Corynebacterium aurimucosum ATCC 700975 uid59409

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|227831947|ref|YP_002833654.1| hypothetical protein cauri_0117 [Corynebacterium aurimucosum ATCC 700975]
    MQTVDTLIIGGGAAGLQAALVMVRARRSILVVDSSTPRNRFAHEIHGVIALEGTPPLEFQERGKKQLRSYGVTIANATVD
    SVTDNDRTLTATLSNGETVAARSIIVASGVDDVHPDIPGLEENWGNTVLH
    CPYCHGFEVADKKLGVLCIGEFSLHHAALL
    RQWSKDITFFTNGMELTEEQRADLTRRGLALVDGPVTAFQDGKVLVGSTPHAVDALFYMPVPHPHDEFLTDLNLERHSPP
    PAMGGSLIKVGPAGATSHPRVWAVGNVVNPPAQVAVAMGEANAAAIAVNAFLVEDDWI

    >gi|227831954|ref|YP_002833661.1| putative molybdopterin biosynthesis enzyme [Corynebacterium aurimucosum ATCC 700975]
    MSSRYARQETLWGTSTQERLRASTVAVIGAGGLGSPALLYLAGAGVGRILLFDDDTVSLSNLHRQVIHSTATVGQPKTES
    AAAALSALNPECTVEQFSRLTPDTALDQLRGADLIIDGTDNFYSRHLASWSAHELDIPHVWASLLGYDAQLTVFHSGHGP
    VYEDLFPTDPQVPS
    CSQAGVLGPVVGVAGSALAVEALKLLTGIGTPLIGTLGYYDSLAGTWEYIPVRANGATPARPDNPT
    DIREIPEDATLIDVRTSPERAASLIPGSQHLPLDEILAGHNPTLDPADLAVLY
    CASGLRSAQAVEALRARGFRNVYSLRG
    GIDAWQEHISELSAEADAEAS

    >gi|227832037|ref|YP_002833744.1| putative thiol:disulfide interchange protein [Corynebacterium aurimucosum ATCC 700975]
    MSQYSRWPGYVKASIVAIVALAALAFVGVVNLLEDDEPEVPVPEAQEQEVAKRPKCPEGPIAGVDLPCLGAAGTAAAKNV
    QIVTVWAWW
    CEPCRTELPFFEDLARSHSTWNVVGVHADANAANGAALLNDLQVNIPSYQDDDGAFAGELGLPGVIPITLV
    VRDGIVEEKFIKPFTSAEELEEAVEEVLQ

    >gi|227832075|ref|YP_002833782.1| putative secreted protein [Corynebacterium aurimucosum ATCC 700975]
    MPSSSSRPTSDPKKSALSAISPVAWGLLVIVVILAIIIGFLLAERNSSGKESTPAAQETATSTAPTEDLAKDADKATPGT
    KFSDGKGDPMMFGPGGDTKSGDITVVHRKKENDPFAVGAVDAPVVISEFSDFE
    CPFCSRHANVTEPDLLKKYVEKGLVRI
    EWNDFPVNGPAAVEAAKAGRAAAAQGKFQEFKHELYTASKDISGHPEFGIEDFMKFAEKAGVADLDKFRQQATDDTYTEV
    IEKATSYASQIGITGTPAFVVGDQFVGGAQPPEVFEQIIQEQLGKAANA

