Coraliomargarita akajimensis DSM 45221 uid47079

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|294053551|ref|YP_003547209.1| arsenate reductase-related protein [Coraliomargarita akajimensis DSM 45221]
    MLKIYCYKNCGTCKKAIKWLEQAGVEFKVLPIRDTPPSVEELKAMLTYQQGELKRLFNTAGGDYRELNMKERLQKLSEDE
    AFELLHSRGNLVKRPFALGDNLGLVGFKEAEWQAALGL

    >gi|294053638|ref|YP_003547296.1| protein of unknown function UPF0061 [Coraliomargarita akajimensis DSM 45221]
    MGIPFDNTYAKLPARFYAVQTPTPVAAPGLIRVNYALAEHLGIDPRWLESAQGIEVLAGNAVPDRAAPISQAYAGHQFAN
    FVPQLGDGRAILLGEVIASNGQRYDIQLKGSGPTPFSRRGDGRSALGPVLREYIVSEAMHALGVPTTRALAAVTSGETVY
    RGDLQAGGVFTRIARSHLRVGTFQYFAALQDHEALRMLADMAIARHYPEAAEAAVPALALLDGVIASQARLICHWLGFGF
    IHGVMNTDNCAISGETIDYGPCAFMEQFHPQCVFSSIDQQGRYAWGNQAQIAYWNLTRFAETLLPLIHDDQDQAIKQAEQ
    SLDAFPSVFESVYRDTFAAKLGLVPQQPGNPGLIKHTLEQLAEQQIDFTVFFRRLTRVAQGDDTAEFVALWQTEAAGRDW
    LQAWHNLAQPETQLSAMLGANPVRIPRNHQVERAIQAGYAGDFSPFHRLVDGLGQPFADQSEYADLETPAAPEERVTETF
    CGT

    >gi|294053728|ref|YP_003547386.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Coraliomargarita akajimensis DSM 45221]
    MPKPTPLEAGQTAPEFTFEIDGTEISRSELNSYCLLYFYPKDNTPGCNKEACAFRDEWSACKAAGLMIVGVSKDSMTSHE
    KFRAKFELPFPLIADTELELASAYGVWGEKKFMGKTFDGVHRMSFLIDPEGTIVKAYHKVKPAAHAAEVLNDLSTLAN

    >gi|294054203|ref|YP_003547861.1| glutaredoxin [Coraliomargarita akajimensis DSM 45221]
    MSETSDNREAIWHYVLDGQQQGPVTESELSELLKSGQLSPDSLVWRQGMVEWQAMNVLAELKEMTKPATPSKLQLRPTPP
    PLARDDESPSSNTEGDAAPERNIEQLLQHASRNDPHMEPPKAGIWRGRSLEYKLTFLIVLLTVIGAAVCQFMGSSKLSEL
    TALPVYFPFVLVWCLLALAAGSLFANILYYVRLFQIGILWGLMSLFIPIVGLIATLLNWAFIWRCFMLNVLFVALIMATG
    HQLIEYSKEQPEFQQWIEESVKRLEREAQAYQESTRSSQQNTVLVYSTSW
    CGPCKQAKALLRKHGIPFKDYDIESNAPAR
    REFEKLGGRGVPLLVINGTVLEGYDERRILKLCGK

    >gi|294054210|ref|YP_003547868.1| FAD-dependent pyridine nucleotide-disulfide oxidoreductase [Coraliomargarita akajimensis DSM 45221]
    MQHFDYVVIGGGSGGYAAARTAREVCDQVAIIDGAKELGGLCILRGCMPSKTLIYSAEILHLAQKGRQFGLDLQSAEVDM
    PLLHQRKLDIIKEFSDYRQEQLESDRFTLFRNNAHFISENCIELDNGEQITADHFMVATGSAVAVPPIVGLGEVPFWTSD
    HILDLDFLPSKIIVLGGGIVACELTQFLRRIGSEVIQIQRSSSLLKELPESAAAVVAQAFKDEGIDVYTDTAIESVSHTD
    GIFTVQFKHANQSIQVTAPYLLNALGRVPASDQLNLPAAGIECRPSGHIRCNEYQQTTNSKVYACGDVAGPHEIVHIAIM
    QGEVAARHATNRSAEPVDYETLSSVVFTDPQVAQVGKTETQLQAEGLDFLVADYPFDDHGKSILMEAKYGYVKVIADKAG
    TVLGAECVSKDAGELIHTMAVAVSLKANVRDLLKVHWYHPTLAEIWTYPIEDIVDEL

