGIAGQEQLISGTDIVIATGSRPYIPEAI
    AESGARYYTNEDIMRLPQQPESLVIVGGGFIALEFAHVFEALGTKVTILNRSDVLLREADADISAKILELSKKRFDVRLS
    TAVTAVHNKADGGVKISIDTGDDIEADILLVATGRTPNGNQMNLDAAGIEMNGRSIKVDEFGRTSVEGVWALGDVSSPYK
    LKHVANAEMRAIKHNLANPDDLQKMPHDFVPSAVFTNPQIAQVGMTEQEAREAGLNITVKIQNYSDVAYGWAMEDKDGFV
    KLIADKDTGKLVGAHIIGAQASTLIQQLITVMAFGIDAREAATKQYWIHPALPEVIENALLGLEF

    >gi|145296006|ref|YP_001138827.1| thiamine biosynthesis protein ThiF [Corynebacterium glutamicum R]
    MRWPHQVLKVWHPGRSRCFNMAQLPTSELHRTARQLALPGYGIEQQERLFNAHVLVIGAGGLGCPVMQSLASAGVGTITV
    IDDDTVDISNIHRQILFGASDVGRPKVEVAAERLKELQPDITVNALHERITPENACELLNSVDLVLDGSDSFSTKYLVSD
    AAEITGTPLIWATVLRFHGELALFNSGPDHRGVGLRDVFPEQPSADFVPD
    CATAGVLGATTAIIGALMATHAIGFLTEIG
    DVQPGTILSYDAFPATTRRFRVSADPARPLVTRLRASYEAARTDTTSLIDATLNGSLTALDIREAHEVLLKDLPEGATSL
    KLPLSHISSDDDVLEALSAIDGDILVYCASGIRSSDFIDKYSHLGHNFVNLPGGVNAL

    >gi|145296159|ref|YP_001138980.1| hypothetical protein cgR_2078 [Corynebacterium glutamicum R]
    MTAPSTNTGVILTESAASKAKALIDQEGRDDLSLRIAVQPGGCSGLRYQLYFDDRTLDGDKEDIVGGVRLVVDKMSTPYL
    LGAQIDFADTIEQQGFTIDNPNAGSSCACGDSFN

    >gi|145296406|ref|YP_001139227.1| hypothetical protein cgR_2320 [Corynebacterium glutamicum R]
    MAQKVTFWFDTTCPFCWVTSRWIKEVEQVRDIEIQWVPMSLAVLNDGRDLPEDYKERMKAAWGPARVFAAVATDHADKLG
    DLYTAMGTRIHNDGRGPIEGSFNDVIAGALEEVGLDAALGEVADTTEWDDALRAFHQTAMDEVGNDVGTPVVKLGDTAFF
    GPVLTRIPRGEEAGEIFDASFKLASYPHFFEIKRSRTENPQFD

    >gi|145296423|ref|YP_001139244.1| hypothetical protein cgR_2337 [Corynebacterium glutamicum R]
    MSDLIDMLVGEDLPQLRDNRPQARDNAQKSFEALLEPVNPGTFSFGERYAVATYVAGLHQFAPAVDLYQDLLLDDAPTTL
    ANAVSDAIDEGLSAGPYGTYREPGLESESEPGGSVRNDAAKLGERLAAAFDYAHLLVFHPRDSRPEVLGRLSGAGWSADD
    TVTLAQLVSFLAFQLRIAYGLRTLKGEDIQVKAPRLSIPEAKWELSNNGFEISTYEELNRPEAFVNHSLGWKPWVPPVAK
    ADLTEEQLDSLIQPERADMPYFRLLARDPAALKARTLTDLDIFFNTDGEGLGRAERELGATVTSRYNGCVY
    CASVHAGRA
    QEESGRADDVNALLASIDSDLGSDQWNVIRDAARALTATPAAFNQGCISKLRGVGFSDLQIVDLINSVAFFNWANRLMLS
    LGEPEVPKRFL

