Corynebacterium glutamicum ATCC 13032 Bielefeld

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|62388911|ref|YP_224313.1| HCCA isomerase, secreted protein [Corynebacterium glutamicum ATCC 13032]
    MNQQSKKWLVPTLVVIIAVLLIAVVLLMYRGNASDTAEGVSAAATSDSAAASTAASGSASGAADSDLTSVEARDPSDPVA
    VGDVDAPVGLVVFSDYQ
    CPFCAKWSDETLPQMMKHVEDGNLRIEWREVNIFGEPSERGARAAYAAGLQDAYLEYHNALFA
    NGEKPSEDLLSEEGLIKLAGDLGLDESKFTADFQSPETAVAIAQHQQLGIDLGAYSTPAFLLGGQPIMGAQPASVFEAAF
    EQALAAKE

    >gi|62388919|ref|YP_224321.1| organic hydroperoxide resistance protein [Corynebacterium glutamicum ATCC 13032]
    MHNGKLLTDELVVASVFFVFSHDRNTAMAIESIAYTSEALSTGSGRLGHVRSTDGALEFEMTPPKALGGSGEGTNPEQLF
    AVGYAACFHSAMHSVARSRKITLEDTAVGARVSIGPNGAGGFEIAVELEVSIPQLPQAEAQELADAAHQV
    CPYSNATRGN
    ISVTVSVIDEEA

    >gi|62388947|ref|YP_224349.1| metallo-beta-lactamase superfamily protein [Corynebacterium glutamicum ATCC 13032]
    MLIERIYDEDLAQASYFIGCQAHNTAVVVDPRRDIAVYLDMAKKNGMEIVGVTETHIHADYLSGTRELAAATNATMYVSG
    EGGADWQYEFDAERICDGSEIRLGNLVLTAVHTPGHTPEHLSFLLKDGAFADEPGFMLTGDFVFAGDLGRPDLLDEAAGG
    VDTRFEGARQMFKSLKEKFLTLPDHIQIFPGHGSGSACGKALGSVPSTTLGYERQFAWWGKYLEADDEQGFIDELLEGQP
    DAPAYFGRMKRQNRQGPAIMGARELLPQLEASDLHDVIVVDTRSADEVHQGTVAGAVNIPAGNSMAKFGSWTVDPEKDSR
    ALVLLAASQIGAMEMWDHMVRVGIDNVAGFITNFDGVDLVAPQTVSPDQLDELEYDLLLDVRNRSEVEEGYIPGALHING
    ASVLWNLEKLPRDGKIVSY
    CKSGTRSSIAASTLRNAGFDVVELQGSYDNWVRHNAQ

    >gi|62388949|ref|YP_224351.1| sulfurtransferase [Corynebacterium glutamicum ATCC 13032]
    MSITITETNKRRNLDQILDVRENFEIAEGIIPEAVHIPMGELNFRFKELDQNRPVIVVCRSGNRSTQVANALKQAGYTAY
    SMTGGMSAWYQNNLPIK

    >gi|62388950|ref|YP_224352.1| sulfurtransferase [Corynebacterium glutamicum ATCC 13032]
    MTSAQPITSVDAQTLKSWIDKHEGLTVIDVRTAHEFSNLHIKGSYNVPLTTLAEHSEEISSRVGEHVVLVCQSGIRAGQA
    QQKLAPLGISTVAVLEGGINSFAKADGDVVRGTQVWDIERQVRFAAGSLVLAGLAGGKFLSPKVRTLSGIIGAGLTFSGV
    SNTCAMGKALSALPWNKTKPVPTETETLSKLPSPKEN

    >gi|62389106|ref|YP_224508.1| molybdopterin biosynthesis protein MoeB [Corynebacterium glutamicum ATCC 13032]
    MKNLDIARYRRQIMLGEIGQQKQQSLFDAKVSVIGAGGLGSPALLYLAGAGVGHIHIIDDDLVDLSNLHRQVIHTTAGVG
    TPKAESAREAMLALNPSVKVTVSVRRLDWSNALSELADSDVILDGSDNFDTRHLASWAAAKLGIPHVWASILGFDAQLSV
    FHAGHGPIYEDLFPTPPPPGSVPS
    CSQAGVLGPVVGVMGSAMAMEALKIITGVGTPLIGKLGYYSSLDGTWEYIPVVGSP
    EVLERVLGSAGVSGISGGFGEVLDVPRVSALVDGVSLIDVREPSEFSAYSIPGAHNTPLSAIREGAIPPSVSAGKEVIVY
    CAAGVRSAQAIAILESAGYTGMSSLDGGIEGWLDSLG

