Corynebacterium efficiens YS-314

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|23578007|ref|NP_702954.1| hypothetical protein CE3P021 [Corynebacterium efficiens YS-314]
    MSTPTNPTTSTRPSGNWRKAQIIVWALLAIVVITGIVAFLIGRADSTSAPAPETVVSDAGQVVRDNSRVLSQAPNEKAVL
    VEFLDFE
    CEACRAAYPFVEELREEYSDTVTFVNRYFPLQGHRNSMPAAVAVEAAAQQGQYEAMYHRMFETQSEWGESAED
    KSAVFRGFAEDLGLDMAAYDAAVADPATEERVRLDVADGTALGVGGTPTFFLDGQLLTPDSLEQFRAEVDAAAAD

    >gi|25026610|ref|NP_736664.1| hypothetical protein CE0054 [Corynebacterium efficiens YS-314]
    MAEITVPEAQQRYTDEQVLDVREDFEVREGMIPTALHIPMGQLGARLDELDKNRPVIVVCRSGRHSATVADALNQAGFTA
    DTMAGGMIEWKQAGLPTG

    >gi|25026611|ref|NP_736665.1| hypothetical protein CE0055 [Corynebacterium efficiens YS-314]
    MGVYGTLVWHLPRDSLERTPMSSPSTTANITTVEPEVLRQWITDNEDLVVLDVRSAAEFESVHIRGSYNVPLQLVSEHTD
    QLAERLGGRVVLV
    CQSGVRAEQARQRLGAAGVETAHVLAGGVNAFADAGGDVVRGAQRWDIERQVRLVAGSLVVTGLLGG
    KFVSPKMRAVAGAIGAGLTFSGVTNTCAMGKALAAMPWNKTAQNPTAAESINQIPNTSA

    >gi|25026631|ref|NP_736685.1| hypothetical protein CE0075 [Corynebacterium efficiens YS-314]
    MTAPTALKNTTLRSDEFTCPSCVAKIENKLNSLDGVESAEVKFSSGRILVSHDPRKATVRDLVKAVADVGYTAKPSAI

    >gi|25026739|ref|NP_736793.1| molybdopterin biosynthesis protein MoeB [Corynebacterium efficiens YS-314]
    MGGPVKREQIARYRRQIMLGEVGQAGQQKLLDARIAVIGAGGLGSPALLYLAGAGVGHVLIIDNDVVDLSNLHRQVIHTT
    DGVGRPKAESAREAMLALNPTVDVAVAVERLNWSNALPLLKGYDMILDGSDNFETRHIASWAAARLGIPHIWASILGFDA
    QLTVFHADHGPIYEDLFPTPPPAGSVPS
    CSQAGVLGPVVGVVGSSMAMEALKLITGVGRPLIGRLGYYSSMDATWEYIPV
    VGDPAVVEKVRAKEVVAGPESGSGEALDVPRVSAVPSGVTFVDVREPHEFAAYAIPGAVNVPLSAIRSGAVPDAVAAGEE
    VLVY
    CAAGVRSAQAVAILQEAGYGGMTSLDGGIEGWLDA

    >gi|25026846|ref|NP_736900.1| hypothetical protein CE0290 [Corynebacterium efficiens YS-314]
    MTTSAKWSLVGVVVVLAVLVAVIPQLLSGSTTGDGDATGAAGDGAGEASTSIVADRPDCQDDGAAGVQLPCLGGEQGQGN
    DLPTVVNVWAWW
    CEPCRDELPVFDEFAASHPELNVVGVHADTNAANGAAMLGDLGVGLPSYQDDSNLFAGTLGLPAVVPI
    TVVVDPDGELVGTFPRTFDSVQDLEAAVAGVL

