Colwellia psychrerythraea 34H uid57855

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|71278281|ref|YP_266879.1| hypothetical protein CPS_0111 [Colwellia psychrerythraea 34H]
    MRIFTTFVISLSLLLSSIATANTSAPVITPNLPAYSKIYDDQRDPFKDAAAALTLAQETNRQVLIEIGGNWCSWCHKMDA
    FLAKNPDVYEALHSQYVLLKISVSDSNENNDFMKSLPPVLGYPHMYVSTAQGKMILSKDTAELLTGNNYSKSQWLSFLSD
    WSVSTTKAQAQLATTASVE

    >gi|71279845|ref|YP_266890.1| thiosulfate sulfurtransferase [Colwellia psychrerythraea 34H]
    MSENSFKHMSVSDLQEVMANKSHVVVDIRDANSFANGRIAESIHLTNESLPDFLREADLDAPVVVCCYHGISSQQAAEFL
    ISQDFTEVYSLDGGFTQWQTQFPDNIER

    >gi|71281610|ref|YP_266909.1| anti-oxidant AhpCTSA family protein [Colwellia psychrerythraea 34H]
    MIELNQLMPVGELQELKNGEMTTHNTAELFAAKKVVLFAVPGAFTPTCSAAHLPGYVVSADELKAKGVDAIICLSVNDAF
    VMNAWGESQNAENIMMLADGDGSYTKALGLSMDTATFGGVRSQRYAMIIDNGEVISLHVEEPKSFEVSKAEVILDQL

    >gi|71280774|ref|YP_266923.1| methylated-DNA--protein-cysteine methyltransferase [Colwellia psychrerythraea 34H]
    MFIDYLDTPLGLFEFMATEQGICQAIFCGDQSYDDKKGERKANDITALCKQQLIEYFAGQRQTFTVPLDPQGTEFQQSVW
    GCLAKIPFGTVKSYGEIAKMLDKPKASQAVGGANGRNPITLIVP
    CHRVIGGDGSLTGYAGGIERKLWLLNHEGVEVKQTN
    NNANLDIKNVINKRQEKTQFLR

    >gi|71282174|ref|YP_266943.1| thioredoxin [Colwellia psychrerythraea 34H]
    MSDKIVQLTDDSFEADVLKASGLVLVDFWAEWCGPCKMIAPVLDDIATEYDGKVTVGKLNIDQNSATPPKYGVRGIPTLL
    LFKDGEIADTKVGALSKTQLKEFLDKNL

    >gi|71280908|ref|YP_267025.1| AhpC/TSA family protein [Colwellia psychrerythraea 34H]
    MNRKIYSRINKKISISVFSLLLLLTNNAFANTSINVGPTLGEQAPEISVVNTQEQAVNIKEISGEQGLIILFFRSADWCP
    F
    CKKHLIELNEHAEQFTKLGYGLAAISYDNTDILKTFADQKNINYPLLSDQKVQTMLAYGIVNSEYAVDSDHYGIPYPGV
    VIIDNKGKVIHKHFFKGYKKRVKFADLYQQLKKGS

    >gi|71278420|ref|YP_267100.1| soluble pyridine nucleotide transhydrogenase [Colwellia psychrerythraea 34H]
    MEKSFDYDVIIIGTGPGGEGAAMNLAKRQKKVAIIERYHQVGGGCTHWGTIPSKALRQSVSRLIEYNSNPLFNQNEQVKQ
    LTFQDILSHASAVIQKQVSLRSGFYNRNRVEHIQGQASFIDAHTISISHPDGSVEKISAKQIMIATGSRPYRPDDIDFDH
    PRVYDSDSILSLKHAPQHVIIYGAGVIGSEYASIFRGLGVKVDLINTRERLLSFLDTEMSDSLSYHLWNSGVVIRHGEEI
    ERVESSEDAVIVHLKSGKKMRADCLLFANGRTGNTADLNLAAAGLKADGRGQLKVNDCYQTEVDNIFAVGDVIGYPSLAS
    AAFDQGRIAASAMVDSSSKAKLIVDIPTGIYTIPEISSVGKTEQELTEAKIPYEVGRAQFKHLARAQISNNLVGSLKILF
    HRETKEILGIHCFGENAAEIIHIGQAIMQQTNGGNTIEYFVETTFNYPTMAEAFRVAALNGLNRLF

