Coprothermobacter proteolyticus DSM 5265 uid59253

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|206895272|ref|YP_002246408.1| dithiol-disulfide isomerase [Coprothermobacter proteolyticus DSM 5265]
    MEIEFFHDVLCAWCYALSPRLRRLTEEFPDIKVIHRGFPLAPEPNDIVQMFGSKEKGKRDILQHWKAANMNDDEHRINAE
    LMEQRDFDYPYSTPALLACKAAELQGGQAMHWNYFDKVQEAHLTLCRNIADFDVLTDIARELSLDVEKFSADLRGEQVKY
    LLRLDIDRALELGVEATPTLVANDGMLTGAVPYDSLKRWYVKVRQ

    >gi|206895244|ref|YP_002246428.1| redoxin superfamily [Coprothermobacter proteolyticus DSM 5265]
    MFEEQTRMPLIGDKFPELEVKTTFGPMKLPDDFNGKWVVFFSHPGDFTPVCTTEFVAFQKRFDEFKALNTELIGLSVDQV
    PSHIKWVQWIKDNLGVEIQFPIIADELGRIAKALGLIHPAKGTNTVRAVYIVDPKGIIRAILYYPQEIGRNIDEIIRMIK
    AFQTADANHVAIPANWPNNELMGDEVIIPLPPDIKGAEERMNQPNCYDWWLCHKKI

    >gi|206896099|ref|YP_002246515.1| bacterioferritin comigratory protein [Coprothermobacter proteolyticus DSM 5265]
    MEHWQEIELVDLDGRSVRISDFQGWKVLYFYPKAMTSGCTMEAEDFSRLYEDFKTLGVTVIGVSTDNVERLKKFKEKVGI
    PFVLLSDPNHALAEALGVWKEKNMYGKKTMGIERSTFVINPDNQIIKEWRKVKVAGHAQEVFDHIKEFMKN

    >gi|206895631|ref|YP_002246538.1| cadmium, zinc and cobalt-transporting ATPase, putative [Coprothermobacter proteolyticus DSM 5265]
    MRTTLTATQLKCPKCAVHIEEEIKKKNLARDLVIDVPTGIISVEADEEQLIQIKRLLSQAGLYHEEHEERTERFITISGL
    VLFAIGFAAIRLSPPVGITFLVVSSIINGYPRVHELVHNLSVGVLDIFDENLLMLLGGTGGFIAGAYVEAAMVFNLYALA
    EIIEESVKKKAQEGLRSILTDIPDSAMLIKEQQLVAVEVEQLKAGDHIRFTAGDTVPVDVVLLSPALVDESVITGESAPV
    NHEPGDMVLSGSKLLTPCDAEVLRPLQESNLAQVQKTIAQTLSRKSAFRSWMERFTNVYSPLVLISAVAVFLFGLLSGNA
    FSVAVYRSSVLLLIACPCSLLLASPSAVSAAVSTLARQGVLVRNTDALEKLPQVGTVIFDKTGTITTGRMKITEAQISDE
    HLALVASVESYFKHPVADAIVAYAAEKNIVLKEAKVRQNGNVITGEIENHQVELTMKDLLQVKVDGMDVGFFKVEEELRD
    EAPWVIQRLKDQGYKIIILSGDQHEKVETLARQLKVDEYYANMTPEGKQAFVKELEKREHCLMVGDGLNDALALSEAHVS
    VALPDRRIKTIVETADFILSGTLTPLVNLPSYAQSYTSTVKTNVGLSLGIKVAIFTTSLLGYVALPLAVVADEGTALLVL
    LNSLRLTSRASH

