Conexibacter woesei DSM 14684 uid43467

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|284041938|ref|YP_003392278.1| Heavy metal transport/detoxification protein [Conexibacter woesei DSM 14684]
    MATTELSYTVKGMTCNSCKLNVTEEVEQVQGVSEIEVEIETGRLTVRGEGVSDDAVKAAVGEAGYEVVVS

    >gi|284041940|ref|YP_003392280.1| heavy metal translocating P-type ATPase [Conexibacter woesei DSM 14684]
    MSTTPEQVDLPITGMTCASCANRIERKLNKLDGVQASVNYATEKAAVSFDPEHVSAEDLLKAVESAGYTATLPAPAGADG
    GAGAATAAGEDEDPTRPLRNRLIWSALLSLPVLLLSMIPALQFDNWQWLAWNLATPVVLWAAWPFHRAAWANLKHATATM
    DTLISVGTLAAWTWSVVALFFGDAGMTGMRMGFDLVPDRSAALDHVYFEVAAVVITFILGGRYFEARAKRKAGAALSALL
    ELGAKDVAILDADGTERRVRIEELNVGDRFVVRPGEKVATDGVVVEGSSAVDQSLLTGESIPVEKAPGDDVVGATVNVGG
    RLVVRATKIGTDTALAQIAKLVSDAQTGKAPVQRLADRVSGVFVPIVIAIAAGALGFWLGAGESAAFAFTAAVAVLIIAC
    PCALGLATPTALLVGTGRGAQLGLLIKGPEVLESTRKVDTIVLDKTGTVTTGQMALVDVAVADGVDPEEALRLVGGLEHA
    SEHPIARAIAEAAQARVGTLPAPEGFANREGLGVEGTVDGHAVVAGRPALLADWGLRLPAALDAARTAAEAEGRTAIAAA
    WDGETRAVFVVADTPKPTSAEAIRQLKALGLRPVLLTGDNASTARAVAAQVGIDDVIAEVLPSEKAEVVKRLQAEGRVVA
    MVGDGVNDAPALAQADLGLAIGTGTDVAIEASDLTLVSGDLRAAGDAIRLSRKTLGTIRSNLFWAFAYNVALIPAAAAGF
    LNPLLAGAAMAFSSVFVVANSLRLRAFRVQREGAAGGS

    >gi|284042061|ref|YP_003392401.1| Methyltransferase type 11 [Conexibacter woesei DSM 14684]
    MADLSDTDKIREAVRERYASAATASATDAPVGGDCCGPASAVPVATTDAQGREVFGAALYDSADADAPEAAVAASLGCGV
    PTAVADLHAGETVLDLGSGAGADVLISARCVGPNGHAIGLDMTDEMLALARRNADEAGVANVEFVKGYIEDIPLAGGSVD
    VVISNCVLNLSGDKPKVLREAARVLRGGGRFSISDVIADEDMDAATRADMRQWTG
    CVAGALTRAEFEQALADAGLTDVEI
    RETHRVHEHAAAAIIRATKRATA

    >gi|284042122|ref|YP_003392462.1| thioredoxin [Conexibacter woesei DSM 14684]
    MSTQPIVACDNCGRRNRLPVIAEGIPRCAVCHHPLQWIVEAGDATFDGAIAASVPVLVDFWADWCGPCRMVSPLVERIGH
    DYAGRLKVVKLDTEAAPQIAARFQIRSIPLLVLFRDGDEVARLIGAHPDAQLRAWIDGQLAAAGAATGSD

    >gi|284042236|ref|YP_003392576.1| dihydrolipoamide dehydrogenase [Conexibacter woesei DSM 14684]
    MPDSAYDCIVIGSGPGGYVAAIRAAQLGLRTAVVEKDQIGGRCLNYACIPAKVVLRSADILSEIDEAAEFGIAVEGRTVD
    FSKVMDRRKKVIRTMTGGVSGLFKKNRIDVIEGVGAVTKDGNVVVDGTTYEATKGVILATGSVKRPIPGTQFGGRVIGTE
    EAWALDELPKTLAVVGAGASGSEIASAYARLGTEVLLFEALDRVLPTEDSDISKLAERGLKKQGMKVFTRTFVENVEAGD
    SSVRFTYNGEAGEAEWLVIAAGRGADVEGLGLDEAGVKVDDRGLIEVDRAQRTSVKGVWAIGDIVPGPALAHKASEEGII
    AAEDINGDETHPFEYVDVPRATFCTPNVASFGLTEQQAKDAGHDVVVGRVPYGAVGAGTVYGDRAGLIKIIGDKRYGELL
    GGHIIGAKATELIQELVNAKSLEGGYPEVARIVHGHPTLSEGVMEAARDADGWLIHG

