Corynebacterium glutamicum ATCC 13032 uid57905

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|19551268|ref|NP_599270.1| protein-disulfide isomerase [Corynebacterium glutamicum ATCC 13032]
    MVKENSVNQQSKKWLVPTLVVIIAVLLIAVVLLMYRGNASDTAEGVSAAATSDSAAASTAASGSASGAADSDLTSVEARD
    PSDPVAVGDVDAPVGLVVFSDYQ
    CPFCAKWSDETLPQMMKHVEDGNLRIEWREVNIFGEPSERGARAAYAAGLQDAYLEY
    HNALFANGEKPSEDLLSEEGLIKLAGDLGLDESKFTADFQSPETAVAIAQHQQLGIDLGAYSTPAFLLGGQPIMGAQPAS
    VFEAAFEQALAAKE

    >gi|23308767|ref|NP_599276.2| stress-induced protein [Corynebacterium glutamicum ATCC 13032]
    MAIESIAYTSEALSTGSGRLGHVRSTDGALEFEMTPPKALGGSGEGTNPEQLFAVGYAACFHSAMHSVARSRKITLEDTA
    VGARVSIGPNGAGGFEIAVELEVSIPQLPQAEAQELADAAHQV
    CPYSNATRGNISVTVSVIDEEA

    >gi|19551302|ref|NP_599304.1| Zn-dependent hydrolase [Corynebacterium glutamicum ATCC 13032]
    MLIERIYDEDLAQASYFIGCQAHNTAVVVDPRRDIAVYLDMAKKNGMEIVGVTETHIHADYLSGTRELAAATNATMYVSG
    EGGADWQYEFDAERICDGSEIRLGNLVLTAVHTPGHTPEHLSFLLKDGAFADEPGFMLTGDFVFAGDLGRPDLLDEAAGG
    VDTRFEGARQMFKSLKEKFLTLPDHIQIFPGHGSGSACGKALGSVPSTTLGYERQFAWWGKYLEADDEQGFIDELLEGQP
    DAPAYFGRMKRQNRQGPAIMGARELLPQLEASDLHDVIVVDTRSADEVHQGTVAGAVNIPAGNSMAKFGSWTVDPEKDSR
    ALVLLAASQIGAMEMWDHMVRVGIDNVAGFITNFDGVDLVAPQTVSPDQLDELEYDLLLDVRNRSEVEEGYIPGALHING
    ASVLWNLEKLPRDGKIVSY
    CKSGTRSSIAASTLRNAGFDVVELQGSYDNWVRHNAQ

    >gi|19551304|ref|NP_599306.1| rhodanese-related sulfurtransferase [Corynebacterium glutamicum ATCC 13032]
    MSITITETNKRRNLDQILDVRENFEIAEGIIPEAVHIPMGELNFRFKELDQNRPVIVVCRSGNRSTQVANALKQAGYTAY
    SMTGGMSAWYQNNLPIK

    >gi|19551305|ref|NP_599307.1| rhodanese-related sulfurtransferase [Corynebacterium glutamicum ATCC 13032]
    MTSAQPITSVDAQTLKSWIDKHEGLTVIDVRTAHEFSNLHIKGSYNVPLTTLAEHSEEISSRVGEHVVLVCQSGIRAGQA
    QQKLAPLGISTVAVLEGGINSFAKADGDVVRGTQVWDIERQVRFAAGSLVLAGLAGGKFLSPKVRTLSGIIGAGLTFSGV
    SNTCAMGKALSALPWNKTKPVPTETETLSKLPSPKEN

    >gi|19551459|ref|NP_599461.1| molybdopterin biosynthesis protein MoeB [Corynebacterium glutamicum ATCC 13032]
    MKNLDIARYRRQIMLGEIGQQKQQSLFDAKVSVIGAGGLGSPALLYLAGAGVGHIHIIDDDLVDLSNLHRQVIHTTAGVG
    TPKAESAREAMLALNPSVKVTVSVRRLDWSNALSELADSDVILDGSDNFDTRHLASWAAAKLGIPHVWASILGFDAQLSV
    FHAGHGPIYEDLFPTPPPPGSVPS
    CSQAGVLGPVVGVMGSAMAMEALKIITGVGTPLIGKLGYYSSLDGTWEYIPVVGSP
    EVLERVLGSAGVSGISGGFGEVLDVPRVSALVDGVSLIDVREPSEFSAYSIPGAHNTPLSAIREGAIPPSVSAGKEVIVY
    CAAGVRSAQAIAILESAGYTGMSSLDGGIEGWLDSLG