    >gi|25026869|ref|NP_736923.1| hypothetical protein CE0313 [Corynebacterium efficiens YS-314]
    MTRGSATRAPRRQTWLVPAVVITVAVLLIGTVLIINRGAGSAGSTESATGTPAVISGQEPTVYDPTEPDFTVVETRDEAD
    PLAVGPVDAPVGLVIFSDYQ
    CPYCAKWSAETLPLMLEHAEAGDLRIEWRDLNLFGPASERASRAAYAAALQGGDAYLDYH
    HALFKDGTSRSDNELDDDQLIALAHTLGLDTEAFTADFTSPETAGTVAAHAQLGITLGVYSTPAFILGGQPIMGAQPSEV
    FVDAFETALATQG

    >gi|25026875|ref|NP_736929.1| hypothetical protein CE0319 [Corynebacterium efficiens YS-314]
    MIPRGVYVMMVLTHPTNKKFWSDPLMLLHRFYDEDLAQASYFIGCQAQNTAVVVDPRRDITDYLELAEHHGMTITGITET
    HIHADYLSGTRELAAATGADIYVSGEGDEDWQYGFDGTRLYDGDTIKIGNITIEAKHTPGHTPEHLSFLITDGAFAHTPG
    YLLSGDFVFSGDLGRPDLLDEAAGGVDTRFGGAKQLFASLKNVFLTLPDHVQVYPAHGAGSACGKALGALPSTTVGYERT
    YAWWAPYLENDDEQGFIDELLAGQPDAHAYFARMKRQNKSGPAILGYPLAPLPEFTGSAIATEVEAGEKIVVDTRHHSEV
    HEGTVNGAVNVPGLNKAATYSAWVFDPETDTGRLVVLAADEEEAAAYRDHFMRVGIDEVDGFITSLDGLPMSTPEVLPQD
    KLEGFDRAMLLDLRNKTEHADGHIPGSTQLSGGRVLWNLDQLPAKDDTIVTY
    CQSGVRNSVAASALRRKGYTIVELEGSY
    LGWLAHNNK

    >gi|25026895|ref|NP_736949.1| putative pyridine nucleotide-disulphide oxidoreductase [Corynebacterium efficiens YS-314]
    MTTTVIVGGVAGGMSTAARLRRRDEEMEIIVLEASGYVSFANCGLPYHVSGVIPERDSLLLQTPESLAQRFNLDVRVNTR
    ATSIDRENKTVTTENGEVISYDYLVLSPGAAPIMPPIPGIERALTLRTVEDVDTVIAALSEDVKTAAIIGGGFIGLEMAE
    NLRHRGLEVTVIERAPQIMTPLDEEMALIVEKHLVDNGVTVITGGDTTDIAADHLTLSDGRTVPADVVIASIGVKPASDL
    AADAGLEVGERGGIKVDDQQRTSDPSIFALGDAAEKLDAVSGEDTLVPLAQTANRHGRLVADIITGRDVRRTPTLGTAIV
    GLFDMAAGSVGWNERRARAAGKNIRVIHTHPSDHAGYYPGAEMLHLKLVVDADTDAILGAQAVGGAGVDKRIDVIATAMR
    GGLTATDLADLELAYAPQFGSAKDPVNLLGYVNDNMVSGEKTVQWHELNDALSDGWTLVDVRTPGEFNAGTIPGAVNIPV
    DDIRDRIDELEGRKALAF
    CRVGQRGHVAASLLTHLGVESANLDGGFITWELSPANK