    >gi|206895875|ref|YP_002246588.1| thioredoxin-disulfide reductase [Coprothermobacter proteolyticus DSM 5265]
    MPDLYDCLIIGAGPAGLSAAIYAGRARLSTIVFEKKQVGGQAALTWGLENYPGSVEDPTGPKITARMREQAEYFGALIKH
    EEVKSVDLSGKVKKVVTNKGTYEGKTVILAPGASHIRLGIPGEEKFTGKGVSY
    CATCDADFFTDLDVVVIGGGDSGLQEG
    LYLTKYCNSVTIVEMLPELRASKILQERAANNPKVKILTHTAVESIEGEDLVEKVVLKDTQTGERTELQVQGVFVFAGMK
    PDTELFKGLVDMDEKGYIKTDEYMRTNVPGVFAAGDCRVKWLRQVVTAAADGAQAAVAAERYVDENFSD

    >gi|206895871|ref|YP_002246589.1| thiol-disulfide isomerase [Coprothermobacter proteolyticus DSM 5265]
    MVEVTAQNFEQEVKSETDKLVLVDFWSEKCEKCMALMPEVEELEKKYADKVKFAKVDAAKDRRFCWSLKVMSLPTFQLYK
    NGEKVDEITQDVTVDKIEEMINKYL

    >gi|206896369|ref|YP_002246593.1| glycine reductase complex component B subunit gamma (Selenoprotein PB gamma) [Coprothermobacter proteolyticus DSM 5265]
    MLKVVHYINQFFGQIGGEDKADTPPLVKEGPVGPGLALQQALGDQGKVVATIICGDSYFNEHVDEALAEVLRMVEQYQPD
    LFVAGPAFFAGRYGIACATVCKAVQEKFGIPVVTGMYPENPGVDLCKKDVYVVKTGDSAAQMKDAITKMVKLALKMVNKE
    EIGTPEEEGYIPRGIRKNYFAQERGSKRAVDMLVKKLKGEPYTTELPMPEFDRVPPAPAVKDLSKALVALVTSGGIVPKG
    NPDHIESSSASKFGKYDLEGIQALSPETHQTAHGGYDPVYANEDPNRVLPVDVMRELEKEGKIGKLHRYYYATVGNGTPV
    AKAQQYGQAIAKELKDAGVQAVILTST
    CGTCTRCGATMVKELERAGLPTVHICTIVPISKTVGANRIVPAVAIPHPLGNP
    ELSKEDEKALRRKILEKALEALQTDIDTQTVFEWQ

    >gi|206896280|ref|YP_002247072.1| methylated-dna--protein-cysteine methyltransferase (6-o-methylguanine-dna methyltransferase) (mgmt) (o-6-methylguani
    MKSSERICTYELPFGLWLLLLTDEERLVRTWLQDSKPNAEEIRSGVLKDFLDKYSSGLWEPSFVLNLVDWNMFTEKRAEV
    YRTLTTAVPMGSTITYGRLGNICNCSPRAVGSYMRTNKFPIIIP
    CHRVVGQKSLGGYSPEVQWKRVILEWELNNAKSNSG
    NRTFWSW

    >gi|206895900|ref|YP_002247206.1| thioredoxin-disulfide reductase [Coprothermobacter proteolyticus DSM 5265]
    MNESRLFDVFIVGGGPAGLSAAIYCARNGLRVAVASADIFGGTLNNAAIIENYPGFPEGVSGAELADRFRQHALNAGAEL
    LEEKIEKIEKKEQYFVLHGYDTYTAKAVILAMGIDYRKLGVPGELELLGRGVSF
    CATCDGAFFRNKVVAVVGGGSSAFAS
    AEYMANIASKVYLVHRRSGFRAEKVLVDRVLSHPKVEPLLNKVVKRINGQNKVESLLLEDVVTKEESVLPVDGVFIQVGH
    VPKTDLAKGLVNMDENGYIKVSEDMKTSEEGIFAAGDVRQGALGQIVTAAADGAIAAESAFRYINEKGL

    >gi|206895683|ref|YP_002247224.1| hypothetical protein COPRO5265_0893 [Coprothermobacter proteolyticus DSM 5265]
    MAKRNIKEEAKELNEGMAQLASEIPGVMKGFNEVHHAATADGALSTKEKELIALGIAVAVRCSHCIVAHVGSALQAGATR
    EEIMEALGVAIMMSGGPGVAYSVEAMEVLEGLTQ