    >gi|19551544|ref|NP_599546.1| thiol-disulfide isomerase [Corynebacterium glutamicum ATCC 13032]
    MTSSAKWSIVGVVAILAVIVALIPQLVGGESAEEAQGETSTSKITTRPDCVASGAAGVDLPCLGGANGVGNELATVVNLW
    AWW
    CEPCRAELPIFDEFATTHPELNVIGVHADQNAANGAALLEDLGVNLASYQDDSNLFAGTLGLPGVVPITIVVSPDGN
    VVDTFPQPFETIDDLETAVAGALQNA

    >gi|19551612|ref|NP_599614.1| dihydrolipoamide dehydrogenase [Corynebacterium glutamicum ATCC 13032]
    MTEHYDVVVLGAGPGGYVSAIRAAQLGKKVAVIEKQYWGGVCLNVGCIPSKSLIKNAEVAHTFTHEKKTFGINGEVTFNY
    EDAHKRSRGVSDKIVGGVHYLMKKNKIIEIHGLGNFKDAKTLEVTDGKDAGKTITFDDCIIATGSVVNTLRGVDFSENVV
    SFEEQILNPVAPKKMVIVGAGAIGMEFAYVLGNYGVDVTVIEFMDRVLPNEDAEVSKVIAKAYKKMGVKLLPGHATTAVR
    DNGDFVEVDYQKKGSDKTETLTVDRVMVSVGFRPRVEGFGLENTGVKLTERGAIEIDDYMRTNVDGIYAIGDVTAKLQLA
    HVAEAQGIVAAETIAGAETQTLGDYMMMPRATFCNPQVSSFGYTEEQAKEKWPDREIKVASFPFSANGKAVGLAETDGFA
    KIVADAEFGELLGAHLVGANASELINELVLAQNWDLTTEEISRSVHIHPTLSEAVKEAAHGISGHMINF

    >gi|19551632|ref|NP_599634.1| cation transport ATPase [Corynebacterium glutamicum ATCC 13032]
    MAQTPAKIPAALNFIDVDLGVTGMTCTSCSARVERKLNKLDGVEATVNYATESAQVSYDPSKVSPEQLIKTVEDTGYGAF
    TMASAAAESEEDNAPADSGQSRIDAARDHEAADLKHRVIVSALLSVPVVLVSMIPALQFNNWQWAVLTLVTPIFFWGGSP
    FHKATWANLKHGSFTMDTLVSLGTSAAYLWSLWALFIGNAGHPGMKMEMHLLPSASTMDEIYLETVAVVITFLLLGRWFE
    TKAKGQSSEALRKLLDMGAKDAVVLRDGAEVRVPVNQLKLGDVFITRPGEKIATDGEVVEGSSAVDESMLTGESIPVEVT
    KGSKVTGATLNTSGRLMVKVTRIGADTTLSQMAKLVTDAQSKKAPVQRLVDQISQVFVPVVIVIAIATLIAHLVFTDAGL
    APAFTAAVAVLIIACPCALGLATPTALLVGTGRGAQLGLLIKGPEILESTKKVDTIVLDKTGTVTTGTMSVTDVTAINYS
    ETEILEFAAAVESASEHPIAQAIAKAAEHEQVTDFQNTAGQGVTGVVRGHEVRVGRPSSTLIDALLHPFQHAQKIGGTPV
    VVTIDGVDSGIITVRDTVKDTSAEAIRGLKELGLTPILLTGDNEGAAKSVAAEVGIDQVIANVLPHEKVQNVEALQAQGK
    NVAMVGDGVNDAAALAQADLGLAMGAGTDVAIEASDITLMNNDLRSAVDAIRLSRKTLGTIKGNLFWAFAYNVALIPVAA
    IGLLNPMLAGIAMAFSSVFVVSNSLRLRGFKARSN