    >gi|294054259|ref|YP_003547917.1| thioredoxin [Coraliomargarita akajimensis DSM 45221]
    MSSEVLHISSEAAYKQLVQSGQPLLVDFWAPWCGPCRALGPVLDEAARESGESAIIAKVNVDELPALAREHGITSIPALL
    YFADGKLQERATGVQSKEAILSQLASLDGIGA

    >gi|294054321|ref|YP_003547979.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Coraliomargarita akajimensis DSM 45221]
    MELCMRVILCVLLVFSGLLRADEFRTWTIVGGGYFEAKLKAVGNTTATLENREGRTIDFPLSDLKPSDQEYVRTWQSKQK
    TSVSSQAVFVERSEFAERVFKDLVYSKGKRLANFKPEPTDNPKYFAFYFSAQW
    CPPCRKFTPKLVDFYKKHQGKGAHFEV
    IFVSSDRSEDEMARYMKEYDMEWPAFELGKNKDIVQRNGSGIPNLVVTDAQGNKILDSYDSSGKYTGPSRVLAELEDLL

    >gi|294054397|ref|YP_003548055.1| iron-sulfur cluster assembly accessory protein [Coraliomargarita akajimensis DSM 45221]
    MTEQSTSVLPEGVREGNEKLIAVTEPAGVKLQSLIEREQKGDYLRVKITGGGCNGLSYKMKFVATAKRGDILVRSSGAQV
    VVDSKSALYLRGTELDYSDKMVGGGFKFSNPNAKASCSCGESFSI

    >gi|294054459|ref|YP_003548117.1| methionine-R-sulfoxide reductase [Coraliomargarita akajimensis DSM 45221]
    MTKFSARLLIAGAVCAGFTLSLFAMPEKKSKDSTHTDIDISACASACALPSHVDLESGVFPVTRTDAEWKERLTELQYHV
    ARKQGTERPFQNPYHDEKATGLYRCVGCDTPLFSSTDKFDSGTGWPSFTKPIDERTLGEHRDTSYGMIRTEVHCAVCGSH
    QGHVFPDGPKPTGLRY
    CINSASLKFEQAESAEQVQELVQAWYEAGVDG

    >gi|294054471|ref|YP_003548129.1| thioredoxin [Coraliomargarita akajimensis DSM 45221]
    MSDKISELDSSSFDSTISSTSVPVVVDFWAPWCGPCKAIAPILEELADELGDAVKICKVNVDNNSDIAGKFAIRAIPTIL
    VFKDGEVAETIVGLTSKDDLKAKLA

    >gi|294054559|ref|YP_003548217.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Coraliomargarita akajimensis DSM 45221]
    MRRILIALSLFSLAQLSAESNLQTQLDQKKASSPIDAATRATMQAAIDDLAQTQIVEKAVQRGQKAPDFTAPKVDGDGVF
    TLSEALKDGPVVLVYYRGDW
    CPYCNVQLMEYDKHVQTIQSHGAQLVAISPQTVENRKYAGEANPFSFGILMDPDNRIARS
    YGIAFELPAEIEALYTKFGFDLHIENGSDRAELPLAATYVIDTKGTVVYSFLDADYTKRAEPDAIIEVLKEL