    >gi|284042530|ref|YP_003392870.1| FAD dependent oxidoreductase [Conexibacter woesei DSM 14684]
    MPDVIVIGAGHNGLTCACYLARAGLDVLVLEQSDTVGGCINTRDLPDGRGRLELGAYEHGGIRGSGVAADLELETRHGLR
    FHLRDEVTLGPADDGARIAFHNGLEETLELLRPVVGPSETDAYARFAAWATAGMKLVGSLDSGPPPSFGQLAAAAQATLG
    AEAAPFMQTLLGSASAVLRATFEDERLMAPMAHWAGHSQQSPLDPGTGGGGLMLAAFHGAPAARPAGGSRATVEALVRCL
    EAAGGRVVCDAAVSAVEVSGGRASAVIAGGERHVATRGVVSAIDARRLLGSGGLVAQEHVPDRLKRELRRVHSGLRNVSE
    LKVDAVIDTLPQVEPAGFDRAFMLSANTITDIEQAFASVQLGELARRPPVMIAFPSTLESGWAPEGKAVAWISTFVPWRP
    ADGAWDEAKLEAAADHAWSVAERALGARMGVVERRITGPVSWVARHGNANANPNHIEMSIDQLLGFRPTPSLSGYKTPID
    GLFLTGAGTHPGGGITGVPGRNAAQVALASLGVGSRGARLARRARERSALVRDAWKATRELRSAS

    >gi|284042538|ref|YP_003392878.1| methylated-DNA/protein-cysteinemethyltransferase [Conexibacter woesei DSM 14684]
    MTSTATIPTPAGPFTVVVSDDAVVASGWSADADALLAVIGAARLPSVAAELDAGTLARRRDLGPFTRAVRDYHDGDLAAI
    DAVPVAQSSGPFTNRAWDELRAIPAGESRTYSQLAASSGRPAAIRAAGTACATNRAALFVP
    CHRALRSDGTLGGFAYGLD
    VKRWLLAHEAQAASAARAA

    >gi|284042580|ref|YP_003392920.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Conexibacter woesei DSM 14684]
    MIETGAKAPQFTLPDQDGNDVSLSDYAGKTVVLYFYPKADTPGCTTQACGVRDHLPNYTEAGAVVIGISPDPHTRVKRFA
    DKFGLDFTLLGDADHAVCEAYGTWAEKSMYGKKYWGALRATFIIDGDGTVVHVIPRVSPRTHDDEVLKALEQLAAA

    >gi|284042976|ref|YP_003393316.1| Na+/H+ antiporter NhaA [Conexibacter woesei DSM 14684]
    MTATAPGDQTTPKRRQLLAQLGAPLRHFISTEAGSAGLLLAATVVALVWANSPLSDSYESLWHTRLSISLGDWTIDMDLR
    HWLDEGLMALFFFVIGMEVRREWSIGELKDRTRVTVPVIAGIGGMVLPALIYLALIHFSGAVSGSAHGWGIVIATDTAFM
    LGALAIVGPACPTQLRVFLLTLSIVDDIAAISVIGIVYSESLDVVALLVALACLAGIGLLGSTRIWRGSAYCALGAGLWI
    ATVVSGLHPTLAGMAAGLLITAYTPRREQVEQAASQARAFRQSPLPQLARDTKLSIERSVSPNERLQTLLHPWTSYAIVP
    LFALANAGVDMRAGALGDALSSPITWGVVAGLVLGKTLGIATGALGAVRMRLGTLPQGVGEGQVVGGAALSGIGFTVSLL
    IVGLAFSDAQQQEEARIGVLLAAVLAVGAGWLAFKLAALLRGEVSAGLPRELSPPVDAARDHVRGPLDAPLTLVEYADFE
    CPFCGRATGMVRELRRRFGDDLRYVLRHLPLIDVHPHAELAAQAMEEAAVQGRFWELHDKLFDHQDELEFEDLLGYAGKI
    GIDVEELARALQDGRHLARVRKDVASAEASGARGTPTFFVGGQRHVGPYDAETLARELEESRRR

    >gi|284043073|ref|YP_003393413.1| glutaredoxin-like protein [Conexibacter woesei DSM 14684]
    MSDQPNPLRDAISEAIAENPVILFMKGTPEQPMCGFSARTAAALQALDTPFAAVDILPDPRIRQELSALSNWPTIPQLFV
    RGELIGGADIVAEMYESGELAQVLGVEQPAAPEPQAAPEGEAAPAAPLSIENRLS

    >gi|284043075|ref|YP_003393415.1| iron-sulfur cluster assembly accessory protein [Conexibacter woesei DSM 14684]
    MITLTEKGAEKVHEFLASQGSEVETAGLRVGVRGGGCSGFQYALAFDQERDGDVVFEDRGIRLLVDKPSLPYVHGSVIDY
    VDEMQGAGFKVDNPNVVAACGCGSSFRVAEEEEVSAV