    >gi|19551661|ref|NP_599663.1| hypothetical protein NCgl0401 [Corynebacterium glutamicum ATCC 13032]
    MGATMGHSVEIIVRDNCGSCVRVKAQILPIVEAAGIKLTERNVDQDASLKLEFGDRVPVILVDDEEFACWEVDNDELANA
    LL

    >gi|19551684|ref|NP_599686.1| thiol-disulfide isomerase or thioredoxin [Corynebacterium glutamicum ATCC 13032]
    MRLTKLAATIGCVTLSGLALVACSSDSTAGTDAVAVGGTFQFHSPDGKMEIFYDEADRQQLPDIGGDSLMEEGTQINLSD
    FENQVVILNAWGQW
    CAPCRSESDDLQIIHEELQAAGNGDTPGGTVLGINVRDYSRDIAQDFVTDNGLDYPSIYDPPFMTA
    ASLGGVPASVIPTTIVLDKQHRPAAVFLREVTSKDVLDVALPLVDEA

    >gi|19551923|ref|NP_599925.1| thioredoxin reductase [Corynebacterium glutamicum ATCC 13032]
    MSSHDLVDVVVVGAGAAGLAAAVALGRSLRSVIVIDAGQPRNSYAHAAHNVLGQEGIAPAELLEKGRAEARSYGVTIAPG
    RVAKVERTGSTFAITLDDASLLHSRRIILAHGAVDDLPEVEGLSDFWGTKVLH
    CAYCHGFEARDSEIVVVGTSPMAAHQA
    LMFSQLSKTVSLVGTIDIDEQTSESLDSAGVKVLGTNAVRVSAEGDGLSVELSEGDHLSCDNIVVASRPLVDGTLYTQLG
    GQMEENPMGRFIPGTQTGRTPIEGVWAAGNAQAPMAMVYGSAAQGVMAGAEINFDLILEDISVASAQS

    >gi|19551931|ref|NP_599933.1| thiosulfate sulfurtransferase [Corynebacterium glutamicum ATCC 13032]
    MAAPFDPFPAFEEYAHPERIVSASWLSARLGSPGLKVVESNEDSLLYDIGHLPGAVRIDWAKDLNDPLTRDFIDGEAFAE
    LMNRKGIARDDTVVVYGDKSNWWAAFTLWVFELFGHSDVRLLNGGRDAWMAEERDTSYVVPEYPSANYPVVERVDENQRA
    FVAEVLGSLTQSGGMTLVDVRTPSEFSGLDEHGNPTSNTGVLRGGHIPGAINLDWSDAVLPNGNFRTRAELDKLYADLNP
    ADDTVVY
    CQVGDRAAHTWFVLKYLLGFNNVRNYDGSWAEWGNMVRMPIETGENTKNNVSVS

    >gi|19552069|ref|NP_600071.1| hypothetical protein NCgl0808 [Corynebacterium glutamicum ATCC 13032]
    MSNVTIYATDWCPYCRSLLKGLDGQEYDLIDVDQDEEAGEWVKSVNDGNRIVPTVRYSDGTHATNPLAAEVIAKIEALA

    >gi|19552140|ref|NP_600142.1| hypothetical protein NCgl0877 [Corynebacterium glutamicum ATCC 13032]
    MSSLDNAPLLELDVQEWVNHEGLSNEDLRGKVVVVEVFQMLCPGCVNHGVPQAQKIHRMIDESQVQVIGLHSVFEHHDVM
    TPEALKVFIDEFGIKFPVAVDMPREGQRIPSTMKKYRLEGTPSIILADRKGRIRQVQFGQVDDFVLGLLLGSLLSETDET


    >gi|19552312|ref|NP_600314.1| peroxiredoxin [Corynebacterium glutamicum ATCC 13032]
    MGSMAKTHFQGNETATSGELPQVGDNLAEFNLVNTELGEVSSKDFQGRKLVLNIFPSVDTGVCATSVRKFNEAAASLENT
    TVLCISKDLPFALGRFCSAEGIENVTPVSAFRSTFGEDNGIVLEGSPLKGLLARSVIVVDENGKVAYTQLVDEISTEPDY
    DAALAALN