    >gi|25026939|ref|NP_736993.1| dihydrolipoamide dehydrogenase [Corynebacterium efficiens YS-314]
    MLCRTRIVEIVTEHYDVVVLGAGPGGYVSAIRAAQLGKKVAVIEKQYWGGVCLNVGCIPSKALIKNAEIAHIFNHEKKTF
    GINGEVTFNYEDAHKRSRGVSDKIVGGVHYLMKKNKITEIDGFGTFKDAKTIEVTDGKDAGKTVTFDDCIIATGSVVNSL
    RGVEFSENVVSYEEQILNPVAPKKMVIVGGGAIGMEFAYVLGNYGVDVTLIEFMDRVLPNEDPEVSKVIAKAYKKMGIKL
    LPGHATTAVRDNGDSVEVDYQKKGSDKTETITVDRVLISVGFRPRVEGFGLENTGVKLTERGAIDIDEHMRTNVDGIYAI
    GDVTAKLQLAHVAEAQGIVAAETLAGAETQTLGDYMMMPRATFCNPQVASFGYTEEQAKEKWPDREIKVSSFPFSANGKA
    VGLAETDGFAKIVADAEFGELLGGHIVGANASELLNELVLAQNWDLTTEEISRSVHIHPTLSEAVKEAAHGVNGHMINF

    >gi|25026963|ref|NP_737017.1| putative cation-transporting ATPase [Corynebacterium efficiens YS-314]
    MDTMPRAVNLIELDLGVTGMTCTSCSARVERKLNKVDGVEASVNYATESASVKYDPEKVTEDQLIDTIKGAGYGAFALST
    TTPETTTPTTDADAATGQERIDAARDAEADDLKHRLIISAILTVPITLLSMIPALQFTNWQWAVLTMTTPVFFWGGAPFH
    KATWANLRHGSFTMDTLISLGTTAAYLWSLWALFIGNAGMPGMTMEIHLFPTDSSMDEIYLETAAVVITFLLLGRWFETK
    AKGRSSEALRKLLDMGAKDAAVIRDGHEVRIPISQLEIGDVFIVRPGEKIATDGRVTDGSSAVDESMLTGESIPVEVTKG
    SKVTGATLNTSGRLLVEATRIGSDTTLAQMAKLVTEAQSKKAPVQRLVDRISQVFVPVVIVISILTLAGHLLFTDHGLAA
    AFTAAVAVLIIACPCALGLATPTALLVGTGRGAQLGLLIKGPEILESTKKVDTIVMDKTGTVTSGVMSVHDVTTAPGFDR
    DEVLTLAAAVESASEHPIAQAIAAAPRAALPEVTGFQNTAGRGVTGVVDGRTVTVGRPSSTLDDALSASFTQAQNQGATP
    VVVMIDGVNAGVITVRDTVKDTSAEAVAGLKKLGLTPMLLTGDNLGAARAVAAEVGIAPEHVIAEVMPDEKVSVVNKLQS
    EGRNVAMVGDGVNDAAALAQADLGLAMGAGTDVAIEASDITLMNNDLRSAVDAIRLSRRTLGTIKGNLFWAFAYNVALIP
    VAAAGFLNPMLAGVAMAFSSVFVVTNSLRLRRFSTNH

    >gi|25027018|ref|NP_737072.1| hypothetical protein CE0462 [Corynebacterium efficiens YS-314]
    MRVRKIAATLVAIMLGSTTLVACSAEDTAGTNAVAAGGTFQFHSPGGQMDIFYEEGERQPLEQISGDSLMDENTRINLTD
    YENQVVVLNAWGQW
    CAPCRSESDDLQEIHEQLQAAGDGSTPGGTVLGINVRDYSREIAQDFTVDNGLTFPSIYDPPFMTA
    AQLGGVPASVIPTTIVLDKQHRPAAVFLREITADEILDVALPLVEEA