    >gi|62389191|ref|YP_224593.1| thioredoxin-related protein, secreted [Corynebacterium glutamicum ATCC 13032]
    MTSSAKWSIVGVVAILAVIVALIPQLVGGESAEEAQGETSTSKITTRPDCVASGAAGVDLPCLGGANGVGNELATVVNLW
    AWW
    CEPCRAELPIFDEFATTHPELNVIGVHADQNAANGAALLEDLGVNLASYQDDSNLFAGTLGLPGVVPITIVVSPDGN
    VVDTFPQPFETIDDLETAVAGALQNA

    >gi|62389264|ref|YP_224666.1| dihydrolipoamide dehydrogenase [Corynebacterium glutamicum ATCC 13032]
    MTEHYDVVVLGAGPGGYVSAIRAAQLGKKVAVIEKQYWGGVCLNVGCIPSKSLIKNAEVAHTFTHEKKTFGINGEVTFNY
    EDAHKRSRGVSDKIVGGVHYLMKKNKIIEIHGLGNFKDAKTLEVTDGKDAGKTITFDDCIIATGSVVNTLRGVDFSENVV
    SFEEQILNPVAPKKMVIVGAGAIGMEFAYVLGNYGVDVTVIEFMDRVLPNEDAEVSKVIAKAYKKMGVKLLPGHATTAVR
    DNGDFVEVDYQKKGSDKTETLTVDRVMVSVGFRPRVEGFGLENTGVKLTERGAIEIDDYMRTNVDGIYAIGDVTAKLQLA
    HVAEAQGIVAAETIAGAETQTLGDYMMMPRATFCNPQVSSFGYTEEQAKEKWPDREIKVASFPFSANGKAVGLAETDGFA
    KIVADAEFGELLGAHLVGANASELINELVLAQNWDLTTEEISRSVHIHPTLSEAVKEAAHGISGHMINF

    >gi|62389285|ref|YP_224687.1| copper-transporting ATPase [Corynebacterium glutamicum ATCC 13032]
    MAQTPAKIPAALNFIDVDLGVTGMTCTSCSARVERKLNKLDGVEATVNYATESAQVSYDPSKVSPEQLIKTVEDTGYGAF
    TMASAAAESEEDNAPADSGQSRIDAARDHEAADLKHRVIVSALLSVPVVLVSMIPALQFNNWQWAVLTLVTPIFFWGGSP
    FHKATWANLKHGSFTMDTLVSLGTSAAYLWSLWALFIGNAGHPGMKMEMHLLPSASTMDEIYLETVAVVITFLLLGRWFE
    TKAKGQSSEALRKLLDMGAKDAVVLRAGAEVRVPVNQLKLGDVFITRPGEKIATDGEVVEGSSAVDESMLTGESIPVEVT
    KGSKVTGATLNTSGRLMVKVTRIGADTTLSQMAKLVTDAQSKKAPVQRLVDQISQVFVPVVIVIAIATLIAHLVFTDAGL
    APAFTAAVAVLIIACPCALGLATPTALLVGTGRGAQLGLLIKGPEILESTKKVDTIVLDKTGTVTTGTMSVTDVTAINYS
    ETEILEFAAAVESASEHPIAQAIAKAAEHEQVTDFQNTAGQGVTGVVRGHEVRVGRPSSTLIDALLHPFQHAQKIGGTPV
    VVTIDGVDSGIITVRDTVKDTSAEAIRGLKELGLTPILLTGDNEGAAKSVAAEVGIDQVIANVLPHEKVQNVEALQAQGK
    NVAMVGDGVNDAAALAQADLGLAMGAGTDVAIEASDITLMNNDLRSAVDAIRLSRKTLGTIKGNLFWAFAYNVALIPVAA
    IGLLNPMLAGIAMAFSSVFVVSNSLRLRGFKARSN