    >gi|294054570|ref|YP_003548228.1| Methionine sulfoxide reductase A [Coraliomargarita akajimensis DSM 45221]
    MSQGLDTIYLAGGCLWGVQEFVRHLPGVVQTEAGRANGTSSSTATEYDGYAECVRTLFDSKQLTVDQLMRYFFEIIDPYS
    LNRQGPDVGEKYRTGVYSENPQHLDDARQFIAQRHDADRIVVEICRLTNYVRSDREHQDRLSRCPEDQCHLPKALLHKYK
    V

    >gi|294054626|ref|YP_003548284.1| dihydrolipoamide dehydrogenase [Coraliomargarita akajimensis DSM 45221]
    MSEIQNFDLIVIGSGPGGYVAAIRSAQLGFKTAIVEKSPTLGGTCLNVGCIPSKALLHSTEMYHFAGHGAAEHGIDLTNL
    SISIEKLMAKKDKTVEQLCGGVAHLMKANKIDVFHGLGSLEGDGKVHVTGGKENQMLSAKHIVIATGSSVIDLPFLPQDG
    ETVVGSTEAIAFEQVPEKLAVVGAGAIGLELGSVWARLGSKVSVVEFLPAVAASYDKDVSKLAERAFKKQGLEFHLSTKV
    TGLRKEAGKTFLTAENKKGEAIEIEADKILVAVGRKPNTDGLNLKKVGLSTDERGRIPVDKHFQTSVSGIYAIGDVIEGP
    MLAHKAEEEAVACVELIAGQAGHVNYDVIPNVIYTEPEIASVGITEAIAKDQGVAIKTGKFNFAANGRAIASDGTEGFVK
    VIADKESDRLLGVQIIGKGASELIASAVSHMEYGGSAEDLGRTIHAHPTMSEAVKEAALAVDKNAIHSV

    >gi|294054728|ref|YP_003548386.1| iron-sulfur cluster assembly accessory protein [Coraliomargarita akajimensis DSM 45221]
    MITLTDSAAAQIRKMQAEKASDGQRLRIFVEPGGCSGFEYGMSFDDVKEADQELESNGVPFLIDATSLEYLDGSVVEFDD
    GLNGKGFEIKNPNATSTCGCGRSFN

    >gi|294054895|ref|YP_003548553.1| Redoxin domain protein [Coraliomargarita akajimensis DSM 45221]
    MKILSTLLTLVAFIGASSITHAADSKTAFETAITQNLVQLKDGKLQPIAADSLGAKDYYAIYYSAHWCPPCRKFTPKLVD
    YYNEAKGHHDNFEVIFVSSDRSASAMEGYMKETGMKWYGLQFDKKKESKEVTQFVGRGIPHLVVVDKNGKILSDSVVDGQ
    YVGPYKVLDDLKDILHQ

    >gi|294054959|ref|YP_003548617.1| transcriptional regulator, AraC family [Coraliomargarita akajimensis DSM 45221]
    MVKTELDVTKDYTRVARAIEFLREQVHGQPELSDLAAHLELSESHVQRLFSRWAGLSPKRFVQLLTLESAKQQLAKSADV
    LSASYDSGLSGPGRLHDLFVSLEAVTPGEFKRQGGGVRIEYGLHACPFGWCFIGQTERGVCYLEFTDDDLEQALARLQAR
    WPGAELVASEGQTAQTADGIFHRSQVGGSSLHLLVRGTNFQVQVWNALMRIPQGHLMDYAGVARWIGNPAATRAVGTAIG
    ANPIAWLIP
    CHRVLRGDGSLGGYRWGTTRKSACLLYEQGRCRADQR