    >gi|71279696|ref|YP_267390.1| putative glutaredoxin [Colwellia psychrerythraea 34H]
    MKRVVLYTMEKCPHCQTAKRYLEQQGIAFRLCNIKTAKGQKEFSATGFRGVPVLKVGDQLLNGFSVQAFTELYKN

    >gi|71279082|ref|YP_267517.1| selenide, water dikinase [Colwellia psychrerythraea 34H]
    MTSIRLTQYSHGAGCGCKISPSVLDVMLKSSLALPVNDALLVGNSTKDDAAVFDIGNDQGVISTTDFFMPIVDDPTDFGK
    IAACNAISDIYAMGGKPIMAIAILGWPVNLLAPEIAQQVLDGARAICAEAGIPLAGGHSIDAPEPIFGLAVTGLINNAHI
    KRNNTAEVGDLLYLTKPLGIGIMTTAEKQGKLLPEHAQLAPQAMKTLNVIGQKFAELEVVTAMTDVTGFALLGHLLEMCQ
    GSGVAAVIDFEQVPRLDFVNDYIDQGCVPGGCERNFISYGEHVGPLSPKQKILLCDPQTSGGLLVAVKPQGKEAFEALCQ
    ENGLNLQPIGELVAATSPTVSLLS

    >gi|71279084|ref|YP_267562.1| thioredoxin [Colwellia psychrerythraea 34H]
    MKEELNLQGLNWCDHEKSWVLIYFSTSWCAPCKSMAPIMVDVSEHYVDQLNVIKIDVDEQTQLAKQLEVTGVPSLVLLGR
    SGSKSRLIGGVNTEEINLWLSEQLNQANV

    >gi|71278086|ref|YP_267575.1| dihydrolipoamide dehydrogenase [Colwellia psychrerythraea 34H]
    MKVINVDVAIIGTGTAGMGAYRAAKKHTDKVVLIEGGAYGTTCARVGCMPSKLLIAAADASYHASQTDLFGIQVDRISVN
    GKAVMKRIQTERDRFVGFVVESVESFDEQDKIRGFAKFLDEHTLQVDDHSQVIAKRIVIATGSRPNYPEFLAAAGSRLLT
    NDNLFELNDLPKSVAVFGPGVIGLELGQALSRLGVIVKVFGRSGSVANLQDEEMKRYAEKTFNEEFYFDAKARVISTIEK
    EDAVEVIYFDKSGQKTTESFQYVLAATGRKANVDKLGLENTSIELDKKNSPLFDELTLQTSVDHIFVAGDANNTLTLLHE
    AADDGKVAGTNAGAYPVIAQGQRRAPLSVVFTEPQVASVGLSLRQIEDLYADQDAANYVVGQVSFEGQGRSRVMGKNKGL
    LNVYADRTSGEFLGAEMFGPAAEHIGHLLAWARQQQMTVQAMLTMPFYHPVIEEGLRTALRDAQQKLAIEKHDMNEFIMT
    HDNAMKLVI

    >gi|71280925|ref|YP_267578.1| glutaredoxin [Colwellia psychrerythraea 34H]
    MAKIEIYTRPGCGYCTHAKRLLTNKGLDYVEYDVYENPMYIQELQQRTTGRTYPQIFIEELSVGGFTELLENEQFNLLKK