    >gi|62389316|ref|YP_224718.1| hypothetical protein cg0496 [Corynebacterium glutamicum ATCC 13032]
    MGHSVEIIVRDNCGSCVRVKAQILPIVEAAGIKLTERNVDQDASLKLEFGDRVPVILVDDEEFACWEVDNDELANALL

    >gi|62389339|ref|YP_224741.1| secreted thiol-disulfide isomerase or thioredoxin [Corynebacterium glutamicum ATCC 13032]
    MRLTKLAATIGCVTLSGLALVACSSDSTAGTDAVAVGGTFQFHSPDGKMEIFYDEADRQQLPDIGGDSLMEEGTQINLSD
    FENQVVILNAWGQW
    CAPCRSESDDLQIIHEELQAAGNGDTPGGTVLGINVRDYSRDIAQDFVTDNGLDYPSIYDPPFMTA
    ASLGGVPASVIPTTIVLDKQHRPAAVFLREVTSKDVLDVALPLVDEA

    >gi|62389582|ref|YP_224984.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Corynebacterium glutamicum ATCC 13032]
    MSSHDLVDVVVVGAGAAGLAAAVALGRSLRSVIVIDAGQPRNSYAHAAHNVLGQEGIAPAELLEKGRAEARSYGVTIAPG
    RVAKVERTGSTFAITLDDASLLHSRRIILAHGAVDDLPEVEGLSDFWGTKVLH
    CAYCHGFEARDSEIVVVGTSPMAAHQA
    LMFSQLSKTVSLVGTIDIDEQTSESLDSAGVKVLGTNAVRVSAEGDGLSVELSEGDHLSCDNIVVASRPLVDGTLYTQLG
    GQMEENPMGRFIPGTQTGRTPIEGVWAAGNAQAPMAMVYGSAAQGVMAGAEINFDLILEDISVASAQS

    >gi|62389590|ref|YP_224992.1| thiosulfate sulfurtransferase [Corynebacterium glutamicum ATCC 13032]
    MAAPFDPFPAFEEYAHPERIVSASWLSARLGSPGLKVVESNEDSLLYDIGHLPGAVRIDWAKDLNDPLTRDFIDGEAFAE
    LMNRKGIARDDTVVVYGDKSNWWAAFTLWVFELFGHSDVRLLNGGRDAWMAEERDTSYVVPEYPSANYPVVERVDENQRA
    FVAEVLGSLTQSGGMTLVDVRTPSEFSGLDEHGNPTSNTGVLRGGHIPGAINLDWSDAVLPNGNFRTRAELDKLYADLNP
    ADDTVVY
    CQVGDRAAHTWFVLKYLLGFNNVRNYDGSWAEWGNMVRMPIETGENTKNNVSVS

    >gi|62389732|ref|YP_225134.1| hypothetical protein cg0964 [Corynebacterium glutamicum ATCC 13032]
    MSNVTIYATDWCPYCRSLLKGLDGQEYDLIDVDQDEEAGEWVKSVNDGNRIVPTVRYSDGTHATNPLAAEVIAKIEALA

    >gi|62389804|ref|YP_225206.1| hypothetical protein cg1043 [Corynebacterium glutamicum ATCC 13032]
    MSSLDNAPLLELDVQEWVNHEGLSNEDLRGKVVVVEVFQMLCPGCVNHGVPQAQKIHRMIDESQVQVIGLHSVFEHHDVM
    TPEALKVFIDEFGIKFPVAVDMPREGQRIPSTMKKYRLEGTPSIILADRKGRIRQVQFGQVDDFVLGLLLGSLLSETDET


    >gi|62389975|ref|YP_225377.1| thiol peroxidase [Corynebacterium glutamicum ATCC 13032]
    MGSMAKTHFQGNETATSGELPQVGDNLAEFNLVNTELGEVSSKDFQGRKLVLNIFPSVDTGVCATSVRKFNEAAASLENT
    TVLCISKDLPFALGRFCSAEGIENVTPVSAFRSTFGEDNGIVLEGSPLKGLLARSVIVVDENGKVAYTQLVDEISTEPDY
    DAALAALN

    >gi|62389984|ref|YP_225386.1| arsenate reductase [Corynebacterium glutamicum ATCC 13032]
    MKVTIFHNPRCSTSRNTLAYLRDKDIEPEIVQYLKDTPTASELKELFNTLGIPVHDGIRTREAEYTELGLSPETPETELI
    DAIVAHPRLLQRPIVVTAKGARIARPKIDVIDSIL