    >gi|294054999|ref|YP_003548657.1| Copper-exporting ATPase [Coraliomargarita akajimensis DSM 45221]
    MLHEAKLTRCEHCSTPFTPKTDERFCCQGCFYVSQVLHDDGLERFYELKGEKSVPPVGSKVFQDAHTHWLESAQNDAETD
    SHVRVASIELGIEGIS
    CLGCVWLIEAVFKRQVGSSNIRIDPRTSTVGISWIPEQFNLAEFARNLQQIGYRLAPDAGNTAE
    YSGTRQLSFRLGLCGFFLMNTMLFTLPGYLGMGGDFFLAPIFQMLGALFATLSLVVGGGYFIARAWKALQNKVLHIDLPI
    ALGLMAAYAGSMIGVATGYTSLVYFDFVATFVFLMLAGRWLQEFALSHNRAQLQKQHSGPREITLIGGADDGKRVPVSQI
    ETGQLFSVSPGEINPVASELQDDAANLSLEWINGEADPVVWKPERIAPAGAINVGLHALNFKAKESWDASLLAQLLERAD
    DSFSNRRLQQILKTYIGIVLALGLLGGMAWLASTGDVLKATQVLISVLIVSCPCALGVALPMCDEFANARLRRAGLFIKS
    SDIWERLRQVKTVVFDKTGTLTMDVPRLLNPDAIENLDPLSTQALFVMVEHNVHPVARSLRESLMATHPQLVRSAHQEAD
    RISLEESIGNGVSWTDSGSIHWSLGKPLWNPHGERHAPAPELETAHTVLRQNGLIVAAFKFAEDVRDDANEALNQIRIHG
    MNTAILSGDAHARVSTIAEQLSLPREVVRAECSPRDKANWIEQHAPKSALMIGDGANDSLAFDSAICRGTPVVDRSILES
    TADFFFFGRSLRSLPILFGTALARRRTVATVFGTAVCYNVLAVGLCLSGHMHPLLAAILMPLSSIVTLLISWIGLRSAR

    >gi|294055344|ref|YP_003549002.1| thioredoxin reductase [Coraliomargarita akajimensis DSM 45221]
    MEDVIILGTGCAGLTAAIYTGRANLSPLVLEGTQPGGQLTTTSEVENFPGFPEGIDGFTLMDNLRKQASRFGARFEHAKV
    DKIEVEGDVKKLIAGDKVYEAKTVIIGTGARPRLLGIPGELEMFGGKGVTT
    CATCDGAFYRDMEVVVVGGGDSACEEALF
    LTRFCSKVTLVHRRDELRASKIMADRAVNHEKIEMAWNSLPQEVLADEQGFTRALLVKDAESGEEREIPCKGAFIAIGHI
    PNTDFAEGILERDAEGYIVPVLGSQVLTKVPGLFAAGDCVDHVYRQAISAAGMGCQAAIEAERWLLEQS

    >gi|294055389|ref|YP_003549047.1| Rhodanese domain protein [Coraliomargarita akajimensis DSM 45221]
    MNKEISASDAYKMFEQGDVILLDVRDADELEICKIDGAQHIPMTQIPQNLDHLPRDQRLVVFCHHGMRSQHVCLFLEGHG
    LDNAVSMTGGINAWTDEVDPSLQRY

    >gi|294055398|ref|YP_003549056.1| glutaredoxin [Coraliomargarita akajimensis DSM 45221]
    MKIIAYLKPTCGWSMGVRAIMKKYELEYEDRDIINNPDQYAEMVEKSGQPLSPCVEINGHMLADVSGEEVENWMLSQGLI
    EANAREADAPTNAPCTDEEHEAMRSKTIRFF

    >gi|294055489|ref|YP_003549147.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Coraliomargarita akajimensis DSM 45221]
    MALSTGTKAPEFTLKTKTAEGLEDISLANNFGKQKTVLLFFPLAFTSVCMEEMCSVSSGIQDYTNLNAAVYGISVDSPFC
    LEKMAAVDNLQFPLLSDFNKEVSAAYDVLFEDLIGFKGVSKRSAFVIDETGSIIYAESSDDPKQLPDFEAIKAALK