    >gi|227832084|ref|YP_002833791.1| dihydrolipoamide dehydrogenase [Corynebacterium aurimucosum ATCC 700975]
    MTNEHFDVVVLGAGPGGYVSAIRAAQLGKKVAVIEKQYWGGVCLNVGCIPSKALLKNAEVAHTFNHEAKAFGISGDVSFD
    FGVAHKRSRKVSEGIVKGVHYLMKKNKITEINGLGSFKDAKTIEITEGDDKGKTVTFDN
    CIIATGSVVRSLPGVEIGGNI
    VSFEEQILNDDAPDSMVIVGAGAIGMEFAYVLANYGVDVTIVEFMDRVLPNEDKDVSKAIAKEYKKLGVKLLTGYKTTAI
    KDNGDNVTVEVESKDGSKTDTLTVDRCMVSIGFAPRTEGYGLENTGVELTERGAIAIDDYMRTNVEGIYAIGDVTAKLQL
    AHVAEAQGVVAAEVIAGAETQLLGDYMNMPRATFCNPQVASFGYTEEQAREKFADRDIKVATFPFSANGKAAGLNETAGF
    VKLIADGEFGELIGGHMVGSNVSELLPELTLAQRFDLTAEEIGRNVHTHPTLSEAMKEAAEGIGGHMINL

    >gi|227832127|ref|YP_002833834.1| hypothetical protein cauri_0297 [Corynebacterium aurimucosum ATCC 700975]
    MSHVVELMVRTTCGSCARVLEQITPVVQQAGAELKVRNVDEDAELAMEYGDRVPVVVIDGEEFSCWEVDNEELAQALME

    >gi|227832153|ref|YP_002833860.1| thiol-disulfide isomerase/thioredoxin [Corynebacterium aurimucosum ATCC 700975]
    MARRTIRAAAAGVLAVIALVGCSQSEENAQNAVASGGTFEFISPGGQTTIRYAEEDRKPLKDFSGEDLRNESTTIKLSDF
    QDQIVVLNSWGQW
    CAPCRSESDDLQAIHSELQKRKVGTVLGINVKDFNPEISRDFMADNGLEYPSIYDPPFKTAAALGGV
    PTSVVPTTIVLDKQHRPAAVFLTEITEKDVLEVVDELEKEQ

    >gi|227832343|ref|YP_002834050.1| hypothetical protein cauri_0515 [Corynebacterium aurimucosum ATCC 700975]
    MLSTLFIGFTGGLITGISPCILPVLPLVLAVSGGSRWRPWQVIGGLVTSFSLVTLFATTLLNALGLPADILWKVGIALLV
    LVGLGMVFPRVQEALEWPFQKLPKAGGLQAKARDKGGFVVGLAMGVVFVPCAGPVLTAISVAGATGTVDAHILLLCLSFA
    LGVAIPLLAFALGGNEVGKRVDAFRSHQRGVRIAAGIVVIAMAGAISLGAPAWLQQKLPSINVDATPVEQDAPTAEGTPV
    PAFAGLTGWFNTDAPVDPRTSGKVTLIDFWAYA
    CINCQRNNTHLTKLYAHYKDYGFDIIGIHAPEYAFEHEADNVRRAAR
    EQGIEYPVAQDNDFATWKNFGNRYWPAHYLVDKHGMLRQSHHGEGDYAETERLIRELLLERDPSIALPEPIEAADANSAP
    RSPETYLGTARAQYFTNPDYHDGTHQFTTSEPPLGQYSLGGTWTLADQPITAGPHARLRLNYRAAWVQLVTSGSGTVRVH
    RADGSVRTFDITQDGTVDLVREPDNHTETIELEVSEGLSLYSFTFG

    >gi|227832618|ref|YP_002834325.1| hypothetical protein cauri_0790 [Corynebacterium aurimucosum ATCC 700975]
    MSTNVATPETTEHVTIFFADWCPFCAKLIKNLDRTETPYELVNVEADSPDTADINAWIESVNDGNRIVPTVLYSDGTHAT
    NPSASEVRAKYAELAGE

    >gi|227832666|ref|YP_002834373.1| methylated-DNA--protein-cysteinemethyltransferase [Corynebacterium aurimucosum ATCC 700975]
    MHVWTSLDSPLGRLTLVGSARGLSQVYFPDESPNLSGLRRLTDRSDSTWPSVKVLVAATQQITEYFAGTRRDFELLLDVP
    PSPETFRDRAQRALRDIPFGEHWTYSRLAAAAGSPQAARAAGSACASNPLPIVVP
    CHRVVPASGGLGSYRGGVAAKRLLL
    EHEAGNQ