    >gi|62390063|ref|YP_225465.1| putative copper chaperone [Corynebacterium glutamicum ATCC 13032]
    MTAPNTLKQTTLRSDEFSCPSCVSKIENKLNGLDGVDNAEVKFSSGRILVDHDPSKVSIKDLVAAVAEVGYTAKPSAI

    >gi|62390193|ref|YP_225595.1| Zn-dependent hydrolase, including glyoxylases [Corynebacterium glutamicum ATCC 13032]
    MLFERIYEEGLAQASYFIGCQREGKAIVVDARRDIQTYLDLAAKNNMVISAVTETHIHADYLSGTRELAAATGAEIFLSG
    EGGADWQYGFTGTTLMHNSTIKLGNITITAKHTPGHTPEHLSFLITDGAVSKDPGFMLSGDFVFVGDVGRPDLLDEAAGG
    VDTRFAGAQQLFHSLKEQFLALPDHIQVYPGHGAGSPCGKALGAIPSTTVGYEKANAWWAPYLRSDDEAGFVEELLDGQP
    DAHAYFARMKKQNKQGPAVLSTLSPLVKLEAEEVVEKLGSEAVFVDTREQNQVHLGTVVGALNIPRGAKASNFAAWVIDP
    QKDAQDLIVLAPDANTAADFRDALLRVGIDTVRYFTNSIDGLPTFVPELISPAELAETNYDALIDIRAKSEFAAGSIPGA
    QQLSGGSAMWRLNELPAGGTLVTF
    CQSGARNTVVANALRRAGFTVIELEGSYAAWEKSAANPKNLQTAV

    >gi|62390308|ref|YP_225710.1| rhodanese-related sulfurtransferase [Corynebacterium glutamicum ATCC 13032]
    MTSLKVTSSADATNNNDAHFPEGPVVTVDWLSHNLDRDDVIVLCATMEDDEIARQAGIPGAFLADLEGDFSDPHSELPHT
    APPNLVGLLESYGISTDSTVVVYDLHGLMVAPRVWWLLRVAGLSSIGVLDGGLPAWVDAGLPTEPLSLPTSGGRISAEPQ
    PDLLVGASGVERAIARSSKAVIDARNASRFAGVEEEPRPGLRKGSIPGSVNIPFTDISDEHGFVRPAEELKELIFSRTNG
    AQSLVFS
    CGSGVTACVDAYAAVIAGYDDVVVYEGSWAEWGNPANQKPIA

    >gi|62390645|ref|YP_226047.1| hypothetical protein cg1986 [Corynebacterium glutamicum ATCC 13032]
    MLGRAPHSLFFPIGFYYTPMTSITTTDTPLYTALPHTRISDAELLTPTTTVHEILVYGPAECPGCTATLDFFARKNMPAT
    KVTVAAGDVAHTYITQDLGYLQAPIVTVRISSSASNHDNEHNTQILHWSGVNRYLMQALSRTHF

    >gi|62390737|ref|YP_226139.1| hypothetical protein cg2078 [Corynebacterium glutamicum ATCC 13032]
    MTDFKLISDTEWRERLTPQEFHVLREAGTEPPHVGEYTNTTTEGVYSCRACGEELFRSTEKFESHCGWPSFFSPLAGDKI
    IEKEDLSLGMRRVEILCANCGSHMGHVFEGEGYDTPTDLRY
    CINSISLKLEEKPVS

    >gi|62390843|ref|YP_226245.1| mycothione/glutathione reductase [Corynebacterium glutamicum ATCC 13032]
    MSEQPASIKHYDLIIIGTGSGNSIPGPEFDDKSIAIVEKGAFGGTCLNVGCIPTKMYVYAADIAQEIQESARLGIDATVN
    SVDWPSIVSRVFDKRIDLIAQGGEAYRRGPETPNIDVYDMHASFVDSKTISTGIAGQEQLISGTDIVIATGSRPYIPEAI
    AESGARYYTNEDIMRLAQQPESLVIVGGGFIALEFAHVFEALGTKVTILNRSDVLLREADADISAKILELSKKRFDVRLS
    TAVTAVHNKADGGVKISTDTGDDIEADILLVATGRTPNGNQMNLDAAGIEMNGRSIKVDEFGRTSVEGVWALGDVSSPYK
    LKHVANAEMRAIKHNLANPNDLQKMPHDFVPSAVFTNPQISQVGMTEQEAREAGLDITVKIQNYSDVAYGWAMEDKDGFV
    KLIADKDTGKLVGAHIIGAQASTLIQQLITVMAFGIDAREAATKQYWIHPALPEVIENALLGLEF