    >gi|19552320|ref|NP_600322.1| arsenate reductase [Corynebacterium glutamicum ATCC 13032]
    MKVTIFHNPRCSTSRNTLAYLRDKDIEPEIVQYLKDTPTASELKELFNTLGIPVHDGIRTREAEYTELGLSPETPETELI
    DAIVAHPRLLQRPIVVTAKGARIARPKIDVIDSIL

    >gi|19552399|ref|NP_600401.1| copper chaperone [Corynebacterium glutamicum ATCC 13032]
    MTAPNTLKQTTLRSDEFSCPSCVSKIENKLNGLDGVDNAEVKFSSGRILVDHDPSKVSIKDLVAAVAEVGYTAKPSAI

    >gi|19552529|ref|NP_600531.1| Zn-dependent hydrolase [Corynebacterium glutamicum ATCC 13032]
    MLFERIYEEGLAQASYFIGCQREGKAIVVDARRDIQTYLDLAAKNNMVISAVTETHIHADYLSGTRELAAATGAEIFLSG
    EGGADWQYGFTGTTLMHNSTIKLGNITITAKHTPGHTPEHLSFLITDGAVSKDPGFMLSGDFVFVGDVGRPDLLDEAAGG
    VDTRFAGAQQLFHSLKEQFLALPDHIQVYPGHGAGSPCGKALGAIPSTTVGYEKANAWWAPYLRSDDEAGFVEELLDGQP
    DAHAYFARMKKQNKQGPAVLSTLSPLVKLEAEEVVEKLGSEAVFVDTREQNQVHLGTVVGALNIPRGAKASNFAAWVIDP
    QKDAQDLIVLAPDANTAADFRDALLRVGIDTVRYFTNSIDGLPTFVPELISPAELAETNYDALIDIRAKSEFAAGSIPGA
    QQLSGGSAMWRLNELPAGGTLVTF
    CQSGARNTVVANALRRAGFTVIELEGSYAAWEKSAANPKNLQTAV

    >gi|19552640|ref|NP_600642.1| rhodanese-related sulfurtransferase [Corynebacterium glutamicum ATCC 13032]
    MTSLKVTSSADATNNNDAHFPEGPVVTVDWLSHNLDRDDVIVLCATMEDDEIARQAGIPGAFLADLEGDFSDPHSELPHT
    APPNLVGLLESYGISTDSTVVVYDLHGLMVAPRVWWLLRVAGLSSIGVLDGGLPAWVDAGLPTEPLSLPTSGGRISAEPQ
    PDLLVGASGVERAIARSSKAVIDARNASRFAGVEEEPRPGLRKGSIPGSVNIPFTDISDEHGFVRPAEELKELIFSRTNG
    AQSLVFS
    CGSGVTACVDAYAAVIAGYDDVVVYEGSWAEWGNPANQKPIA

    >gi|19553102|ref|NP_601104.1| hypothetical protein NCgl1823 [Corynebacterium glutamicum ATCC 13032]
    MTDFKLISDTEWRERLTPQEFHVLREAGTEPPHVGEYTNTTTEGVYSCRACGEELFRSTEKFESHCGWPSFFSPLAGDKI
    IEKEDLSLGMRRVEILCANCGSHMGHVFEGEGYDTPTDLRY
    CINSISLKLEEKPVS

    >gi|19553207|ref|NP_601209.1| mycothione/glutathione reductase [Corynebacterium glutamicum ATCC 13032]
    MSEQPASIKHYDLIIIGTGSGNSIPGPEFDDKSIAIVEKGAFGGTCLNVGCIPTKMYVYAADIAQEIQESARLGIDATVN
    SVDWPSIVSRVFDKRIDLIAQGGEAYRRGPETPNIDVYDMHASFVDSKTISTGIAGQEQLISGTDIVIATGSRPYIPEAI
    AESGARYYTNEDIMRLAQQPESLVIVGGGFIALEFAHVFEALGTKVTILNRSDVLLREADADISAKILELSKKRFDVRLS
    TAVTAVHNKADGGVKISTDTGDDIEADILLVATGRTPNGNQMNLDAAGIEMNGRSIKVDEFGRTSVEGVWALGDVSSPYK
    LKHVANAEMRAIKHNLANPNDLQKMPHDFVPSAVFTNPQISQVGMTEQEAREAGLDITVKIQNYSDVAYGWAMEDKDGFV
    KLIADKDTGKLVGAHIIGAQASTLIQQLITVMAFGIDAREAATKQYWIHPALPEVIENALLGLEF