    >gi|25027264|ref|NP_737318.1| flavoprotein disulfide reductase [Corynebacterium efficiens YS-314]
    MEVPFMAKRIVIIGGGPAGYEAALAGAKYGADVTLIEDFGIGGAAVTLDCVPSKSFIAGTGIKTDLRRADDMGLNRGLGK
    AHLEIDALNKRVKALANHQSGDIAGQLKRAGVRMIDGYGRFDDYNTKQTTHYVQVTHNGTGETESLECDLVLIATGATPR
    ILKGAEPDGERILTWRQVYDIDELPTHLIVVGSGVTGAEFVSAFAELGVKVTMVASRDRILPHDDADAADVLETVLAERG
    VSLEKHARVDSVTRTPDGGVCVRTADGREIYGSHALMTVGSIPNTQNLGLENIGVELAPSGHIKVDRVSRTSVAGVYAAG
    DCTDLFPLASVAAMQGRIAMYHALGEGVSPIRLKTVATAVFTRPEIAAVGVTHAQVDAGEVTARTVVLPLVTNPRAKMRS
    LRHGFVKLFCRRNSGLIVGGVVVAPTASELILPIAVAVTNRLTVADLAETFAVYPSLSGSITEAARQLVQHDDLG

    >gi|25027276|ref|NP_737330.1| putative thiosulfate sulfurtransferase [Corynebacterium efficiens YS-314]
    MAAPFDPFPPFQEYAHPERLVSASWLSARLGSPGLKVVESNEDSILYDIGHLPGAVRIDWDKDLNDPVTRDFIDGKAFAD
    LMNRKGIHRDDTVVIYGDKSNWWAAFTLWVFELFGHADVRLLNGGRDAWMSEERDTSYAVPAYPPTNYPVVERVDEGHRA
    FVAEVLESLRGGAGTKLVDVRTAEEYRGRDDEGNPVAGEGVLRGGHIPGAVHIEWEQAVLPNGNFRSRKEIEEVYSHLNP
    AEDTVVY
    CRVGDRAAHTWFVLKYLLGFENVRNYDGSWSEWGNMVRMPIVQGDEPGSL

    >gi|25027473|ref|NP_737527.1| hypothetical protein CE0917 [Corynebacterium efficiens YS-314]
    MAHATIYATDWCPYCASLMRGLKDLDPAEYEVIDVDQDEEAGEWVKSVNDGNRIVPTVKFSDGSHATNPPVAEVIAKIQD
    LS

    >gi|25027532|ref|NP_737586.1| hypothetical protein CE0976 [Corynebacterium efficiens YS-314]
    MVLIEVFQMLCPGCVNHSLPQAVKIHRKVEESALQVIGLHSVFEHHEVMTPAALKVFMSEFGITFPVAVDRPREGQRIPS
    TMKKYRLEGTPSTILVDKKGRIRQVQFGQVDDFVLGLLIGSLLSEED

    >gi|25027697|ref|NP_737751.1| putative thioredoxin peroxidase [Corynebacterium efficiens YS-314]
    MATTHFDGTDTPTSGELPAVGDTLPDFTVVDTNLGEVSLSDLKGKKLVLNIFPSVDTGLCAESVRRFNAEAAGLDNTTVL
    CVSKDLPFALGRFCGAEGLDNVTAASAFRSTFGEDYGVVLEGSPLKGLLARSVIVADEDGKVIYTQLVDEIKTEPDYASA
    IKALG

    >gi|25027706|ref|NP_737760.1| putative arsenate reductase [Corynebacterium efficiens YS-314]
    MTYTLDPAGCGMGHDPTGSMPARACSAPPHVLDGRLTAMDVTIYHNPRCSTSRKTLEYLREDGLSPTIIEYLKDTPTKEE
    LRALFDRMGIPVHQGIRTKETEYTELGLSEDTPEDELLDAVVAHPRLLERPIVVTGKGARIARPSINVIDEIL

    >gi|25028113|ref|NP_738167.1| putative thiosulfate transferase [Corynebacterium efficiens YS-314]
    MTSVQESSSETAYPAFPAGPVVSVDWLAAHLNDDNLVVLCASMGAPEPSRAAGIPGAFLADLDADFSDQSSPLPHTVPAD
    VQALLEGYGISDDTTVVVYDRHGLMVAPRVWWLLRIAGLDNIGVLNGGLPAWTAAGHPTAPLSTPTGGGRITAAPNHDLL
    VGIEGVEKALARSNRVVVDARSAKRFAGVDPEPRKGLQRGHIPGSVSLPYTEIADEQGFLRPVGELQELFREVTDGATSL
    VFS
    CGSGVTACVDAFAAVVAGCGDVVVYDGSWSQWGDPENQQPIA