    >gi|206895418|ref|YP_002247412.1| bacterioferritin comigratory protein, AhpC/TSA family [Coprothermobacter proteolyticus DSM 5265]
    MLTVGSSAPDFELTDHNLKRVRLSSLKGKVVLAFYPGAFTGVCTKEMCTFRDMMARFNELEATVLGISVDTPFANKAFAE
    HNGIEFSLLSDFGGEVAKQYGGVHTDFAGVPNYTAAKRAVFIVEDGKVTYAWVSEDPGKEPPYEEIVKALE

    >gi|206896087|ref|YP_002247475.1| hypothetical protein COPRO5265_1167 [Coprothermobacter proteolyticus DSM 5265]
    MAILKESDKKEVQKRLAVMNKTVKVITFLPESDIIVPGRRECMYCNEVKELMSDLVATTDKLSLVLIDPLKQPETAQEYG
    LKKDSLGFMYPAITFSVLEDDGQEKHYNIWFYGIPAGYEFATLLDDIILLSTGNVKLNKALLPQLAAINTKVTMDVFVTP
    T
    CPYCPKAVFTAHQFAYFNPNFTGNMIEASEFEELTNRWNVYGVPKTVINEKIEVEGAVPENLMLDYVKNALL

    >gi|206895912|ref|YP_002247496.1| dihydrolipoyl dehydrogenase [Coprothermobacter proteolyticus DSM 5265]
    MKLGIIGAGPGGYEAALYAAQRGIDVTLFEKQFVGGTCLNLGCIPTKTILASTELYSHIKEASQFGVTVEGAQISWQQVQ
    QRMLKTVAQLRRGVEFLLKKRGVHLVQGEAFYRGNHQVEVAGETYEFDYVIIATGSRPAELPGLSTDKKWIINSNHFFTR
    KELPKRALVVGTGAIGLELSDILRAFGTEVTVVELVPQVMPLLDSDASTNYAKILSKKGIKFIVGNSVKNIDHEDSHLKV
    TLTNDQELEVDQIVVGVGRTANVEVIKTDRIQVEKGKVKVDKSLLTSEEGVYAIGDVAMPPIARGALAHVASHEGIFAVK
    HILGEAKEMDWHAVPWVVFTDPPLAAIGQTEKEATQAGTAVKTYTLPYRALGAAVAKNRTEGFCKFIVAADTGKVRGVQM
    AGVGADLIINEMAVVLQQNMTVKELSEVIHAHPTLSEVAKESAFALLGYPINTM

    >gi|206896532|ref|YP_002247559.1| copper-translocating P-type ATPase [Coprothermobacter proteolyticus DSM 5265]
    MAKKKAVVEVRGMSCASCVNTVKTAIAHTPGVVSVEVNLATDQAFIEYEEEKVDLVEIAKNVSKVGYALDIEQAKTNEEL
    QRIKEQFIASTLFMVPVTILMVMHMSGIMFPNMELLQLILSALAVATAGQETVSRAFKALFHGQWTMDVLVASGIVMAVL
    SGAISLVYPSVYSFASVGAMILFFNLLGKYLESSAKKRAAKSIRALLDLRPQTARIIVDGIEVEIPVQQLDPGDIMVVRP
    GERIPTDGILLEGECYVDESMISGESMPVQKNIGDSVIGGSINLGSPIKVKATRVGEDTFLSHLIDLVQQAQAARMPIQD
    NLDKVIAIFVPAVISLAVFTFIFWLAFPGLAANVNNYLSSILPWVPKGLTGFSLAAFASIATLVIACPCALGLATPTAVI
    VASGLAAKHGAYFKDGSAFQRLASVNTVVFDKTGTLTTGKPTVRRIVAFEENAEQLMYSMAKQSQHPLSRAIVAYFEENK
    KMDSALQLENVKETPGLGVLATFSGKTYSLGKPKRRQDVQQFIDPTDSTVALYDETDQVLLAVCALYDPVREDAAMAIEE
    LKAMGIEPVLLSGDREEVVKAVATAVGIKTFKANALPEDKLDFIKRLKAEQPESIIAMVGDGINDAPALRLADVGIAMGS
    GTDVAIESGDVVIYKTDIGTIVKTVKIAKATAKKISQNLFWAFFYNLLALPLAMMGAIHPVIAEIAMAFSSVNVVTNSLR
    LNRIKL