    >gi|227832794|ref|YP_002834501.1| Selenophosphate synthase [Corynebacterium aurimucosum ATCC 700975]
    MTDIKLTSFAAGGGCACKIPPGELESAVAGLVGTADPNVLVGLDDGDDAAAVRIPNGLAVISTADFFTPMINDPYDWGRV
    AAANALSDVYAMGGTPITAINLVGWPREKLGLDVLREVLRGGMDVASEAGISITGGHSITAPEPTYGLAATGIVHPDKIM
    RNDAAEAGLPITLTKPIGVGILNNKHKATGEVSQAAVDSMTTLNRDAAAAAVAAGVRAATDVTGFGLLGHLYKMCRASGI
    GAELDFSAVPAVDGAMEALAEGFIPGGSRRNLDWVRPHLDSDLSEEDLVFLADAQTSGGLLVIGEVPGYPVIGRTVTGEA
    RITIR

    >gi|227833229|ref|YP_002834936.1| thiol peroxidase [Corynebacterium aurimucosum ATCC 700975]
    MFPSLWWFTNFRPTHPNRTVVHRGEPPRGSVRLGAMATTNFQNKPVETNAELPKVGDALPDFTLVGTDLAELTNADFAGK
    RLVVSCFPSVDTGV
    CAAQLRKFNEEAAGLENTVVLSVSRDLPFAQERFCAAEGIENVVSASDFRSDFADKLGLVLEGSPL
    KGLFARAVIVTDEDHKVTYTELVPEVTTEPDYDAALAALK

    >gi|227833264|ref|YP_002834971.1| peptide methionine sulfoxide reductase [Corynebacterium aurimucosum ATCC 700975]
    MTDFKLIADTEWRKRLSPEEYHVLREAGTEAPHVGEYTNTTTEGVYSCRACGAELFRSTEKFESHCGWPSFFSPLAGDAV
    IEREDNSLGMRRIEVLCANCESHLGHVFEGEGYDTPTDLRY
    CINSICLDLEEKPVED

    >gi|227833294|ref|YP_002835001.1| alkylhydroperoxidase [Corynebacterium aurimucosum ATCC 700975]
    MSIENLKSALPAYAKDQKLNIGSLTRSTELNEEQLWGSLVAAAAATRNDLVLSEILEEAREHLSEEAVDAALGSATVMAM
    NNVAYRAKSWLGDDFAQVKFGLRMNIIAKPGVDKATFELWSTVVSAINGCEH
    CLSAHANTLLEEGVTKEQIWEGIKVAGV
    VEAVAQALQAEAVRSAE

    >gi|227833295|ref|YP_002835002.1| alkyl hydroperoxide reductase [Corynebacterium aurimucosum ATCC 700975]
    MPILTVGEKFPEFELTALKGGDLHDVNANQPEDYFEQVSLDKYQGMWKVVFFYPKDFTFVCPTEIAAFGKLNEEFLDRDT
    QVLGGSTDNEFAHFNWRATHPELKEVPFPMFSDIRHDLIRALGVENADGVADRATFIIDPDGVIQFVSVTPDAVGRNVDE
    VLRVLDALQSEEVCACNWEANDPTKNIDKLEVVKSAL