    >gi|284043229|ref|YP_003393569.1| putative periplasmic substrate-binding protein [Conexibacter woesei DSM 14684]
    MRIVSLVPSATELLFALGLDSEVIAVTHECDHPPAALALPKVTRDALPSGLTAGQIDAAVRARTEQGEAIYELDAAALHE
    LQPDLIVTQALCAV
    CAVSVEDVRAVAEQIDSRPRVISLDPRTLGEVLGDVRTLAEATGRRDAGVDLIADAAARIDRVRLA
    VRDRPPLKVAALEWLEPVYVAGHWTPQLIEYAGGIDLLGMAGEHSERRAWEEVAAAAPDVVVVMPCGYDAPRALEEAHRF
    GDRLAGLGAGEVVAVDASAYFSRPGPRLVDGLELMAHILHPEAVPEAPSAPLTVEL

    >gi|284043304|ref|YP_003393644.1| electron transport protein SCO1/SenC [Conexibacter woesei DSM 14684]
    MPARLRLTAIVVVALLVAGLGGAVLFGGSGGEASDGDGADPTGFHGAVRPPGARAADFSLRDQDGKLATMREYRGSDVVV
    TFLYANCDDT
    CPLTAQQIRGALDELGEDVPVLAISVDPPGDTPFHVDRFLVKQKMNGRMRFLTGNRAELEPVWKAYGIQP
    QGEGFEHSASTVVIDDRGVQRIGFMTDQLTPDGLAHDLRKLAGDS

    >gi|284043305|ref|YP_003393645.1| UBA/THIF-type NAD/FAD binding protein [Conexibacter woesei DSM 14684]
    MSPSGAELLRKIKSQIQEVDPAAVHEQLGNGAVIVDVREAEEFSVGHIPGAKHVPRAYLESRIEGVVPDRDAHLVLYCAS
    GNRSAYAARTLAEDLGYTDVSSMTGGIALWKDRGYEVDVPRTLTAEQRDRYSRHILMPEVGTEGQLKLLDARVLLLGAGG
    LGAPTALYLAAAGVGTLGIVDNDTVDLSNLQRQVIHTQDRVGEPKVDSAEATIANLNSDVRVVKYPVRLDASNVMEIIEG
    YDVIVDGLDNFPTRYLINDASVRLQIPVVSASILGFDGQLSVFKPYDGPCYRCLYPTPPPAELAPS
    CGANGVLGVLPGTM
    GLLQATEVVKLILDEGEPLIGRLLLYEALGATFTELKVRRDPECPVCSRDPESITDEEMGVFPDYEAFCAAAG

    >gi|284043375|ref|YP_003393715.1| thioredoxin reductase [Conexibacter woesei DSM 14684]
    MADVENVIIVGSGPAGYTAALYTARADLRPLVIEGFAWGGLLQQTTEVENYPGYREGVMGPVMMQEFRDQAERFGTRFIT
    DDATRVELSDGGIHTVWVGDDAYRTKAVVLAMGAQHKKLGVPGEEELSGRGVSY
    CATCDAAFFKEHETVIVGGGDSAMEE
    AIFLAKFAGRVVIVNRRDEFRASAIMLDRAREQANIEWLTPYVVDEFAAGERGALEKVRLKHTETGEPLEHTATGAFIAI
    GHEPQSELVQGQVDLDDNGYVRTVELSTRTNLAGVFAAGDLVDHTYRQAITAAGSGCKAALDAEWYLRDTPPAVEAPAVS
    EAVEA

    >gi|284043380|ref|YP_003393720.1| OsmC family protein [Conexibacter woesei DSM 14684]
    MKAIARRTGTFTHEIDVRGHTLRADEPVEEGGDDDAPSPQELLAASLASCTAITMEMYAKRKGWDIGRVAVEAEYAPAER
    GAPTRFRLTLRLPANLTEEQLERLSVIAAK
    CPVHRTLDGEVMFDERIELVR

    >gi|284043630|ref|YP_003393970.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Conexibacter woesei DSM 14684]
    MSSDYDVIVLGAGSPGEHCAGALAEGSLRVAVVERELVGGECSYWACIPSKTLLRPGEAVHAAREAAASAEVDVEAALAW
    RDFMVSDHSDVGQERWLADNGIDLLRGSGRLAGPGVVEVGGVRHTADHVVLANGADPIVPPVPGLRELDGVWTNREATSM
    TAVPRRLLILGGGPVGVEMAQAVRRLGGEAAIADMADRVLAREPAALGEALGDVLRGEGVELVLSASATAARRDGEEYVL
    AFDDGRELRGDRLLVATGRRPRTQGIGLETVGVEPDARGVPVDAHLHVTDRLWAIGDVTGLFPLTHVGKYQGDVVADNIL
    GRPRRADYEAVPRVVYTDPQAAAVGDGTGAFSATARVSEVAKTATYTRAYAEQNGFLTLVSDGERLTGAYALGPEAGEWL
    QQATLAIRARVPLDVMADTIQPFPTFSEIYVAALKALRARGPRSP