    >gi|294055694|ref|YP_003549352.1| cytochrome c biogenesis protein transmembrane region [Coraliomargarita akajimensis DSM 45221]
    MRFLASLFLCLQFGLWAQFLQAAPQQVQHATVELIAEQAVVRPGDAFTIALRYELDDHWHLYWENPGASGFPPSVEWDLP
    EGVEVGALQFPAPERFELAGLVSYGHEGVVLFPMQVTVASDYAGERLRLKGQASWLLCKDVCIADDAELSLDLSVGDTGT
    LSKSAASIQAAVSALPEPFEGQLESAIEGKEFVLKVRSAEVWSEADVYFYSLPEGLVDPNAAQDVEWTGAAVEIRVALSD
    YADGIEDFGGVLQVGERRFELPMGLIGAVSGSLSNSAVSGTADSGAIGFEERLLQLGPVGWLILAFVGGLILNFMPCVLP
    VLSLKVFSLLKHTGQSRREAMAHGLAYTAGVVLSFIALAGVLFALRAAGELIGWGYQLQSPGFTLGLTVLFFVFGLNLMG
    VFEIGVGLVGADAKVSQRNDLIGSLGMGVLAAVVGAPCMGPLVASVSGIAIQASIFEGLLIFGTMGLGLASPFLLLAIFP
    KFAAFLPKPGAWMETFKQVMGFLLMLAVIFLAGVVGRSGGIPAMMTLLIVLFLSALGAWIYGRWGAPVKTPGTRRIALGL
    ALLLIVGGGAYGAKSIKQAYLDNVGEHQLDGAWATWSPERVEQELEAGNAVFVDFTASW
    CLICQANKIPLRSDEIEMLFE
    DEGIVSLEADWTLRDSVIAQVLEQYGRAGVPLYLLYTPDGEVVELPQNLTRGIIRSAVEDAL

    >gi|294055695|ref|YP_003549353.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Coraliomargarita akajimensis DSM 45221]
    MHMKTKTGLVLGCLLLLAGLVQAVPSGELAPDFSVKDSAGTSHLLSDYKGKYVVLEWTRYTCPFVEKFYDEGHMQALQKE
    FTDQGVVWFQVASSAPGKSGYLEPASLQRIRERDGTHSTATLVDSSGAVGRLYDARTTPHMYLIGPDGVLLYQGAIDSIR
    SADTADIAKATNYLKQAYEAAVAGEPIKPAATKPYGCGVKY

    >gi|294055731|ref|YP_003549389.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Coraliomargarita akajimensis DSM 45221]
    MKIIRLTLLCLLGISSSCIHANDSGLAVGESLPSLMVTDDQGQRFDLANFVNTGTVVIFFYPKAHTGGCTKQACSLRDGS
    ETLREQGIRVLGISSDSVEDQASFREKHSLPYPLIADTDQRVAKAFKKSKWARQAYIFKEGKVVWRDLSASTSKQYEDIQ
    AALKTL

    >gi|294055744|ref|YP_003549402.1| protein of unknown function DUF1573 [Coraliomargarita akajimensis DSM 45221]
    MKFLQTLFIFFLVSVAQASTLIWDRTEARVAMKPEQAVAKAEYTLTNNSDAPLRISKVSSSCGCTGTVIGKRILNPGEST
    EITAKFSKGKRTGTNHNKLAVYIDEQSKPVATLHFIVDIPELIRTTPQIVYWNSKTSKTPRTIEVSLNDQYIDKLDSIEF
    DAALVSVERVVSQDNASHFQLIVEPVDYSQPLRHSIEIKCQSKSGDPVSSKVHAFAHP

    >gi|294055746|ref|YP_003549404.1| Rhodanese domain protein [Coraliomargarita akajimensis DSM 45221]
    MSLFREFCILAALVLCGTGYSLFSGLASPGEAPPLPPGAITLSDTTGLNFIWLDVRSEADYSEAHIPEALHFDSAEWDQS
    LIALMDTWGPQPRPIIVY
    CSSESCDSSEVIANRLRDALQAEVYYLKGGWAAWSSANK