    >gi|19553244|ref|NP_601246.1| thiamine biosynthesis protein ThiF [Corynebacterium glutamicum ATCC 13032]
    MAQLPTSELHRTARQLALPGYGIEQQERLFNAHVLVIGAGGLGCPVMQSLASAGVGTITVIDDDTVDISNIHRQILFGAS
    DVGRPKVEVAAERLKELQPDITVNALHERITPENACELLNSVDLVLDGSDSFSTKYLVSDAAEITGTPLIWATVLRFHGE
    LALFNSGPDHRGVGLRDVFPEQPSADFVPD
    CATAGVLGATTATIGALMATHAIGFLTEIGDVQPGTILSYDAFPAATRSF
    RVSADPARPLVTRLRASYEAARTDTTSLIDATLNGSLTALDIREPHEVLLKDLPEGATSLKLPLSQITSDSDILEALSGI
    DGDILVY
    CASGIRSSDFIDNYSHLGHKFVNLPGGVNAL

    >gi|19553399|ref|NP_601401.1| hypothetical protein NCgl2117 [Corynebacterium glutamicum ATCC 13032]
    MTAPSTNTGVILTESAASKAKALIDQEGRDDLSLRIAVQPGGCSGLRYQLYFDDRTLDGDKEDIVGGVRLVVDKMSTPYL
    LGAQIDFADTIEQQGFTIDNPNAGSSCACGDSFN

    >gi|19553621|ref|NP_601623.1| hypothetical protein NCgl2339 [Corynebacterium glutamicum ATCC 13032]
    MAQKVTFWFDTTCPFCWVTSRWIKEVEQVRDIEIQWVPMSLAVLNEGRDLPEDYKERMKAAWGPARVFAAVATDHADKLG
    DLYTAMGTRIHNDGRGPIEGSFNDVIAEALEEVGLDAALGEVADTTEWDDALRAFHQTAMDEVGNDVGTPVVKLGDTAFF
    GPVLTRIPRGEEAGEIFDASFKLASYPHFFEIKRSRTENPQFD

    >gi|19553631|ref|NP_601633.1| hypothetical protein NCgl2349 [Corynebacterium glutamicum ATCC 13032]
    MSDLIDMLVGEDLPQLRDNRPQARDNAQKSFEALLEPVNPGTFSFGERYAVATYVAGLHQFAPAVDLYQDLLLDDAPTTL
    ANAVSDAIDEGLSAGPYGTYREPGLESESEPGGSVRNDAAKLGERLAAAFDYAHLLVFHPRDSRPEVLGRLSGAGWSADD
    TVTLAQLVSFLAFQLRVAYGLRTLKGEDIQVKAPRLSIPEAKWELSNNGFEISTYEELNRPEAFVNHSLGWKPWVPPVAK
    ADLTEEQLDSLIQPERADMPYFRLLARDPAALKARTLTDLDIFFNTDGEGLGRAERELGATVTSRYNGCVY
    CASVHAGRA
    QEESGRADDVNALLASIDSDLGSDQWNVIRDAARALSSTPAAFNQGCITKLRGVGFSDLQIVDLINSVAFFNWANRLMLS
    LGEPEVPKRFL

    >gi|19553688|ref|NP_601690.1| bacterioferritin comigratory protein [Corynebacterium glutamicum ATCC 13032]
    MTEVKRLDVGDTPPAFSLPNDSGSTTSLSDFAGKQVLVYFYPKANTPGCTKEACDFRDSLSNLNDLDIAVVGISPDPVDK
    LVKFREDHELNFPLLSDEDKSVMTAWGAFGEKKNYGKIVQGVIRSTFLINADGTVGMAKYNVRATGHVERIVREITAA

    >gi|19553730|ref|NP_601732.1| glutaredoxin-like protein [Corynebacterium glutamicum ATCC 13032]
    MAITVYTKPACVQCNATKKALDRAGLEYDLVDISLDEEAREYVLALGYLQAPVVVADGSHWSGFRPERIREMATAAA