    >gi|284043632|ref|YP_003393972.1| cyclic nucleotide-regulated FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Conexibacter woesei DSM 14684]
    MIADSASPRLSPEHAARLRRYGSPETLTAGQRLFGPGDASYDLFLVDEGEVHVIAPGIGAAPEEPIVRFGPDEIVGELSL
    LTREAPVLIGRVARGGHAHRVSGDGLRRLMVEDPELSDVLLRAFIARRARLSGSAARRTTTIVGPERAKGTLALRTYAAR
    LALMHEWIDPDSVHGSALLRATGLRPEDLPAVILPMALLTNATPGDLAHALGLDAAAQLTETVDLVVVGAGPAGLAAAVY
    GASEGLDTVLLDRQGPGGQAAASARIENYLGFPSGLSGADLTGRAAVQALKFGARLSAPCTVTALDRSDRRLHMRLSDGT
    QIATRATIIATGARYRTLDLDRWDDYVGAGIYFAATELEARA
    CAGAPVTVVGGANSAGQAALFLASKGCAVTLAIRGPEI
    GRSMSAYLIDRILADARIDVRTSTKVAELRGDERLREIRLGRDEPQPCAGLFCFIGAAPETGWLTGLATDDDGFLRTDAQ
    LSPEDLGDAWQALRRLPLPFECSVPGVFAAGDVRSGSMKRVAAAVGEGASAVRSVHAAIGSEPR

    >gi|284043738|ref|YP_003394078.1| arsenate reductase and related protein [Conexibacter woesei DSM 14684]
    MTLTLMHNPHCPTSVNALDALTEAGHDVTVRKYLLVAERLSEPEVRSLAERLQGDPVDALIRRDKKYKDLGLDADGLDLD
    AVVATLVEHPALLQRPILDDGENVVIGRPRERQRAWAAAGKAVVEA

    >gi|284043827|ref|YP_003394167.1| DSBA oxidoreductase [Conexibacter woesei DSM 14684]
    MKIELYFDVLCPWCYIGKRKLTAALAGRDDVEVTWRSMELDPEGSATPGMTAAEVIAQYQSSPERAAARVHQIQALGAAE
    GLTLDLHRARPVNSFDAHRLVHLAASHGLADQAVEALLHGYHTRALDIADRGVLATLGAGVGLDAAEVRRTLDTDAFADS
    VRADERSALRRGIRGVPTLVVDDGPPVSAVQDPGALARLLSST

    >gi|284043938|ref|YP_003394278.1| heavy metal translocating P-type ATPase [Conexibacter woesei DSM 14684]
    MSTTRVELPLRAPDECGDCAGRLRAAIAAHDGVGSVEASSRGDSLLVELDADRCSTTCVQEALRAARAGLSDHYAHTIVT
    VDGMD
    CAGCARTVSDAVARLPRVSGVDVSFTTGRMLVEHERDQFDAAAVAQRVERLGYRASLPGTGAGAGSAGARLRRLL
    DPNLLTGVATVLLLLAVVVDFATDLPAAWLYGAAVATGIGPIARSGLVALWVTRRPEIKFLMTVASIGAIAIGAWMEAAL
    VVVLFSIGELLEGRAVARARRELASLVTLAPERARLRAADGSETEIAASALQLGDVVVVRPGERLPADGSVLDGRSAVDQ
    APITGESVPVDKEPGDHVFAGTLNAQGRLVVTVESAPGDTTLARIGTLVAEAQARRSPSERWVDAFARVYTPAVIALAVL
    VAAVPALFFGVAFADSFYSALALLILACPCALVLSTPVTIVSALGRASAAGVLVKGGEQLERAAAIETVAFDKTGTLTAG
    RPRLVALDTLGGDAVDEVDEDELLALAAALEAGSEHPLASAIVAAARERGLTLAPVEEFQAQTGFGASGLVGGAAVAIGK
    PAMFGARTLTPAVERALDARREAGQTAIVLARDDLPLGVLGLADPPRPEAREATAQLARLGIDRTVLITGDNAATAHAVA
    REAGVADVRSDALPEDKARLIGELGDGVAMVGDGVNDAPALAAATLGIAMGSAGSDTAIEVADVALMGDDPRKVAGLIGL
    ARWTRATVRANIAFSLATKAVAAVLLAFGLLPLWAAVATDVGASLVVVLWGLRVLVGAPRGRLRGLPLLPAPRRAAAASG
    AR

    >gi|284043945|ref|YP_003394285.1| OsmC family protein [Conexibacter woesei DSM 14684]
    MSLPAALDTLTAAVDADAANAQVGFRVTGSLTGPTKVALRSGRHAVTVDEPPALGGADAGASPVEHALIALASCHAIAYR
    VWATKLGLELDDVEVRAEGELDLRGFLGLDTSVRAGFTDVRIVVTPKGPEPAERYRELAEAVDQH
    CPVLDLFSNATPVER
    ELAIAAEPAGAS