    >gi|25028347|ref|NP_738401.1| hypothetical protein CE1791 [Corynebacterium efficiens YS-314]
    MTDFKLITDAEWRERLNPEEYRVLRQAGTEAPHVGEYTNTTTEGVYSCRACGEELFRSTEKFDAHCGWPSFFSPLAKDKI
    IEKEDLSLGMRRIEVLCANCGSHMGHVFEGEGFNTPTDLRY
    CINSISLRLEEKPVSE

    >gi|25028452|ref|NP_738506.1| mycothione/glutathione reductase [Corynebacterium efficiens YS-314]
    MTETKHYDLIIIGTGSGNSIPGPEFEDKSIAIVEKGTFGGTCLNVGCIPTKMFVYTADIAREISDSSKYGIDATYNSVDW
    PSIVDRVFTRRIDLIAEGGEAYRRGPETPNIDVYDMHARFIGEKTIATGQAGEEKVISGDQIVIATGSRPFIPPVIKESG
    ARYHTNEDIMRLPTLPSSLVIVGGGFIALEFAHVFSSLGTKVTLINRSEVLLRDADADISARIAKITRERVDVRMSTSVT
    GVTDNADGSVTVSLDSEDPITADVLLVATGRTPNGDQMDLDTAGIEMDGRRIKVDEYGRTTAPGVWALGDVSSPFKLKHV
    ANAEMRAVRHNLLHPDALQTMPHDHVPSAVFTNPQIAQVGMTEAEARAAGHNLTIKVQNYGDVAYGWAMEDTTGFVKLIA
    DRDSGRLLGAHLIGPQASTLIQQLITVMAFDLDVREVATRQYWIHPALPEVIENALLGLEF

    >gi|25028493|ref|NP_738547.1| thiamine biosynthesis protein ThiF [Corynebacterium efficiens YS-314]
    MALPEMSLPDMALPDTELRRTARQLALSGWGMEQQERLHRSHVLVIGGGGLGCPAMQSLASAGIGHITVIDDDTVDITNI
    HRQILFGASDVGRPKVEVVAERLRELQPDITVTALRERLTVDNAVELVGGVDLVLDGSDSFATKYLVADAAEITGTPLVW
    GTVLRFRGDVCLFADGVGLRDLFPVQPTGDSIPD
    CATAGVLGATTATIGALMATEAIKFLAGLPTQPGRMLSYDALTTTT
    RSFTVGADPARDRVTGLQPSYSDAVCAVGPSPEELLDQVRAGAAVLLDIREPHEYLLNDSLADLDPVRLPLSEITGVDTV
    WHALGEARRDARRDTRRVVVHCASGVRSATFVEQYGDLGYDLVNLPGGINALG

    >gi|25028645|ref|NP_738699.1| hypothetical protein CE2089 [Corynebacterium efficiens YS-314]
    MGCIYRMRCTAVSQARGVDCMPTKMFRPTRGVEEFKETTAMTAPSTNTGVILTDAAAAKAKALIDQEGRDDLALRIAVQP
    GG
    CSGLRYQLYFDDRTLDGDKEDVVGGVRLVVDKMSTPYLLGAQIDFSDTIEAQGFTIDNPNAGSSCACGDSFN

    >gi|25028722|ref|NP_738776.1| hypothetical protein CE2166 [Corynebacterium efficiens YS-314]
    MVCTQRRPIPAGFPRKPTKTFTPSCTRVGRRSLGAMSTEPTSPTAPVTATRTGPWTLSVDNGRGATLTIGMEGADGSFSP
    VELLQAALAGCTALSAEAQLVDKLGADVSVSSTVQATYAPDANRIIHLDTTITADMTSLPMERMDKLIQAAERSVGRL
    CT
    VKRSLTHGIETTTTVVNGSAGPTGRV