    >gi|71278562|ref|YP_267702.1| thiol:disulfide interchange protein precursor [Colwellia psychrerythraea 34H]
    MKNLLSLCFLMLAAFTLNPAAAQEKQSIFDVSNSSLFSNDDEFLKVDQAFAFNFYQKNNLLEVSFDIAPEYYLYRHQFKF
    KGKNTQFTSVLLPDGIDHEDEFFGVQKIFTENLAFTVNLENVSNDASIKITYQGCAEKGLCYPPTSKVIKLSKFILGEST
    SAPSSDAAQQTNEGEVKKSEQHQLSDMLKQDSLLLTLIAFFVGGLLLSFTPCVFPMYPILTGIIVGQGEGLTTKKAFTLS
    FFYVQGMAITYTLLGVVVAMAGAKFQAVFQHPIVLIGLSILFIFLALSMFGVFNLALPASWQNKLNNVSNKQKGGSITGV
    LMMGVISGLVASPCTTAPLTGALLYISQTGDVVLGASALYALSLGMGLPLLILGSSGGKLLPKAGAWMNIIKNIFGLLLL
    AVPVFLLERFIPEVASQALWALLILVSASYFYVANQNHAAAQNVQQGKGFWYGLRSLVIFLMLFFGANLAYQLIYPSSNN
    VTNNAQHASFKQVTSLAQLEDEVKKANMQGKTVMVDLYADW
    CIACKEFEKYTFVDADVQKALSNSVWLQIDMTEFDSTDN
    AELVQHYTILGLPSILFFDLQGNELTKQRTTGFMKAAEFSAHVKSIFK

    >gi|71278245|ref|YP_267743.1| hypothetical protein CPS_0994 [Colwellia psychrerythraea 34H]
    MFMLKRLLLSITLTLFISTISLVYASNLSKQLLTIPMTLTTREVVTLEQYQGKKPVYLKFWATWCKPCIKQMPHFEKINQ
    QHGDDLAVIAINLGINDNLAAVQKVQQEFNLSMPMVIDTKGDLAQAFRLLGTPYHLLFDKQMNLVHLGHKADSVLDNKIA
    LISATKELDLLADTAIAETEKPLDLGLDDSKTHAFLFTATWCDWYFKDSRPTASQQ
    CISAQNSVNNLTKKFDKFAWQGII
    SRLWTGPSELANYTKKYQVKHPIAIDVSNSMFHQYGIKEFPSLVVVKNGEVILKTSDFSKPESLAKQLSKL

    >gi|71278582|ref|YP_267785.1| thiol:disulfide interchange protein DsbE [Colwellia psychrerythraea 34H]
    MGKLIRFLPLILVIALGVVLYRGLSLNPQDMPSALVGKTMPAFALQTLNNSEQMVTQADLLGDIVLVNVWATWCPTCKYE
    HPYLVDIAKDPQVKLYGLNYKDERVAAQKWLQNYEDPYMFSIFDEEGTLGLDLGVYGAPETFVIDHHGIIRKRFAGAIDT
    RVWRREFEPLIAQLIEEKKQGK

    >gi|71282119|ref|YP_267827.1| Na(+)-translocating NADH-quinone reductase subunit D [Colwellia psychrerythraea 34H]
    MSSDTKKVLFGPVVDNNPIALQVLGVCSALAVTSSMANALVMTLAVIVVTAFSNLFISIIRNQIPSSVRIIVQMAIIASL
    VIVVDQVLKAFSYQLSKELSVYIGLIITN
    CIVMGRAEAFAMKEKPGVSFLDGIGNGLGYGAVLMVVAFFRELLGFGKVFG
    FEVLPLVQNGGWYQGNGLLVLPFSSFFIIGLIIWAVRQWKPEQVEKD

    >gi|71282541|ref|YP_267828.1| Na(+)-translocating NADH-quinone reductase subunit E [Colwellia psychrerythraea 34H]
    MEHYLSIFIKTIFIENMALSFFLGMCTFLAVSKKVSTAIGLGVAVVVVLGLAVPANQIIYQAILAPGALDSLMGITDPKE
    SIDLSFLSFITFIGVIAALVQILEMLLDKYFPALYQALGIFLPLITVN
    CAIFGAVSFMVAKNLTLGESVVYGVGSGIGWM
    LAIVLMAGLREKMKYSDVPNGLKGLGITFITAGLMAFGFLSFGGISL

    >gi|71280094|ref|YP_267877.1| iron-sulfur cluster assembly protein [Colwellia psychrerythraea 34H]
    MAVTMTPAAAERVQSFMQNRGKGLGLRLGIKTTGCSGLAYVLEFVDDLNEDDQLFNIKDVNIIIDAKSLVYLDGIELDFT
    KEGLNEGFKFTNPNAKGECGCGESFNV