    >gi|62390880|ref|YP_226282.1| thiamine biosynthesis protein ThiF [Corynebacterium glutamicum ATCC 13032]
    MAQLPTSELHRTARQLALPGYGIEQQERLFNAHVLVIGAGGLGCPVMQSLASAGVGTITVIDDDTVDISNIHRQILFGAS
    DVGRPKVEVAAERLKELQPDITVNALHERITPENACELLNSVDLVLDGSDSFSTKYLVSDAAEITGTPLIWATVLRFHGE
    LALFNSGPDHRGVGLRDVFPEQPSADFVPD
    CATAGVLGATTATIGALMATHAIGFLTEIGDVQPGTILSYDAFPAATRSF
    RVSADPARPLVTRLRASYEAARTDTTSLIDATLNGSLTALDIREPHEVLLKDLPEGATSLKLPLSQITSDSDILEALSGI
    DGDILVY
    CASGIRSSDFIDNYSHLGHKFVNLPGGVNAL

    >gi|62391037|ref|YP_226439.1| hypothetical protein cg2411 [Corynebacterium glutamicum ATCC 13032]
    MTAPSTNTGVILTESAASKAKALIDQEGRDDLSLRIAVQPGGCSGLRYQLYFDDRTLDGDKEDIVGGVRLVVDKMSTPYL
    LGAQIDFADTIEQQGFTIDNPNAGSSCACGDSFN

    >gi|62391265|ref|YP_226667.1| hypothetical protein cg2661 [Corynebacterium glutamicum ATCC 13032]
    MAQKVTFWFDTTCPFCWVTSRWIKEVEQVRDIEIQWVPMSLAVLNEGRDLPEDYKERMKAAWGPARVFAAVATDHADKLG
    DLYTAMGTRIHNDGRGPIEGSFNDVIAEALEEVGLDAALGEVADTTEWDDALRAFHQTAMDEVGNDVGTPVVKLGDTAFF
    GPVLTRIPRGEEAGEIFDASFKLASYPHFFEIKRSRTENPQFD

    >gi|62391275|ref|YP_226677.1| alkylhydroperoxidase [Corynebacterium glutamicum ATCC 13032]
    MSDLIDMLVGEDLPQLRDNRPQARDNAQKSFEALLEPVNPGTFSFGERYAVATYVAGLHQFAPAVDLYQDLLLDDAPTTL
    ANAVSDAIDEGLSAGPYGTYREPGLESESEPGGSVRNDAAKLGERLAAAFDYAHLLVFHPRDSRPEVLGRLSGAGWSADD
    TVTLAQLVSFLAFQLRVAYGLRTLKGEDIQVKAPRLSIPEAKWELSNNGFEISTYEELNRPEAFVNHSLGWKPWVPPVAK
    ADLTEEQLDSLIQPERADMPYFRLLARDPAALKARTLTDLDIFFNTDGEGLGRAERELGATVTSRYNGCVY
    CASVHAGRA
    QEESGRADDVNALLASIDSDLGSDQWNVIRDAARALSSTPAAFNQGCITKLRGVGFSDLQIVDLINSVAFFNWANRLMLS
    LGEPEVPKRFL

    >gi|62391328|ref|YP_226730.1| bacterioferritin comigratory oxidoreductase [Corynebacterium glutamicum ATCC 13032]
    MKTRYWESILLNTCARGAPVPEFTPYARYLHRRAPAIVECMTEVKRLDVGDTPPAFSLPNDSGSTTSLSDFAGKQVLVYF
    YPKANTPG
    CTKEACDFRDSLSNLNDLDIAVVGISPDPVDKLVKFREDHELNFPLLSDEDKSVMTAWGAFGEKKNYGKIVQ
    GVIRSTFLINADGTVGMAKYNVRATGHVERIVREITAA