    >gi|25028832|ref|NP_738886.1| hypothetical protein CE2276 [Corynebacterium efficiens YS-314]
    MRSKHGPYIDKFYPEPYKQLVEVSKTLKKIYPEVDLPESLIELVSVRVSQINGCGTCLSIHVPAARRAGVPEKKLDALPA
    WRMVDEYTAEEKAALQLAESLTLLDRNEGHLAARTACSVFAEEQVAALEWSIIMINAFNRISIASGHPLL

    >gi|25028875|ref|NP_738929.1| hypothetical protein CE2319 [Corynebacterium efficiens YS-314]
    MAEKVTFWFDTSCPFAWATSRWIKEVEKVRDIEVAWTPMSLAILNDGRDIPADYADMMKANWGPARVFAAVATKEPEKVG
    DLYTAIGTRVHHEGRPEVRNDYGAYNEVIAEALAEVGLDASYAEVADTEEWDDALRAFHQSAMDEVGDDVGTPVIKLGDT
    AFFGPVITRIPTGEEAGEIFDASVRLAAFPYFFELKRSRTESPQFD

    >gi|25028886|ref|NP_738940.1| hypothetical protein CE2330 [Corynebacterium efficiens YS-314]
    MADIIDMLVGTDLPHLRDNRPQARDNAQKSFEALLEPINPGTFSFGERYAVATYVAGLHQFTPAVELYSDLLLDDAPTTL
    ANAVTDAIDATLSAGPYGTYREPGLAAESQPGGSVHTDASVLGERLAAAFDYAHLLVFHPRDSRPEVLGRLSEAGWSADD
    TVSLSQLISFLTFQLRVAYGLRTLNGEDIKVKIKGRLAVPEVEWTLSDKGFPITTYEDINRPEAFVNHALGWKPWVPPVA
    KADLTEEQLESLIKPERADMPYFRLLARDPQALKARTLTDLDIFYNTDGEGVGRAEREIAATVTSRFNGCVY
    CASVHAGR
    SVEEAPERLDDVNALIDNGVDADLGSDQWNVIRDAARALTATPMAFNQGCITKLRGVGFTDLQIVDLINSVAFFNWANRL
    MLSLGEPEVPKRFL

    >gi|25028943|ref|NP_738997.1| putative bacterioferritin comigratory protein [Corynebacterium efficiens YS-314]
    MKTRYCGPILLNSSPERTPIPENTTAPAIVEVMTDARRLDVGDTPPAFTLPNDSGSTTSLSDFAGERVVVYFYPKANTPG
    CTKEACDFRDSLAQLNDLGVKVIGISPDPVDKLVKFREDHDLNFPLLSDEDKAVMTAWGAFGEKKNYGKIVQGVIRSTFV
    IEPDGTVGLAKYNVRATGHVARILRDLEAA

    >gi|25028981|ref|NP_739035.1| putative glutaredoxin NrdH [Corynebacterium efficiens YS-314]
    MAITVYTKPACVQCTATKKALDRAGLDYELVDISLDDEARDYVLALGYLQAPVVVTEADHWSGFRPERIREMAAAVA

    >gi|25029008|ref|NP_739062.1| hypothetical protein CE2452 [Corynebacterium efficiens YS-314]
    MPKRSEEPTVAAKMKIEVWSDIMCPFCYIGEKKLDDALAGFADAERIDVEFKSFELMPGLETHPIRSTNEMLAETKGMTV
    EQARQMNAQVAQLAAAVGLEMDSETSIPANTINAHRLTHLAKKHGKQKDVTHALFRAYFAEQKNVDDIDTLVAIAEGVGI
    DGDEARSVLESDAYTNEVQRDVHEARQLGVTGVPFFVFDRKYAISGAQDAAVFEGTIEKSFGEWAEANPASPFEVIEGQT
    CSVDGTCS