    >gi|294055842|ref|YP_003549500.1| FAD-dependent pyridine nucleotide-disulfide oxidoreductase [Coraliomargarita akajimensis DSM 45221]
    MNTQNDNPHIVIVGGVAGGASAAARARRLNEHARITLIERGPDVSFANCGLPYHIGGEIEDRSKLALQTPETLKAQLAVD
    VLAETEVTSINRDAKAVTLRTVGSDESSELAYDKLILSPGASPLTPPLDGIDLPGIYTLRNLQDMDRIKTAAQEAKSALV
    IGAGFIGLEMAEQLKHIGKDVSLIELADQVLPQMDPEMVRIVEQELIDNGINLVLGDGINGFAQNGSSLQAKLNSGQTLE
    ADIVILSIGVRPESGLAKDAGLELGARGHIKANRHMQTSDPDIYAVGDVSETVDPILGGPTAIALGGPANRQGRTAADHI
    FLGDQARPYPGSIGTSIVRVFDIAAGVTGFTEKRLQVMGIEYEKTIVTDYNHASYYPGATHLSVKVLWDKTTGRILGGQS
    NGIDGVDKRLDVLATAIKGKLTVEDLEHMELAYAPPFGSAKDPINTAGFSANNIRSGNYTPAYELPSNDSVQIVDVRPAE
    MAALKPIPNTRNIPYGQIRHRMDELDKSKPVITV
    CALGKTSYFASRILKQNGFNVSSHVGGWRIEAKPKPPASKTAFTSH
    THTADSSINTTETIVKLDATGLACPGPILRVKEAAAELKPGEILEVRSSDAGFKNDLPPFCKANGYEFISAEKEKGIVTG
    RLRLSGTPAALTGVATPVATPSANGSTLVVFSGEMDKVMAAFVIANGAIAMGGKATLFFTFWGLNALRKDSPPEIKDKTF
    MDKMFGWMLPRGVNKLPLSNMHMAGMGTKMMKDRMADKKLPNLPDLMQTAIDNGARLVA
    CGMSMEAMGIREEELIDGVEI
    GGVAEFLGAASETNTNLFV

    >gi|294055926|ref|YP_003549584.1| hypothetical protein Caka_2398 [Coraliomargarita akajimensis DSM 45221]
    MKPNVEIEYCPGCRWLLRAGWTAQELLTTFERELGSVSLKPSEAGGRFTVTLDGELVWDRKAEGGFPEMKQLKQRIRDRI
    APERDLGHSDYKKGGLDG

    >gi|294055983|ref|YP_003549641.1| dihydrolipoamide dehydrogenase [Coraliomargarita akajimensis DSM 45221]
    MANLEKYDLVVIGGGPAGYAAAIRAGQLGKKVACVEQERPGGTCLNWGCIPSKALLKSAELFNKINHCDDFGISVTGAKY
    DFSKIIKRSRGVSDQMARGVEFLFKKNKVDYIKGVGTVNVPGMVEVTDGPDKGKILSTEKILICTGCKPRTLPGLEVDGE
    RIMTSRQALEMKQQPKSIVIVGAGAIGAEFAYFLNAFGTKVTLVEMMDQVLPVEDHEVAAVVEKEFKAGGIDCRTSTAVE
    NIQVAAKNVKMDLVKGDKKESITADSVLIAIGVVPNTQGLLSPRMKLAEDRGYLKVDDNYETSVKGVYAAGDIIGPPWLA
    HVATYEAVQAVQGMFGHGKAKKVGDFPGCTYCIPQVASIGKTEKKLKEEGIKYKVGKFPFMASGKAVAGGHPEGFVKMLV
    DEKYGEVLGAHIVGGEAPEMIAEYGLGMKLEVTAEEIHNTIHAHPTMSEAVMEAAATVFGEAIHI