    >gi|145296491|ref|YP_001139312.1| hypothetical protein cgR_2402 [Corynebacterium glutamicum R]
    MTEVKRLDVGDTPPAFSLPNDSGSTTSLSDFAGKQVLVYFYPKANTPGCTKEACDFRDSLSNLNDLDIAVVGISPDPVDK
    LVKFREDHELNFPLLSDEDKSVMTAWGAFGEKKNYGKIVQGVIRSTFLINADGTVGMAKYNVRATGHVERIVREITAA

    >gi|145296530|ref|YP_001139351.1| hypothetical protein cgR_2439 [Corynebacterium glutamicum R]
    MAITVYTKPACVQCNATKKALDRAGLEYDLVDISLDEEAREYVLALGYLQAPVVVADGSHWSGFRPERIREMATAAA

    >gi|145296562|ref|YP_001139383.1| hypothetical protein cgR_2470 [Corynebacterium glutamicum R]
    MSIEFSAPAKMKIEVWSDIMCPFCYIGKKRLDDALSTFDQAGRIEVEYKSFELMPGLETHPLRSDIEYLADAKGMSLEQA
    RQMNGQVQAMAQATGLEMNPDETIAANTINAHRLTHFAKAHGKQQEVAQELFKAHFVDGKNVDDLDVLVSIAAEVGLDAS
    AAREALESDAYTNEVQQDVYEARQLGVQGVPFFVFDRKYAINGAQQEEVFTGTVEKAFEEWAAENPVSPFEVIDGQSCSV
    DGTCN

    >gi|145296586|ref|YP_001139407.1| hypothetical protein cgR_2494 [Corynebacterium glutamicum R]
    MTSIHDISVTLNDGTETTMADWAGHLLLIVNVASKCGLTPQYEGLQKLYEEYQDRGFFVIGVPCNQFNGQEPGTDAEVCA
    FAQNQYDVTFPLLSKTEVNGEGTHPLYKVLKEATGGSEIEWNFEKFLVDAEGNTIKRFAPRTEPSAAEVVEAIEENLPI

    >gi|145296707|ref|YP_001139528.1| hypothetical protein cgR_2612 [Corynebacterium glutamicum R]
    MKEVAVNEVPAGAQLIDVRETDEYAEVRAQGAVNIPMSEFVGRINEIDLDRDIYVICKLGGRSAQVAEYLEQRGIEAINV
    NGGTDGWVAAGLPTEA

    >gi|145296902|ref|YP_001139723.1| hypothetical protein cgR_2802 [Corynebacterium glutamicum R]
    MSYHDHSDIEYLKKIGANSPDAFKAFAHFDEAALRGPNKEIPRNYTEMIALAVAFTTQCAYCIDIHTAAAKKEGVTTEEL
    AEVALIAAALRAGGAMTHGALAMKLYDEN

    >gi|145296930|ref|YP_001139751.1| methionine sulfoxide reductase A [Corynebacterium glutamicum R]
    MAWFFAPEPVMVTADEALKGGRHPVLENPAPHTVLGTPVTGPWKEGQQRIWIGLGCFWGVEQMYWQMDGVEGTSVGYAGG
    FTPNPTYREVCSGRTGHTEIVEVVYDPSKISLEQLVARGLEAHDPTQGFRQGNDVGTQYRSAYYTENEEDAARVKAVVDA
    YGETLKQHGFGEITTEIGVISPSEYFLAEDYHQQYLDKNPDGYCPHHSTGIPCGVEA

    >gi|145296963|ref|YP_001139784.1| hypothetical protein cgR_2862 [Corynebacterium glutamicum R]
    MAGNNYSPLKVGLYTDLTNLERRFLMATIDVTEDTFESTVTGDGIVLVDAWASWCGPCRQFAPTYEKVSETHTDATFAKL
    DTEANQGLAAALQIQSIPTLMVFRDGIMVYREAGTMPAPALDDLVNQVKALDMDDVRRQVAEQQGSAEA