    >gi|19553763|ref|NP_601765.1| dithiol-disulfide isomerase [Corynebacterium glutamicum ATCC 13032]
    MSIEFSAPAKMKIEVWSDIMCPFCYIGKKRLDDALSTFDQAGRIEVEYKSFELMPGLETHPLRSDVEYLADAKGMSLEQA
    RQMNGQVQAMAQATGLEMNPDETIAANTINAHRLTHFAKAHGKQQEVAQELFKAHFVDGKNVDDLDVLVSIAAEVGLDAS
    AAREALESDVYTNEVQQDVHEARQLGVQGVPFFVFDRKYAINGAQQEEVFTGTVEKAFEEWAAENPVSPFEVIDGQSCSV
    DGTCN

    >gi|19553787|ref|NP_601789.1| glutathione peroxidase [Corynebacterium glutamicum ATCC 13032]
    MTSIHDISVTLNDGTETTMADWAGHLLLIVNVASKCGLTPQYEGLQKLYEEYQDRGFFVIGVPCNQFNGQEPGTDAEVCA
    FAQNQYDVTFPLLSKTEVNGEGAHPLYKVLKEATDGSEIEWNFEKFLVDAEGNTIKRFAPRTEPSAAEVVEAIEENLPI

    >gi|19553903|ref|NP_601905.1| rhodanese-related sulfurtransferase [Corynebacterium glutamicum ATCC 13032]
    MKEVAVNEVPAGAQLIDVRETDEYAEVRAQGAVNIPMSEFVGRIDEIDLDRDIYVICKLGGRSAQVAEYLEQRGIEAINV
    NGGTDGWVAAGLPTEA

    >gi|19554092|ref|NP_602094.1| hypothetical protein NCgl2804 [Corynebacterium glutamicum ATCC 13032]
    MSYHDHSDIEYLKKIGANSPDAFKAFVHFDEAALRGPNKKIPRNYTEMIALAVAFTTQCAYCIDIHTAAAKKEGVTTEEL
    AEVALIAAALRAGGAMTHGALAMKLYDEN

    >gi|19554111|ref|NP_602113.1| methionine sulfoxide reductase A [Corynebacterium glutamicum ATCC 13032]
    MAWFFAPEPVMVTADEALKGGRHPVLENPAPHTVLGTPVTGPWKEGQQRIWIGLGCFWGVEQMYWQMDGVEGTSVGYAGG
    FTPNPTYREVCSGRTGHTEIVEVVYDPSKISLEQLVARGLEAHDPTQGFRQGNDVGTQYRSAYYTENEEDAARVKAVVDA
    YGETLKQHGFGEITTEIGVISPSDYFLAEDYHQQYLDKNPDGYCPHHSTGIPCGVEA

    >gi|19554151|ref|NP_602153.1| hypothetical protein NCgl2860 [Corynebacterium glutamicum ATCC 13032]
    MAAATDATPEGPTTYQVTGMTCGHCADNVTEAVSALPQVDDVQVDLIAGGVSIVTVTGSVPLETVHRAIEETGYTVLS

    >gi|19554157|ref|NP_602159.1| hypothetical protein NCgl2866 [Corynebacterium glutamicum ATCC 13032]
    MEEGEEISLSDFEGEVVVLNAWGQWCAPCRAEVDDLQLVQETLDPLGGTVLGINVRDYNQTIAQDFKLDNAVTYPSIYDP
    PFRIAAALGGVPTSVIPTTIVLDRSHRPAAVFLREVTALSG

    >gi|19554161|ref|NP_602163.1| copper chaperone [Corynebacterium glutamicum ATCC 13032]
    MTAPATLKNTTLRSDEFTCPSCVAKIENKLNGLDGVENAEVKFSSGRILITHDPQKVSVRDLVTAVAEVGYTAKPSAI

    >gi|19554167|ref|NP_602169.1| thioredoxin [Corynebacterium glutamicum ATCC 13032]
    MATIDVTEETFESTVTGDGIVLVDAWASWCGPCRQFAPTYEKVSETHTDATFAKLDTEANQGLAAALQIQSIPTLMVFRD
    GIMVYREAGTMPAPALDDLVNQVKALDMDDVRRQVAEQQGSAEA