    >gi|284044301|ref|YP_003394641.1| alkylhydroperoxidase like protein, AhpD family [Conexibacter woesei DSM 14684]
    MTAIAPSPSDYVAHTPRIADLPRVARENYHAMRRLAGSVELDPILRHLIDIRVSQLNGCVYCLDMHHNEARDDGETTQRL
    DTLAGWRESPFFTASERAALGLAEAMTRLTDGPVPDAVYDEAARQFDEHALTQVIFAITVINSWNRLMVTTQALPPTR

    >gi|284044550|ref|YP_003394890.1| methylated-DNA/protein-cysteinemethyltransferase [Conexibacter woesei DSM 14684]
    MEASGFTLFDTAIGCCGIAWGPAGLTDVQLPESSRAATRARLLRQLPPAAREHAPSELPPEIADAVARIVALLAGADDDL
    ADVAVDMERVPPFHRRVYDLARTIPPGATLTYGEVADRIGADRGAARAVGQALGANPVPIVVP
    CHRVTAAGGKTGGFSAG
    GGVSTKLRMLDIERAHAAAHGAPTLF

    >gi|284044556|ref|YP_003394896.1| glutaredoxin 3 [Conexibacter woesei DSM 14684]
    MAKITLYTTDFCPYCVRAKQLLEKRELAFEEINLARDPDGRAKLVELTGMMTFPQILVGSQPLGGYDQLAAADRSGELSA
    LLATA

    >gi|284044682|ref|YP_003395022.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Conexibacter woesei DSM 14684]
    MSVLQPGTPVPAFTLKREDGASFTQDDLKGKTTVLVFYPFAFSPVCTDQLNLYEEVLDQFSAQGATLYGVSCDSSWAQRA
    FREKLGVTIEQLSDFEPKGAACTAFGVLHEGGFPQRALVIVDPEGTVKWSYQAPSPGDLPGANLIFDGLAA

    >gi|284044683|ref|YP_003395023.1| DSBA oxidoreductase [Conexibacter woesei DSM 14684]
    MAPDDHRSGPRERPLAIVYADYECPYCAVLEARLVQASAQRVFRHFPVKSKHPRAWAASCAAEAAGLQGRFWEMHALLFA
    DQGRLEDPHLWARAEQLGLDVDRFDADRRSDAVAARVKHDFLSGMRAGVVTTPTLFLDGVAHPGLPSDELIARLR

    >gi|284044810|ref|YP_003395150.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Conexibacter woesei DSM 14684]
    MASTPQIGDSAPDFTLDGTDGPFTLSARRGERVVLAFYPGDETTVCTKQMCSYRDRADDLSALGVTVVGISGKDVASKES
    FRDHHGLTVPLLADPDHAVARLYGVASRVMGTKRATFVIDETARVAWRKVHAIGLTFVTVDELRTVLAGLPAATA

    >gi|284044894|ref|YP_003395234.1| DSBA oxidoreductase [Conexibacter woesei DSM 14684]
    MELELWLDVVCPWCYLGKRRLDAALERFDARDQITLVHRSFELDPDAPRRREGTLAEMLAAKYGGSVAEAEARQAQLTEL
    GREDGIAFRFERAQPGNTFDAHRLIHLAASIGAQEAVVERLMRGYFGEGLAIGDPAELVAAVADAGLDAATAREALDGDD
    FAAAVRADEERGAALGIRGVPFLVLDGRYGLSGAQPVDAYLQAVEQAWGERAAVA

    >gi|284044900|ref|YP_003395240.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Conexibacter woesei DSM 14684]
    MNLDPAPATSPRLFDAIVVGGGPAGEVCAGKLAGAGLETALVERELIGGECSFYACMPSKALLRPGELAEETHRVVGVTD
    ATVEPIVALRRRDEVIHELDDSGQLPWLEDRGITLIRGDARLDGERRLVVATGDGGELRLQARRAIVLATGSGASIPPVP
    GLAEIEPWTNREITTAQQVPPRILILGGGVVGVEMAQAWSSFGAHVTLVEIGERLIAQEEEIASELVADGLRGHGVDVRL
    GATVSGARRDPDAGESVLTLDGGEELRAEVLVVAAGRAPRTQGLGLETVGLEPGRHVEVDARLRVPGSDWLYAIGDVNGR
    ALLTHEGKLQARIAALAIAGRDDAELRDDGPPPRVIFTSPQVAAVGMTLDQARDAGVQATAVDGRIDAVAGASFWGKGAD
    ARVRFVVDERRRVLVGATFVGPDVAEMVHAASVAVVGEVPVDRLVHAAPAFPTLSEAWLKLADWAGT