    >gi|227833367|ref|YP_002835074.1| putative mycothiol reductase [Corynebacterium aurimucosum ATCC 700975]
    MVGMTSAQHFDLVIIGTGSGNSIPSPEFDDKSIAIIEEGTFGGTCLNVGCIPTKMYVYAADVALAAREATRLGLSAHVDA
    VDWEGIVERVFHNRIDQIARGGEEYRRGEETPNITVFDQHARFIGPKTLQAGDDIITGDNIVIATGSRPVLPEPYASSSV
    PVHTNEDIMRLEKQPRSLIVVGGGYIAMEFAHVFDGLGTEVTVVNRSEKLLRFLDEDLSSRFNDIARERFDVRIGTTTAL
    EETADGVRLTLDSGDVLEAEAILVATGRQPNGDQMDLSTSGIEMHEDGRIKVDEFGRTTCEGVWALGDVSSPYMLKHVAN
    AEQRAVQHNLLHPDDLQPMPHEHVPAAVFTHPQIATVGLTEAQAREEGYDVTVKVQNFGDVAYGWAMEDTTGICKLVADQ
    GTGKLLGAHLMGPQASTLIQQLITAMAYGLDMREFARSQYWIHPALPEVVENAVLGLEWQE

    >gi|227833402|ref|YP_002835109.1| dinucleotide-utilizing enzyme involved in thiamine biosynthesis [Corynebacterium aurimucosum ATCC 700975]
    MLSKDELARTARQRLLPGFGDAAQERLHAAHVLVVGTGGLGCPALQQLAAGGIGRITIIDSDTVDLSNLHRQVLFGVGDV
    GKPKAEVAAARARELSPELTITALKERLDSSNVLDLCSEADLVLDGSDTFDTKYLVADACELTSTPLAWGTVLRYGGQAA
    LWHSGNACADGRGVGLRDLFPAPPNGEALE
    CSTAGVLGATTSVIAGLMATAAVATLGVLPDHRDMIGRVTSYDALPGSFR
    TLKVGPDPERPLISALPGERSLPPELRDGHAALLDISEEPNFFADAVTLPWHTVTDDDSVRRALSACASELIYVACPSGG
    RSAGFVLRYADLAADMGIELRNLPGGLAAHDY

    >gi|227833527|ref|YP_002835234.1| putative secreted protein [Corynebacterium aurimucosum ATCC 700975]
    MTAPASATGVILTEAAAAKAKSLLDQEGRDDLSLRIAVQPGGCAGLRYQLYFDDRTLDGDKVDSIGGVNLVVDKMSIPYL
    TGAKIDFSDTIEAQGFTIDNPNAGGSCACGDSFN

    >gi|227833855|ref|YP_002835562.1| hypothetical protein cauri_2031 [Corynebacterium aurimucosum ATCC 700975]
    MAQQVTFWFDCSCPFAWLTSRWIKEVEKVRDIEVTFEPMSLSVLNKGRDLDPEYMKMMEANWGPARVAAKIAVEAPEKVD
    AFYTAMGTRIHTEGQGGKKGYGAYDDIIKQALDDASLPSTFASVANTEEMDEKLTEFHNRGISEVGDEVGTPVVKFGDTA
    FFGPVITRVPTGEEAGELFDASVRLAQFPYFFELKRSRTESPQV

    >gi|227833863|ref|YP_002835570.1| hypothetical protein cauri_2039 [Corynebacterium aurimucosum ATCC 700975]
    MADIINLVAGVEGDVAQLRERRPEAKENAQASFAALLEPAEPGTFSYAERYAIATFVAGVYQAAPAVDFYSDLLAEESEE
    LAAEITRAVERGITTGPYIDGGFTLFDGSPRLAAALDFAHLLAFHPKDASPAAIGHLQAAGWSDDDIVTLAQLISFLSFQ
    LRVAHGLSVLAGTAQPAPVTEAPRPTQTPEWVPGEGTLVPDVAKPQGFVAHSLGWKPWVPPQPKEEFTDAQRDALIKPER
    IDMEYFRLLARDPAALKARTLTDLDIFYNTDGGLGRAERELAATVVSRLNGCEY
    CASVHQQRAKEEGGDAAAVDRLLEEG
    VDADLGSAQWSAIRDAALVLTKSPFDFDASHVERLEAVGFDTLAIIDVINSSAFFNWANRLMLTLGEPDVPKRFR