    >gi|25029039|ref|NP_739093.1| putative glutathione peroxidase [Corynebacterium efficiens YS-314]
    MEAMTSIHDIPVTLTDGTETTMADWAGHLVMVVNVASRCGLTPQYEGLQRLFEDYQDRGFFVIGVPCNQFMGQEPGTDAE
    ICTFAQEKYDVTFPLLAKTDVNGENEHPLYTELKRFGEGGDIEWNFEKFLINADGETIARFGPRMDPEDDEVTSVIEDNL
    PV

    >gi|25029284|ref|NP_739338.1| hypothetical protein CE2728 [Corynebacterium efficiens YS-314]
    MILTGLAVGIALGIVMQRGRFCVTGMLRDIFLQRSWRTFVGLLIVIAVHAVGLAALTSTGVITPTYNNFAPMAVIVGGFI
    FGFGIILSGG
    CASGTWYRSGEGLVGSWIALATYAISTAAMKDGALTGFTDVMFSWETELTTLPAMFGVSVWWFVIPFAAL
    TAYLVRRFMILEAQRPKIARLGNQPAWKRPLHVYTAGALIGLIGVIAWPLSAAAGRNSGLGITTPTSHTLQYATTGDESY
    LNWGVMLVLGILVGSFIAAKATGEFRVRVADATTSVRAVVGGTMMGVGASLAGG
    CTVGNGMVQTSLFSFQGWIALLFIAI
    GVGVAAKIFLKPASVAKREAATTETYSTEESLAHATPTSAEDRVLPLNTQDTQDTQGTGTAATPAPLGGVKVATSLVSLK
    PAVSEKLRDLGSGYYALDSLGAVCPFPLIEAKDVMKTLQSGDHLVIDFDCTQATDAIPQWCATDGHEVTDFKETGEASWQ
    ITVKKG

    >gi|25029320|ref|NP_739374.1| methionine sulfoxide reductase A [Corynebacterium efficiens YS-314]
    MEGNVTMAFFFRPEPKMVTPEEALKGGRHPVLESPQPHTVLGTPITGPWKEGQKRVWIGLGCFWGVEQMYWKMDGVESTS
    VGYAGGYTPNPTYREVCSGRTGHTEIVEVVYDPEKITLAELVARGLEAHDPTQGYRQGNDVGTQYRSAFYVETGEEAETV
    RQIVSTYGETLKSHGFGEITTEVDVITPADYYLAEDYHQQYLHKNPDGYCPHHSTGIPCGVEA

    >gi|25029368|ref|NP_739422.1| putative thioredoxin [Corynebacterium efficiens YS-314]
    MDPSGTRTGHHAHCMMSFESDSGSESPRGRDHDRPGNARDLHLVDLYIQTIQTFRRSYYMATIDVTEDTFEQTVTGEGIV
    LVDAWASW
    CGPCRQFAPTYEKVSGDHPDAVFAKLDTEANQSLAAALEIQSIPTLMIFRDGIMVFREAGTMPAPALDDLVK
    QVKQLDMDDVRRQIAEQQAAQGDA

    >gi|25029369|ref|NP_739423.1| hypothetical protein CE2813 [Corynebacterium efficiens YS-314]
    MSTKNYSVEGMTCEHCVASVQEEVAEVPGTQGVEVELESGRLVVTGEGFSDDAIAAAVERAGYKVQQEH

    >gi|25029386|ref|NP_739440.1| hypothetical protein CE2830 [Corynebacterium efficiens YS-314]
    MSIGKILLYYAFTPLSDPKAVQLWQRDLCESLNLRGRILISEHGINGTVGGDINDCKAYIRKTREYPGFAKMEFKWSEGG
    AEDFPKLSVKVRDEIVAFGAPNEIKVDENGIIGGGVHLKPEEVNQLVEERGDEVVFFDGRNAMEAQIGKFRDAVVPDVNT
    THDFIKEIESGKYDDLKDKPVVTY
    CTGGIRCEILSSLMINRGFQEVYQIDGGIVRYGEKFGNQGLWEGSLYVFDKRMHME
    FGEDYKRLGHCIHCDTPTNKFEHCVNEDECRQLVLMCPDCYANVETRHCGQDDCVEIAADLAARGVDPLVTQ