    >gi|284044923|ref|YP_003395263.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Conexibacter woesei DSM 14684]
    MAAEQDFRRLPPDLPVPLDDGAADHLPGLELPALTLPSTKGEPVDLAAIAAEAATLVLYVYPRTGTPGEELPEGWDDVPG
    ARG
    CTPQNIAFRDHRAQLTVLGADVVGLSAQSSEDQQAFSAREHIPFPLLSDPGLELAAALGLPTFEIAGMTLYRRITLI
    AREGVIARVFYPVFPPDRDAANVAAWLGAVS

    >gi|284044925|ref|YP_003395265.1| thioredoxin [Conexibacter woesei DSM 14684]
    MVFDVTEQDFQREVIERSHTIPVVVDFWAEWCGPCRQLGPVLERGVGAREGKVALAKLDVDTNQQLSQAFQVQGIPAVKA
    FKDGEVVAEFTGAQPPAAVERFLDGLVPSEADGLVAAGDEASLRRAVELDPNRADALVPLARLLHARGEDDDALELLERA
    PGDFGASGLAARIELERSGTPDLADAFGALDAGDQERALDLLIGALPSADGARDDIRKVVVGVLDELGVGNELARDARRR
    LAAALY

    >gi|284045089|ref|YP_003395429.1| Peroxidase [Conexibacter woesei DSM 14684]
    MALTIGDSAPNFRAQTTEGEIDFHEWIGDSWAVLFSHPRDFTPVCTTELGYMASIKPEFDKRGAKIIGLSVDPVGNHDRW
    AQDIESSQGTAPNYPMIADTDHAIAKAYGMLPAEVEGDPTSRTPAQNATLRNVFVIGPDKKIRLVLIYPMTTGRNFDEIL
    RVIDSLQLTAQHQVATPAQWQQGEKVIIAGSVSDEQAKERYPDGFEQPLPYLRIVDAP

    >gi|284045242|ref|YP_003395582.1| peroxiredoxin, Ohr subfamily [Conexibacter woesei DSM 14684]
    MAKVLYTAEATVSGGRAAGHGRTSDGALEVDLRLPAEMGGEGGGTNPEQLFAVGWAACFEGALGVVARRQGVGADDASID
    SRVQLLPTGDGGFKLAAALDVTLPSIADDAVAAEIVRAAHQV
    CPYSNATRGNIDVALTANGRPVD

    >gi|284045279|ref|YP_003395619.1| hypothetical protein Cwoe_3827 [Conexibacter woesei DSM 14684]
    MTERNADVVINLATGHEDAERVTVAFLVATAALAKGRQVTMFLTKEAVRLGLPGYGEAIEVSGAPPVARLLSQFADGGGE
    LLV
    CPICFSGRQLDEAALVPNAVLGGATPLFDRIGDGATVFSY

    >gi|284045501|ref|YP_003395841.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Conexibacter woesei DSM 14684]
    MNENETTWDCIVVGAGAAGLSAALVLGRARQRTLVIDAGRQSNRVAHGIGGLLGHDGRPPTELYAAGREELAAYPSVELR
    AGEVLAGERDGGGDGFVLELADGARVRARRVLLATGMDYRHPTLPGIEERWGRSVFH
    CPFCHGWEVRERPLGVLDRGETG
    ARRALLLRVWSDDVTLFADGPADLAAEDAEQLRAAGVTVDERPIAGLRGPGDTLAAVAFADGAERPCEGLLVPITMHQRS
    TLAEQLGAVAAGPGPVSADAIDVDAQLRTSAGGVFAAGDVSVQMPSVANAIAAGSIAAAMIVHDVAFGG

    >gi|284045515|ref|YP_003395855.1| Rhodanese domain protein [Conexibacter woesei DSM 14684]
    MPEAMVTAAWLREHIEDPLVRVVEIQYEPDEFPYGDGHVPGALNWFWQDAFWHPTDRQFATPQAMAEWLGRAGVTPEHTL
    VLYSGRSQYAMYGSWAFGTMCGHADIRVMGGGHRAWVGAGGELTRDVPSFEPVDYGTPARSERVDDSRVSLEELRGLLGK
    DGVRILDARYDEEYSGARVKPGTGVDHGAQRHGRIPGAQSLPFRTLMDEAFRMKSLEEIEGLFRAVGAAPDQTDQVVVY
    C
    RLGHRASMLWFVATHLLGWDHVRVYDGSWTEWGSVVGVPVEK