    >gi|206895873|ref|YP_002247588.1| OsmC/Ohr family protein [Coprothermobacter proteolyticus DSM 5265]
    MGTLKVEVHEVEGMQLLARTGSGFAFVMDSPKDNGGLEQGPRPKEMLLAALAGCTAMDVISILKKMQEPLEKLVVNVEGE
    TAEEHPKYIKKIILTYVAYGNVNEDNLKKAIELSQQKYCGVSATLRPDIEKEIRWEIRHD

    >gi|206895426|ref|YP_002247662.1| conserved protein with OsmC domain [Coprothermobacter proteolyticus DSM 5265]
    MAKVTFKAKTEWKGGMVAEGTARGFKVTVDEPKGLGGTDTAMNPVEMLLCSLGGCMAIVASAFAPMCGVELKGFSVDLEG
    DLDPDGFLGKNPNVRKGFSEIRYKMHIVSDSPEENVKKLYELIQER
    CPVKDTLKGVPVNGDMVIEK

    >gi|206896338|ref|YP_002247691.1| redox-active disulfide protein 2 [Coprothermobacter proteolyticus DSM 5265]
    MHQEKPENQTSSFSEGTPNLDHEQENCVRNDSNPAVLSVKVLGPGCARCKALEANTKSALDKLGLKADFNHVTDFSQIAA
    YGIMSTPALVINEKVVSFGRVLSAEEVVKILRSELQL

    >gi|206895332|ref|YP_002247750.1| hypothetical protein COPRO5265_1493 [Coprothermobacter proteolyticus DSM 5265]
    MHIVLQVINPPYSYEDMDSAIKIADAALKKGHKVSIFLFADSVLSVNTKVRPIRIDRNIPNLLKDLADRGAEIHICGLCF
    EYRGLDIETATPGAELSGVPEMATLLATADRYVNFAV

    >gi|206895964|ref|YP_002247751.1| YeeE/YedE family protein [Coprothermobacter proteolyticus DSM 5265]
    MQGTLIGGLIVGLLFGFLLQRSRMCFNSAIRDVRYFKDNWLWKQGLMAIAVETIGFQLMAAIGVIKLNPSAFIPAAQIVG
    GFAFGMGMVLAGG
    CASGVTYRIGEGNAVAIIAATFYALFAGAARNGKLKPITALFGKPITVTMENPGVYAAKDGQVAPTV
    ANLLGIDPWIVAIVFALIIFAYLFFTKTSQRKAPMHWTVGGILIGLVGMLAYWSNQSYSLGITGGWINLFTATLTDAPYN
    WIGMEVFGIIIGAFIAALIFKEFKIRFPKDPKAYVYAVIGGALMGWGAGVAGG
    CNIGHFLSGVPHLAISSLLATAFFILG
    NWFMYWLLYGRD

    >gi|206895768|ref|YP_002247803.1| peptide methionine sulfoxide reductase MsrB/msrA [Coprothermobacter proteolyticus DSM 5265]
    MFQFSNSLFHMKEAFKAVENKDFSELERKVMFEKATELPFTGEYYDFFEEGIYVCKNCGLPLYRSQDKFHSGCGWPSFDD
    EVPGAVLRQPDKDGVRTELVCGYCGAHLGHVFTGEGFTKKDTRH
    CVNSVSLKFLPKGQKPEKEQIFFAAGCFWGVEHLFK
    QCEGVLDTQVGFMGGHTDHPTYEEVCTGTTGHAETVRVVYDTKVDVENLIKYFFEIHDFTQVNRQGPDWGKQYRSVIFYT
    SEEQKQKAEKIKALLSQKYKVATSIEKASTFWPAEDYHQDHYDKTGKTPYCHYRRAIFGKDIPISLD