    >gi|25029393|ref|NP_739447.1| putative methylated-DNA--protein-cysteine S-methyltransferase [Corynebacterium efficiens YS-314]
    MALCHTRFTSPVGELLLVADDAGLTYLGFAGEDHTRHSAGSTAAHTPILDRAVAELDQYFAGERTTFTVPLSRPGDGEMG
    FHGRVQRLLATIPYGSFVTYKELAGKAGNPGAVRAVGTACATNPVPIFSP
    CHRVLRTDGGLGGYRGGTKAKELLLRLENI
    DFRN

    >gi|25029441|ref|NP_739495.1| hypothetical protein CE2885 [Corynebacterium efficiens YS-314]
    MVPTHGNGFNIFPSPSGPGVARRRQQVRFRLCRTVGPHAEPRTPPPSGDPVMSIDLPPDVDVLVVGGGPAGLSAATWLGR
    YQRSTLVVDAGNQRNLPAQYAHGLLGRDPTTARELLADARAGLEQYPHVLLRQGTVTGLSRSGDGLFRAVIEGMDADGMV
    EVSAQRIVLASGVRDRFPKVAGFHDHYGRDVFH
    CLACDGLTARGQTAIVLGSGPHVPAYAAEVLEWAGAVRIIAENAEAF
    TQGQRSMLGSHGIEVVDGPAEAFIGKPGALEGVRLAGGEVVEGSTVFFSYAHHPANDLARQLGCNLDHEGQPVINGYQLT
    SVEGVYAAGDIIAGWQLIPIAMGTGTAAGLACATSLRGHATAAMAPDPAPPTGLFKAHESA

    >gi|25029464|ref|NP_739518.1| putative organic hydroperoxide resistance protein [Corynebacterium efficiens YS-314]
    MKTLPHPHKKVVHNLIVVHDGRCSPITPPNHKEPPLMDALYSTEALATGAGRNGHAATADGSLEFSMAIPKEMGGSGEGA
    NPEQLFALGYAACFHSALQSVARAEKKDLGDSSVGARVSIGKQGEGFGLAVDLEVVIPALEQEEAQALADAAHQV
    CPYSN
    ATRGNIPVTVTVSRD

    >gi|25029489|ref|NP_739543.1| putative thioredoxin reductase [Corynebacterium efficiens YS-314]
    MSEEQSKIHDVAIIGSGPAGYTAAIYAARADLKPIMFEGYEYGGSLMTTTDVENFPGFQDGIMGPELMENMRAQAERFGT
    DLRMELVDRVDLTGDIKKIWVGDDEYQARAVILSMGSAPRYLGIPGEKELLGRGVSA
    CATCDGFFFRDQDIAVIGGGDSA
    MEEATFLTKFARSVTIVHRREEFRASAIMLERAQKNEKIRFVTNKTVEEVIENDGKVAGLKLKDTVTGELSDLDVTAMFV
    AIGHDPRSEMLVGQVELDSSNYVVAEHPSTRTNVPGVFAAGDLVDSHYQQAITAAGSGCRAAIDAENYLANQI

    >gi|25029490|ref|NP_739544.1| putative thioredoxin [Corynebacterium efficiens YS-314]
    MSNVIAVTEQTFKSTVVESDKPVLVDFWAEWCGPCKKLSPIIEEIAGEYGDKIVVASVDVDAERTLGAMFQIMSIPSVLI
    FKGGQKVDEFVGLRPKTEIVAKLEQHL