    >gi|284045681|ref|YP_003396021.1| protein of unknown function DUF255 [Conexibacter woesei DSM 14684]
    MANALANETSPYLLQHKDNPVDWRPWGPDALAAARERDVPLLISIGYSACHWCHVMERESFEDPQTAALMNERFVCIKVD
    REERPDVDAIYMDAVQAMTGHGGWPLNAFATPEQVPFYAGTYFPPQPRHGLPSWRQVLEAISDAWRARRDEILAQNDRIV
    AHLSAGARLAPSGAMVDPGLLDDAVDSLRMAADPVNGGFGSAPKFPQASVIELLLRRGEQTVALDALRAMARGGIHDQLG
    GGFSRYTVDAAWVVPHFEKMLYDNALLARAYLHGWQVSGDPLLRQVCEDTLDWALREMRGPEGGFHSALDADSEGVEGKF
    YVWSLAELRSALGDDELYDVAVAWYGATVAGNFEGLNILVRAGSASAAEPPELPEIRRRLLAARSTRVRPGLDDKRLTSW
    NALMIAALAEAGAVLERDDYLDAARGTASFLLDSLATSDGRLLRSWKDGRATLPGYLEDHAYALEALLTLYEATFEERWF
    TAARALADATIAHFADAEHGGFFMTADDHEQLVARRKDLEDTPIPSGNSAAAFGLLRLARLTGSADYEREAERVIALLHP
    LAAGHAMAFAHLLAAIDFQLGEVHEVAIVGDRAAAKPLERVVRAKLRPHVVLAGGTGEGDRDAEASVVPLLEGRHAVGGK
    PAAYVCERFACRAPVTDPDALAELLG

    >gi|284045845|ref|YP_003396185.1| dihydrolipoamide dehydrogenase [Conexibacter woesei DSM 14684]
    MVVGELIEEVDLLVVGGGPGGYTAALHAAALGRRVTLVEEGGPAALGGACLHVGCIPSKALIEVASHAWRGHELAELGAA
    KTAGGFDGDRFQVGKAALIARLASGVAGQLANAGVRVVEGRATLTAADRVSVHSGADGALVAQLRFRDAILATGSRPIEL
    PALPYDGVTVLDSAGALALADVPEALAVVGGGYIGLELGIAFAKLGARVSIVEARERLLPELPKALLRPLLKRLAELGVA
    IHVNALAVGHADGRLRCEQADGAALVDADKVIVAVGRRPNVDGLGLGDAGLADPAGALLAPAPDRRIAEHVAAIGDIVPG
    PALAHKATAEARVAAEALSGRRVAFDPAAIPLVVFSDPEIASAGQTAAQARDAGVDAIEVVMPLAASGRAATMAATHGFV
    QLVVDPQADAIIGAHIVAPHASELIAEAVLAIELRASPEDLALTIHPHPTLSELFAEAAERTPATS

    >gi|284045922|ref|YP_003396262.1| Rhodanese domain protein [Conexibacter woesei DSM 14684]
    MDPLVSTDWLAARLEEPRLRVVDCRFALGDPAAGRRAYAAGHIPGAAFLDLDADLSDPPGAPGPAGTGPLGGRHPLPALE
    RFAAAARRAGIGSGTTVVAYDDAMSGGAARLWWLLRHCGFDDVAVLDGGIAAWSGALHAGEEPTPPPGDFAPDPAHLRDD
    VVTAEQLVRDRALPPAERGFLVLDARAPERFRGEQEPVDPVAGHIPGARSVPLAAAFPPPAEVLGERDRTLVAS
    CGSGVT
    ACALLLGLAAAGREDAKLYAGSWSDWVARDLPIETGPGSTDETAG

    >gi|284045963|ref|YP_003396303.1| Redoxin domain protein [Conexibacter woesei DSM 14684]
    MRRLAVPGLVAVLAVALVGLLIFGVLQTTDESSIDQAVADGKRPQAHDVRLTRLDGSGTGSLADYRGKVVVVNFFASWCP
    P
    CVEEAPVLERAQRMLAATGGTVLGVAVDDARGDTQKFVDDNGLSFPVLRDVERAFSNGYGVKGLPETFVIDQDGRITAL
    QRNQITHRWVEQNLAPLLARAQ

    >gi|284046152|ref|YP_003396492.1| Rhodanese domain protein [Conexibacter woesei DSM 14684]
    MSNPVEHTPAEVQALLAEDPDGVQLVDVREPHEHEAGAIAGAKHVPLQQLMTAAEQLDPNRPVIFYCRVGGRSAMATDAF
    RASGWDARNMTGGIVGWVDGGLPLSDPDGVVADH

    >gi|284046186|ref|YP_003396526.1| peptide methionine sulfoxide reductase [Conexibacter woesei DSM 14684]
    MRFLTRKTDMVDAERALSGRDVAIPVPAKHEVLGTPLQPPFPDGYERAIFGLGCFWGAERVFWQAPGVYTTAVGYAGGFT
    ENPTYEEVCSAQTGHTEAVLVVFDPARTSYDELLKLFWENHDPTQGMRQGNDVGTQYRSAIYWTSEEQHKQALASREMFQ
    SQLQQSGYGEITTEIAAERPFYYAEDYHQQYLAKNPDGYCGLGGTGVSCPIGLAAS