    >gi|294055992|ref|YP_003549650.1| hypothetical protein Caka_2464 [Coraliomargarita akajimensis DSM 45221]
    MIFKPCTVKSAWIKVGIAAALLFCALCSHAASGGARLLPRPDSVGQLYAVKGLSLQRSSFDAKTEVVVLFYAASWCIACK
    QISEPLKDLYPELKANYPRLELLTFSRDDSVSARASHLRKSAYPWPAVGPSAAKQRDWQIDLEGGIPQFQAFVLEGEQMR
    AITPPGTIGSVLGEVDAFFAPDK

    >gi|294056059|ref|YP_003549717.1| glutaredoxin [Coraliomargarita akajimensis DSM 45221]
    MLPILYVKTGCPWCTEAMAYFNSQGVELDVRDVSTSPKDMDAMVAISGQTKAPTFEYEDFVVADFSVDEFLAELNDFPEV
    RHNLGISDTDS

    >gi|294056088|ref|YP_003549746.1| peptide methionine sulfoxide reductase [Coraliomargarita akajimensis DSM 45221]
    MIRHLLPLLFVSLAACAKPDTTESTNMETKAKTELATFGAGCFWCVEAVFEGLDGVHDVQSGYMGGEVKDPTYREICSGL
    TGHAEVIQIQFDPETVSYETLLDWLWRSHDPTTLNRQGADTGTQYRSAIFTHSDVQQKAAEASKIAAQPAFKDPIVTEIT
    PASTFYPAEAYHQDYYKLNPNAPYCQVVIKPKLKKLELE

    >gi|294056134|ref|YP_003549792.1| arsenate reductase-related protein [Coraliomargarita akajimensis DSM 45221]
    MKGIVSFYEKPGCTRNALQKEQLRAAGYVIQALSLIDKNWDPQSLYRFFGGNSPHDCVNTRAPQITSGALAPSTLTEDEL
    LEQMRAHPILIKRPLIFYRGEYCCGFDTALVAKLLGAKQTDPGCAHPTGGHCS

    >gi|294056178|ref|YP_003549836.1| FAD dependent oxidoreductase [Coraliomargarita akajimensis DSM 45221]
    MLDLVKVTFDKWCVEYEVVIVGAGPAGIGCGLALRRAGAERVLVLEANRVGASFRCWPEQMRLITPSFHANPFFQTDLNA
    VTPDTSPADFCQKEHLSGNEYADYLTALVRHFELNVQAQSAVVQLVPEADGFTVHTQSGAYRARTVIWAGGEFAHPKLAG
    FSGAEH
    CAHSSVFRNWEDFQGEEALIIGGYESGIDAAYHLVALGKRVVLLSHDEPWKADHSDPSEALSPYTRERLLKIFE
    TWPERLTLHANAEVVAVSRMSERYVVETADGRIFDSKYRPIAATGFHSALMPIKDLFDWKGSIPVFTDEDESTLHSGLYY
    SGPSLVQHDSKFCFIYKFRARFGVIARSIVQRLGYPEPDLENDRRRGFLVDDLKCCTSCDCAIESEASR

    >gi|294056226|ref|YP_003549884.1| UBA/THIF-type NAD/FAD binding protein [Coraliomargarita akajimensis DSM 45221]
    MSQLTTDEILHYQRHLTLPGFGEAAQLKLKAARVLVVGAGGLGCPVLQYLAAAGVGTLGIVDDDVVSLSNLQRQILFTAD
    QVGQPKGQCAAERLQAMNPHVRCVAHPFRLGLDNALELIGQYDLVVDGTDNFPTRYLINDACVLAGKPLIYGALYTFQGQ
    ASVFNYQGGPTYRCIFPEPPKPEDSPN
    CSEIGVVGVLPGLIGTIQATEAIKVLTGVGEPLSGKLLLWDALSMQPQVIRFK
    RVPEQAEVRELKLIEFTCSVAHKESVVDVEPTELQADTSDYQLLDVREGWEREICSLPGAHIPLGVILDGQADFAAAGLD
    PDKLTYVY
    CKGGVRSLKAAEAMQAEYGFKQLRNVRGGILAWAAQVDAGMQAY