    >gi|19554186|ref|NP_602188.1| hypothetical protein NCgl2890 [Corynebacterium glutamicum ATCC 13032]
    MATSKILLYYAFTPLSDPKAVQLWQRELCESLNLRGRILISTHGINGTVGGDIDDCKAYIKKTREYPGFNRMQFKWSEGG
    AEDFPKLSVKVRDEIVAFGAPDELKVDENGVVGGGVHLKPQQVNELVEARGDEVVFFDGRNAMEAQIGKFKDAVVPDVET
    THDFIAEIESGKYDDLKDKPVVTY
    CTGGIRCEILSSLMINRGFKEVYQIDGGIVRYGEQFGNKGLWEGSLYVFDKRMHME
    FGEDYKEVGHCIHCDTPTNKFEHCLNEDDCRELVLMCPDCFANVETRHCKRERCAAIAADFAEQGIDPLVTS

    >gi|19554197|ref|NP_602199.1| methylated DNA-protein cysteine methyltransferase [Corynebacterium glutamicum ATCC 13032]
    MHHLRYESPIGELLLVASDQGLTYVAFSDENYAACTVGSTPGTNAVLEQAVAELEEYFAGKRKEFSTPLDWPSQNLLSFR
    GKVQEFLLSIPYGESKTYKQIAAELNNVGAVRAVGSACATNPLPIFAP
    CHRVLRTDGALGGYRGGLEAKQWLLELERP

    >gi|19554204|ref|NP_602206.1| putative mercuric reductase [Corynebacterium glutamicum ATCC 13032]
    MDTKLGAELGTEFDLIVVGFGKAGKTIAMKRSAAGDKVALIEQSPQMYGGTCINVGCIPTKKLLFETATGKDFPDAVVAR
    DQLIGKLNAKNLAMATDKGVTVIDGKATFTASHEITVTSGSDTLVLYAPTIVINTGSTPVIPNVPGTDNPHVFDSTGIQH
    ISPLPKHLAIIGGGPIGLEFATLFSGQGSKVTIIDRGELPLKNFDREVAELAKTDLEARGITFLNNAELTGFSGDLTIAL
    KDHDLLADAALLAIGRRPATDGLGLEQAGIKTGTRGEVLVDAHLRTNIDGIFAVGDVNGGPQFTYVSYDDHRIVLDQLAG
    TGKKSTAHRLIPTTTFIEPPLSTIGDNTEGENVVVKKALIADMPIVPRPEIINQPHGMVKFFVDKQSDALLGATLYCADS
    QELINTVALAMRHGVTASELGDGIYTHPATSEIFNQLLGS

    >gi|19554262|ref|NP_602264.1| putative metal associated protein [Corynebacterium glutamicum ATCC 13032]
    MALKNYTVEGMTCAHCVASVTEEVSEVNGVSAVDVTLESGNVAVSGEGFSDAEIQAAVEEAGYKIVAS

    >gi|19554280|ref|NP_602282.1| thioredoxin reductase [Corynebacterium glutamicum ATCC 13032]
    MSEEQSAVAPKIHDVAIIGSGPAGYTAAVYAARADLNPIMFEGYEYGGSLMTTTDVENFPGFEKGILGPELMENMRAQAE
    RFGTDMHMELVDRVDLTGDIKKLWVGDDEYHARAVILSMGSAPRYLGVKGEQELLGRGVSA
    CATCDGFFFRDQDIAVIGG
    GDSAMEEATFLTKFARSVTIVHRREEFRASAIMLERAQKNEKIRFVTNKTVEEVIEADGKVSGLKLNDTVTGEDSVLDVT
    AMFVAIGHDPRSEILAGQVEVDPSNYVLVQEPSTRTNLDGVFAAGDLVDSHYQQAITAAGSGCRAAIDAEHYLASLA

    >gi|19554281|ref|NP_602283.1| thioredoxin [Corynebacterium glutamicum ATCC 13032]
    MSNVVAVTEQTFKSTVIDSDKPVIVDFWAEWCGPCKKLSPIIEEIAGEYGDKAVVASVDVDAERTLGAMFQIMSIPSVLI
    FKNGAKVEEFVGLRPKNEIVEKLEKHL