    >gi|145296982|ref|YP_001139803.1| hypothetical protein cgR_2881 [Corynebacterium glutamicum R]
    MATSKILLYYAFTPLSDPKAVQLWQRELCESLNLRGRILISTHGINGTVGGDIDDCKAYIKKTREYPGFNRMQFKWSEGG
    ADDFPKLSVKVRDEIVAFGAPDELKVDENGVVGGGVHLKPQQVNELVEARGDEVVFFDGRNAMEAQIGKFKDAVVPDVET
    THDFIAEIESGKYDDLKDKPVVTY
    CTGGIRCEILSSLMINRGFKEVYQIDGGIVRYGEQFGNKGLWEGSLYVFDKRMHME
    FGEDYKEVGHCIHCDTPTNKFEHCLNEDDCRELVLMCPDCFANVETRHCKRERCAAIAADFAEQGIDPLVTS

    >gi|145296992|ref|YP_001139813.1| hypothetical protein cgR_2891 [Corynebacterium glutamicum R]
    MHHLRYDSPIGELLLVASDQGLTYVAFSDENYAACTVGSTPGTNAVLEQAVSELKEYFAGKRKEFSTPLDWPSRNLLSFR
    GKVQEFLLSIPYGESKTYKQIAAELNNAGAVRAVGSACATNPLPIFAP
    CHRVLRTDGALGGYRGGLEAKQWLLKLEHP

    >gi|145297000|ref|YP_001139821.1| hypothetical protein cgR_2899 [Corynebacterium glutamicum R]
    MDTEFDLIVVGFGKAGKTIAMKRSAAGDKVALIEQSPQMYGGTCINVGCIPTKKLLFETATGKDFPDAVAARDQLIGKLN
    AKNLAMATDKGVTVIDGKATFTASHEITVTSGSDTLVLYAPTIVINTGSTPVIPNVPGTDNPHVFDSTGIQHISPLPKHL
    AIIGGGPIGLEFATLFSGQGSKVTIIDRGELPLKNFDREVAELAKTDLEARGITFLNNAELTGFSGDLTIALQDRDIDAD
    AALITIGRRPATDGLGLEQAGIKTGTRGEVLVDAHLRTNIDGIFAVGDVNGGPQFTYVSYDDHRIVLDQLAGPGEKSTEH
    RLIPTTTFIEPPLSTIGDNTEGENVVVKKALIADMPIVPRPKIINQPHGMVKFFVDKQSDALLGATLYCADSQELINTVA
    LAMRHGVTASELGDGIYTHPATSEIFNQLLGS

    >gi|145297084|ref|YP_001139905.1| hypothetical protein cgR_2980 [Corynebacterium glutamicum R]
    MSEEQSAVAPKIHDVAIIGSGPAGYTAAVYAARADLNPIMFEGYEYGGSLMTTTDVENFPGFEKGILGPELMENMRAQAE
    RFGTDMHMELVDRVDLTGDIKKLWVGDDEYHARAVILSMGSAPRYLGVKGEQELLGRGVSA
    CATCDGFFFRDQDIAVIGG
    GDSAMEEATFLTKFARSVTIVHRREEFRASAIMLERAQKNEKIRFVTNKTVEEVIEADGKVSGLKLNDTVTGEDSVLDVT
    AMFVAIGHDPRSEILAGQVEVDPSNYVLVQEPSTRTNLDGVFAAGDLVDSYYQQAITAAGSGCRAAIDAEHYLASLA

    >gi|145297085|ref|YP_001139906.1| hypothetical protein cgR_2981 [Corynebacterium glutamicum R]
    MSNVVAVTEQTFKSTVIDSDKPVIVDFWAEWCGPCKKLSPIIEEIAGEYGDKAVVASVDVDAERTLGAMFQIMSIPSVLI
    FKNGAKVEEFVGLRPKNEIVEKLEKHL