    >gi|62391371|ref|YP_226773.1| putative glutaredoxin NrdH [Corynebacterium glutamicum ATCC 13032]
    MAITVYTKPACVQCNATKKALDRAGLEYDLVDISLDEEAREYVLALGYLQAPVVVADGSHWSGFRPERIREMATAAA

    >gi|62391405|ref|YP_226807.1| dithiol-disulfide isomerase [Corynebacterium glutamicum ATCC 13032]
    MWLGYMNKSIPTTRKTRTFKAMSIEFSAPAKMKIEVWSDIMCPFCYIGKKRLDDALSTFDQAGRIEVEYKSFELMPGLET
    HPLRSDVEYLADAKGMSLEQARQMNGQVQAMAQATGLEMNPDETIAANTINAHRLTHFAKAHGKQQEVAQELFKAHFVDG
    KNVDDLDVLVSIAAEVGLDASAAREALESDVYTNEVQQDVHEARQLGVQGVPFFVFDRKYAINGAQQEEVFTGTVEKAFE
    EWAAENPVSPFEVIDGQSCSVDGTCN

    >gi|62391430|ref|YP_226832.1| glutathione peroxidase [Corynebacterium glutamicum ATCC 13032]
    MTSIHDISVTLNDGTETTMADWAGHLLLIVNVASKCGLTPQYEGLQKLYEEYQDRGFFVIGVPCNQFNGQEPGTDAEVCA
    FAQNQYDVTFPLLSKTEVNGEGAHPLYKVLKEATDGSEIEWNFEKFLVDAEGNTIKRFAPRTEPSAAEVVEAIEENLPI

    >gi|62391546|ref|YP_226948.1| rhodanese-related sulfurtransferase [Corynebacterium glutamicum ATCC 13032]
    MKEVAVNEVPAGAQLIDVRETDEYAEVRAQGAVNIPMSEFVGRIDEIDLDRDIYVICKLGGRSAQVAEYLEQRGIEAINV
    NGGTDGWVAAGLPTEA

    >gi|62391741|ref|YP_227143.1| hypothetical protein cg3212 [Corynebacterium glutamicum ATCC 13032]
    MSYHDHSDIEYLKKIGANSPDAFKAFVHFDEAALRGPNKKIPRNYTEMIALAVAFTTQCAYCIDIHTAAAKKEGVTTEEL
    AEVALIAAALRAGGAMTHGALAMKLYDEN

    >gi|62391763|ref|YP_227165.1| methionine sulfoxide reductase A [Corynebacterium glutamicum ATCC 13032]
    MAWFFAPEPVMVTADEALKGGRHPVLENPAPHTVLGTPVTGPWKEGQQRIWIGLGCFWGVEQMYWQMDGVEGTSVGYAGG
    FTPNPTYREVCSGRTGHTEIVEVVYDPSKISLEQLVARGLEAHDPTQGFRQGNDVGTQYRSAYYTENEEDAARVKAVVDA
    YGETLKQHGFGEITTEIGVISPSDYFLAEDYHQQYLDKNPDGYCPHHSTGIPCGVEA

    >gi|62391813|ref|YP_227215.1| Thiol-disulfide isomerase or thioredoxin [Corynebacterium glutamicum ATCC 13032]
    MEEGEEISLSDFEGEVVVLNAWGQWCAPCRAEVDDLQLVQETLDPLGGTVLGINVRDYNQTIAQDFKLDNAVTYPSIYDP
    PFRIAAALGGVPTSVIPTTIVLDRSHRPAAVFLREVTALSG

    >gi|62391816|ref|YP_227218.1| copper chaperone [Corynebacterium glutamicum ATCC 13032]
    MTAPATLKNTTLRSDEFTCPSCVAKIENKLNGLDGVENAEVKFSSGRILITHDPQKVSVRDLVTAVAEVGYTAKPSAI

    >gi|62391823|ref|YP_227225.1| thioredoxin [Corynebacterium glutamicum ATCC 13032]
    MATIDVTEETFESTVTGDGIVLVDAWASWCGPCRQFAPTYEKVSETHTDATFAKLDTEANQGLAAALQIQSIPTLMVFRD
    GIMVYREAGTMPAPALDDLVNQVKALDMDDVRRQVAEQQGSAEA