    >gi|284046871|ref|YP_003397211.1| methionine-R-sulfoxide reductase [Conexibacter woesei DSM 14684]
    MASKVTKSDAEWREQLTPEQYAVLREKGTERPFTGEYVNERTPGVYRCAGCGAELFASDTKFDSGSGWPSFTAPAEDDAV
    ATERDTSHFMVRNEVLCSSCGGHLGHVFDDGPAPTGMRY
    CINSAAIDLDAR

    >gi|284046980|ref|YP_003397320.1| peroxiredoxin, OsmC subfamily [Conexibacter woesei DSM 14684]
    MPARGSAEWKGDLRAGGGTFTAGDSISGDYSFKSRFEDGPGANPEQLIAGAHAACFSMAFSNMLAGNGTPPDSVKTDAVV
    WLRPVDGTPTITKIELTTVGVVPGVDDATFQELAARAKAG
    CPVSRALAGVGEITLDATLAS

    >gi|284047027|ref|YP_003397367.1| peroxiredoxin, OsmC subfamily [Conexibacter woesei DSM 14684]
    MRSSARWNGDLATGSGAVTVGESAWTGSYSFASRFEDGAGTNPEELIAAAHAGCYSMALCHVLTEAGHAPRSIETTARVR
    LRMVEGVPTINQIDLDTAVDVPGLDEAGLRELAEVAKQA
    CAVSRALAGVEQIGLTSVTVAAPTAT

    >gi|284047043|ref|YP_003397383.1| Rhodanese domain protein [Conexibacter woesei DSM 14684]
    MAVRGSVNASIMITPEELALSLAAVEPPAVLDVRWQLGDPGFGQRAYAAGHIPGAVFCDLDSVLSGPAGPEGRHPLPDLD
    ELARWLRDAGVDAEREVCVYGAREPMGAARAWWLLRYVGHERVRVLDGGLAAWQADGFDVTDEVPRPRPGSFTVRVVAEH
    RLDDALVQARADDGVLLDARAPERYSGESEPIDPIAGHIPGALNAPAAEMVDADGRMLSAELLRARFGQLGITPDTAVGV
    Y
    CGSGVTAATDILALALAGMPAALYAGSWSKWTAQPDPPVATGPDPR

    >gi|284047197|ref|YP_003397537.1| thioredoxin [Conexibacter woesei DSM 14684]
    MQSTPAPAVPATTDDRFVADVLESDLPVLVDFWAPWCPPCRAMRPVLAAIDAEHDELRVVSLNADEQQATAIRYRILSMP
    TLMLFRGGEPVATLVGSRPKARLERELSELL

    >gi|284047208|ref|YP_003397548.1| hypothetical protein Cwoe_5772 [Conexibacter woesei DSM 14684]
    MADTSGTRRERRAAARTERQERERAEAARARQRTRLFQLGGALALAAAIIIVIVIATGGGDDKTPAKRAGESVAGQRDAI
    ALFSGIEQRGTSLGDPRAPVTLVEFADLQ
    CPYCRDFSLQVLPSIVNDYVKTGRVKLEFRNLAFLGTDSTRGAQMAEAVGL
    QNRLYEFIDIFYANQGEENSGYVTDEFLTRTAGAIPGVDVQRAMDDRGTARVQRLLTDAQEEATAAFPQLSTPSFLIGPT
    GGTLEPLEVEQLSADAFKERIDPVIERNAR

    >gi|284047275|ref|YP_003397615.1| thioredoxin [Conexibacter woesei DSM 14684]
    MAGTITEVTDNNFQAEVIESDVPVLVDFWAPWCGPCRMVAPVLEEIASEKGEALKIVKLNVDDNQQTAMNFEVLSIPTLI
    LFKNGAVAKKVVGAYPKRKLEAELEPALA

    >gi|284047318|ref|YP_003397658.1| Redoxin domain protein [Conexibacter woesei DSM 14684]
    MRAPVVLIACCALAAAVLAGCGGDEPSAKVPTPAEARAALADAPPALASLHADANELLPGGKPAFDRRFAALRGHPFVVN
    VWASW
    CGPCKEEFPVLQRAAVRYGTTIGFLGVDTRDVAEDAQGWLRRHWLAYPSYVDADGKITDAVGIRVGIPGTVFYDR
    DGERAYMHQGPYREDADFERDLQRYLGAKPSS

    >gi|284042086|ref|YP_003392426.1| protein of unknown function DUF899 thioredoxin family protein [Conexibacter woesei DSM 14684]
    MTQEQSPREDPHAPTGAHRTATREQWRVERIALLRREKELTRMSDELARERQELPWVPVEQEYVFDTLDGPQTLAELFGG
    RSQLIVDHLMLGPRMTAACPS
    CSSIADGVNGVHVHLENHDVAFVAVSRAPLEQIERYRKRMGWSFRWVSSHDSDFNFDYD
    VSSTAERPLEEYNFAPLVDEEDGELPGMSAFALENGQVFHTYSAYSRGLDAIWGVYPWLDRAPKGRNEPIHWHRRHDEYG
    AADA