    >gi|227833897|ref|YP_002835604.1| bacterioferritin comigratory protein [Corynebacterium aurimucosum ATCC 700975]
    MLRRANLDSPKSPKGEHGKLDTMTEAQRLSVGDKAPAFSLSDDSGNTVSLSDYAGQRVVVYFYPRANTPGCTKEACDFRD
    SLEQLNGMNIAVVGISPDKPEALAKFREDHELNFPLLSDPDKEVMTAYGAFGEKKNYGKIVQGVIRSTFLVEEDGTIGQA
    MYNVKATGHVARVLKGLN

    >gi|227833937|ref|YP_002835644.1| glutaredoxin-like protein NrdH [Corynebacterium aurimucosum ATCC 700975]
    MSITLYTKPACVQCNATKKALDRAGLDYETVDITLDDDARDYVMALGYVQAPVVEAHGEHWSGFRPDRIKALSVMAASA

    >gi|227833998|ref|YP_002835705.1| putative pyridine nucleotide-disulphide oxidoreductase [Corynebacterium aurimucosum ATCC 700975]
    MSHIPTTVIIGGVAGGMSTATRLRRNDEHRTIIILEASGHVSFANCGLPYYVGGVIPKRSSLLLQTPEALKQRFNLDVRV
    NTRVVSIDRDAKTVATEAGEVIRYDELVLSPGATPFLPPIAGIECAFTLRTVEDVDRIAAAVEDKKKAVIIGGGFIGLEM
    AENLHHRGLEVTLVEAAPQIMGPLDVEMAGIVAKHVRANGVRVLTNAQATEISETRVVLQDGQELEADIVIAAIGVRPAS
    ELAQAAGLEISERGGIVVDAQQRTSDPHIFALGDAATKKDFHSGADSLVPLAQTANRHGRLVADVITGRETASLPVLGTA
    IVGLFGLAAAATGWNERRARAEGKNVRVIHLHPANHAGYYPGAAQLHMKLVVDAENDAILGAQIVGEEGVDKRIDVIATA
    MRAGLSATDLADLELAYAPQFGSAKDPINFAGFINDNIARGECTVQWHELQGRLDSGALLVDVRSPQEFAAGAIPGAVNI
    PLDELRERHGEIANHEDVIVH
    CQVGLRGHNATRLLNNLGYDVANLDGGYLTWVNGQEE

    >gi|227834078|ref|YP_002835785.1| thiosulfate sulfurtransferase [Corynebacterium aurimucosum ATCC 700975]
    MQNVQPTEVPENAQLIDVREDHEWNTEHAQGATHIPMGDLVERLDEIDPDRDIYVICHAGGRSMQVCQYLEQAKGWDVIN
    VEGGTDGWKAQGCPMVYPNH

    >gi|227834227|ref|YP_002835934.1| Peptide methionine sulfoxide reductase [Corynebacterium aurimucosum ATCC 700975]
    MFLFTPEPKLVAAEDALPGRAEPVLDNPQPHAVLGTPITGPWKEGQKSLIIAIGCFWGAEKMFWETEGVESTSVGYAGGT
    TPNPTYYEVCRGLTNHAEAVQITYDPQRVSLRDLVVKALEAHDPTQGFRQGNDVGTQYRSAFYPETEEEREVIQQLVDSY
    AGKLADAGFGATTTEVTLLSETDSGEYYLAEDEHQQYLHKVPNGYCPHHSTGVKCG

    >gi|227834254|ref|YP_002835961.1| thioredoxin [Corynebacterium aurimucosum ATCC 700975]
    MATIDITEDTFQETISGDGITLVDAWAEWCGPCKRFGPVFEKASEEHPDATFAKLDTEANQELSAKLQIQSIPTLMVFRD
    GILVFREAGALPPAALEDLIGQVKALDMDEVRAQVESQKAE