    >gi|294056406|ref|YP_003550064.1| peroxiredoxin [Coraliomargarita akajimensis DSM 45221]
    MSQINASIPEFNAQAYHNGEFKSVSSEDVKGKWSVFFFYPADFTFVCPTELGDLADHYAQLQELGVEVYSVSTDTHFTHK
    AWHDASDTIKKINFPMVGDPTGTITRGFDVMIEEEGLALRGTFVVDPEGKIKVVEVHDLGIGRSAADLVRKVQAAQYVAN
    NDGEVCPAKWQPGEETLAPSLDLVGKI

    >gi|294056407|ref|YP_003550065.1| alkyl hydroperoxide reductase, F subunit [Coraliomargarita akajimensis DSM 45221]
    MLNDQILQTLREYTKHLSRTVELRLYAGQHEKRAELIRMLEGVASVSDKLSFRAVEDDTIAVREGLTFELVADSEPTGVL
    FSGIPGGHEFNSFILALLQAGGSAIKLDEGLQRQIRAIDADLMFESFISLD
    CHVCPDVVQTLNQLSLLNPRIRHEMIDGG
    LHPALTEERKIQGVPTVFVNKKPFSSGQISAAQIIEKLTQDFDLSAEAVESDDTVYDSVVVGGGPAAATAAIYLARKGLE
    VAIVAEKFGGQVSDTVGIENVTSISEITGTQLTQNIRQHLGQYPIKVRENIRVKELKQLSGLKALELSTGEVLQAKTVVL
    ATGAQWRQLGVPGETENVGKGVAY
    CPHCDGPYFKGKDVVVVGGGNSGVEAALDLSAIVKSVTVVEFMDSLKADKVLVDKL
    QATANAEVILSAATNRIQANDTGVTGIELKMRETGELVTRPVDGVFVQIGLAPNSGFVNELVDLNPRGEIVISPKCETSV
    SGIFACGDVTDTPYKQIIISMGEGAKAGLAAFEYLLTHESADA

    >gi|294056558|ref|YP_003550216.1| protein of unknown function DUF255 [Coraliomargarita akajimensis DSM 45221]
    MPNRLSEENSLYLQQHAKQAVNWYAWGSDALEAAEQEGKPLLVSIGYSACHWCHVMAHECFDDDYIAGLMNKHFICVKVD
    REERPDVDQVYMEAVQMLQHQGGWPLNVFCLPDGRPFFGGTYFPPEDNGSGMIPWPQLLMRIADHFKRSPQELIENADAI
    QKNILAGATGGTHSEWTDTLIFDAAEGIVGNHDDQYGGFGKAPKFPPSMTLNFLRSVCLHKEVPASLATRIRALSDQTLK
    AMAHGGIYDQFGGGFARYSVDPHWLIPHFEKMLYDNALLIEAYTRGWLDQQEPLYAAIVEETVGWLNREMLSPTGIYYAA
    LDADSDGGEGRYYVWEPEEIDSVLGLESGRALRTAYGISLEGNFEDGLSNPALADEDFGKRQALAEARERLREHREAQRT
    RPGRDEKLNTMWNCLAIRSIAEAAFYFDRTDWMAGAVKAADFIWDELVNRTKDGPRISAVYYEGAGAQVTGYLHDYATAA
    DAFLLLSGKSDWYQSGTGEIYRERGLALLDAALELFEDPHSIGYYYTAEGAETPVARRKEWFDNAIPAGNSSLLHALSMA
    YALTGELRYAGVLNSMRTAYTDYAQQVASGVAHSLEAFANHSVGIAVCKVREGTDLSAIQLALTTVHWRRIYIQVVAEDE
    LSESYQLCLGSECMAPTSDCKVLIDQF