    >gi|62391840|ref|YP_227242.1| hypothetical protein cg3319 [Corynebacterium glutamicum ATCC 13032]
    MATSKILLYYAFTPLSDPKAVQLWQRELCESLNLRGRILISTHGINGTVGGDIDDCKAYIKKTREYPGFNRMQFKWSEGG
    AEDFPKLSVKVRDEIVAFGAPDELKVDENGVVGGGVHLKPQQVNELVEARGDEVVFFDGRNAMEAQIGKFKDAVVPDVET
    THDFIAEIESGKYDDLKDKPVVTY
    CTGGIRCEILSSLMINRGFKEVYQIDGGIVRYGEQFGNKGLWEGSLYVFDKRMHME
    FGEDYKEVGHCIHCDTPTNKFEHCLNEDDCRELVLMCPDCFANVETRHCKRERCAAIAADFAEQGIDPLVTS

    >gi|62391852|ref|YP_227254.1| methylated-DNA--protein-cysteine methyltransferase [Corynebacterium glutamicum ATCC 13032]
    MHHLRYESPIGELLLVASDQGLTYVAFSDENYAACTVGSTPGTNAVLEQAVAELEEYFAGKRKEFSTPLDWPSQNLLSFR
    GKVQEFLLSIPYGESKTYKQIAAELNNVGAVRAVGSACATNPLPIFAP
    CHRVLRTDGALGGYRGGLEAKQWLLELERP

    >gi|62391859|ref|YP_227261.1| putative FAD-dependent pyridine nucleotide-disulphideoxidoreductase, similar to mercuric reductases [Corynebacterium glutamicum ATCC 13032]
    MPESILGRMDTKLGAELGTEFDLIVVGFGKAGKTIAMKRSAAGDKVALIEQSPQMYGGTCINVGCIPTKKLLFETATGKD
    FPDAVVARDQLIGKLNAKNLAMATDKGVTVIDGKATFTASHEITVTSGSDTLVLYAPTIVINTGSTPVIPNVPGTDNPHV
    FDSTGIQHISPLPKHLAIIGGGPIGLEFATLFSGQGSKVTIIDRGELPLKNFDREVAELAKTDLEARGITFLNNAELTGF
    SGDLTIALKDHELLADAALLAIGRRPATDGLGLEQAGIKTGTRGEVLVDAHLRTNIDGIFAVGDVNGGPQFTYVSYDDHR
    IVLDQLAGTGKKSTAHRLIPTTTFIEPPLSTIGDNTEGENVVVKKALIADMPIVPRPEIINQPHGMVKFFVDKQSDALLG
    ATLYCADSQELINTVALAMRHGVTASELGDGIYTHPATSEIFNQLLGS

    >gi|62391919|ref|YP_227321.1| copper chaperone [Corynebacterium glutamicum ATCC 13032]
    MALKNYTVEGMTCAHCVASVTEEVSEVNGVSAVDVTLESGNVAVSGEGFSDAEIQAAVEEAGYKIVAS

    >gi|62391937|ref|YP_227339.1| thioredoxin reductase [Corynebacterium glutamicum ATCC 13032]
    MSEEQSAVAPKIHDVAIIGSGPAGYTAAVYAARADLNPIMFEGYEYGGSLMTTTDVENFPGFEKGILGPELMENMRAQAE
    RFGTDMHMELVDRVDLTGDIKKLWVGDDEYHARAVILSMGSAPRYLGVKGEQELLGRGVSA
    CATCDGFFFRDQDIAVIGG
    GDSAMEEATFLTKFARSVTIVHRREEFRASAIMLERAQKNEKIRFVTNKTVEEVIEADGKVSGLKLNDTVTGEDSVLDVT
    AMFVAIGHDPRSEILAGQVEVDPSNYVLVQEPSTRTNLDGVFAAGDLVDSHYQQAITAAGSGCRAAIDAEHYLASLA

    >gi|62391938|ref|YP_227340.1| thioredoxin [Corynebacterium glutamicum ATCC 13032]
    MSNVVAVTEQTFKSTVIDSDKPVIVDFWAEWCGPCKKLSPIIEEIAGEYGDKAVVASVDVDAERTLGAMFQIMSIPSVLI
    FKNGAKVEEFVGLRPKNEIVEKLEKHL