    >gi|227834256|ref|YP_002835963.1| putative cation-transporting P-type ATPase [Corynebacterium aurimucosum ATCC 700975]
    MTTSLTLGITGMTCTSCSSRVERKLNKLDNVEATVNFATESASVSYDPATTTPADLIDVVEGAGYGAFTMDGEGEEPAST
    AEDARESEASDILQRTLLSAALSLPVMLLSMVPALQFQHWQWACLMLTTLVYVIGGAPFHRATWANLKHGAATMDTLITL
    GTTAAFGWSLYALFFGDAGMPGMTMHMTLRSNDAQMDHIYLESVGMVITFLLLGRWFELKAKGRSSEALTTLLTMGAKEA
    TVLRDGTETRIPASELHVGDVFVVRPGEKIATDGVVLSGHSAVDESLLTGESMPVEVSPGSTVTGATINASGRLEVRATR
    VGSDTVLAQMGALVTAAQTSKAPVQRLADRIAAVFVPIVIGIALLALVAHLLFGGIAPAFVAAVSVLIIACPCAMGLATP
    TAILVGTGRGAELGILIKGPEILESTRQIDTIVLDKTGTITEGQMSVGAIQSTAGHTQQDVLRLAAAAEQGSEHPIARAI
    RTAYDGELPTAEDFHELPGQGIEATIEGAHVRVGRPPAGYEGTGTQVGVYVDDTLAGSIELQDRIKESSAAAIAAMHKLG
    LTPHLLTGDNAGAARAVARAVGIDDANVTAEVMPADKVDTIARLQEQGRTVAMVGDGVNDAAALAQADLGIAMGAGADVA
    IEASDITVMNNDLRSVAEAVRLARSTLRIIKGNLFWAFAYNIILLPVAAFGLLNPLLAGLAMALSSVFVVTNSLRLKSFT
    PEE

    >gi|227834270|ref|YP_002835977.1| hypothetical protein cauri_2448 [Corynebacterium aurimucosum ATCC 700975]
    MTIGKILLYYCFTPIEDPTAIMLWQRSLCEKLGLKGRILISEHGINGTVGGDMDACKRYVRETREYPGFKKMEFKWSEGG
    AEDFPRLSVKVRDEIVAFGAPGELKVDENGVIGGGVHLKPEEVNKLVEERGEEVVFFDGRNAMEAEIGKFKNAVVPDVRT
    THDFIAELESGKYDWMKDKPVVSY
    CTGGIRCEILSALMKNRGFNEVYQIDGGIVRYGEKYGNDGLWEGSMYVFDKRMHHE
    FGQGLEDPGFIQLGHCVHCGKGTNTFHNCINEDTCRKQVLICDDCIQHVETQHCGRPDCAEVAASQAQA

    >gi|227834352|ref|YP_002836059.1| Thioredoxin reductase [Corynebacterium aurimucosum ATCC 700975]
    MTIHDVAIVGSGPAGYTAALYAARAELNPIVFEGFEYGGELMNTTEVENYPGFQKGIMGPELMEEMRAQAIRFGADLRME
    VVDSVELEGEVKKLHVGDEVYEARAVILATGAAPRYLGIPGESELTGRGVSA
    CATCDGFFFKDHNIAVVGGGDSAMEEAT
    FLTKFAETVTIIHRSENFRASKIMLERAKENPKIKWLTNTTVERVLEKDGKVGALEVKNVLTGETSELDLTAMFVAIGHD
    PRSGFLNGQVETDEAGYVVVEQPSTKTSLPGVFACGDLVDDHYQQAITAAGSGCRAAIDAEHFLAENR

    >gi|227834353|ref|YP_002836060.1| thioredoxin [Corynebacterium aurimucosum ATCC 700975]
    MRNIKNVTTDSFRADVVEAGKPVVVDFWAEWCGPCKKLSPILEEVAEELGEDVSVVKVNVDEERTLGAMFQIMSIPSVLI
    FKDGEKVDEFVGLRSKADIVAQVKKQL