    >gi|71279194|ref|YP_267899.1| glutathione-S-transferase domain-containing protein [Colwellia psychrerythraea 34H]
    MLPIIYSLRNCPYAMRARLAIFKAKQAVLLRDLVLSHKPAEMIAVSPKGTVPVLVLANSTVIEESLEVMLWALQQTDPDD
    LLHCQQEGALPEMLSLINEFDNGFKTSLEAYKCAKRYQEDNIAQCRVVCQQYIEQLEQRLTEHMFLMSDKESLADIALVP
    FIRQFARVERQWYLQSPYPRVRRWLNSYLQSPVFTKVMAKHPLWLDNQQDILFGVN

    >gi|71279861|ref|YP_267981.1| hypothetical protein CPS_1238 [Colwellia psychrerythraea 34H]
    MLKTIPEVIAQARKSLTIMTVEEAMLLAKQENGVIIDVREPSEYAEKSAEGTINIPRGLLEMKMLQMYPNEAQPIFLHCA
    TGARAIFSAEQLKRVGYLNVSVITSTLDDICNAWC

    >gi|71279312|ref|YP_267982.1| DsbA-like thioredoxin domain-containing protein [Colwellia psychrerythraea 34H]
    MASPVVIDYYSDILCVWAWIAQRRNEELNAKLLGKIEWRYHYLDVFGDASNKIPNQWQEKEGFTGFSNHIQKAAAPYPDA
    PINTELWKSVRPKSSANPHLVLKGVELTLGAHVSIELALLFRQAFFIDGKDISHLAVLFGLIEKAGYKADEVKRSIDDGR
    AIAALMADYQQAKLLTLKGSPTYIIDNGRQVLYGNVGYRVLLANIEEQLKAPTNEASWC

    >gi|71282569|ref|YP_268412.1| alkylhydroperoxidase AhpD family protein [Colwellia psychrerythraea 34H]
    MNFKLHTQESSPEESKAQLDSSLKSFGMIPNLHAVMAEAPNVLKAYKLLHDLFQKTSFDNEELTVIWQTINVENDCHYCV
    PAHTGIAKMMGIDDEITEALRNSTTLPTQKLQVLHETTLALVRDRGRPDPTIISSFYQVGYENRQLLEIVLGISQKIMSN
    YINHLSETPIDEAFKEFAWSK

    >gi|71278513|ref|YP_268487.1| hypothetical protein CPS_1756 [Colwellia psychrerythraea 34H]
    MEIKVNFLDNLRLEAKFDDFSVIADQPIRYKGDGSAPGPFDYFLASSAMCAAYFVKVYCNSRDIPTENIRLSQNNIVDPE
    DRHNQIFQIQVELPESISEKDKKGILRSIDRCTVKKVVQQGPEFKVEAVTSLEDDAQAMLMQQPDDGVSTFILGKDLPLE
    ETIANMSKLLADLGMKIEISSWRNIVPNVWSLHIRDAASPMCFTNGKGATKESALASALGEFIERLNCNFFYNDQFFGTD
    IATSDFVHYPNEKWFKAGADDALPSDILDDYCLAIYNPDDELRASNLIDTNSGMTERGICSIPYVRQSDSETVYFPSNLI
    ENLFLSNGMSAGNNLPEAQVQCLSEIFERAVKKQIIAEEIVLPDVPKDVIAKYPAILAGIEGLEAQGFPVVVKDASLGGK
    FPVMCVTLMNPKTGGVFASFGAHPSFEVALERSLTELLQGRSFEGLNDVPKPTFNSMAVTEPENFVDHFIDSTGVVSWRF
    FSAKHDYEFVEWDFSGTNEEENAGLMDILKDLDKEVYIAEFNQLGATACRILVPDYSEVYPVEDLIWDNTNKSLDYREDI
    LNLHRLDDEALTGLFDRLEESQQDNYIDIRTLIGIEFDENTVWGQLTILELKILICLALGALEDATELVGEFLQYNDNTV
    ERGLFYQAVHAVLEVTLDEEMELEDYLGNFNRMFGAENMEQVVGSVYGEVRFYGLTPTSMKLEGLDKHLRLIESYKKLHQ
    ARKLAAQK

    >gi|71280081|ref|YP_268646.1| copper-translocating P-type ATPase [Colwellia psychrerythraea 34H]
    MNTTTQFKIDGMTCASCVGRVEKALHKVIGVTDVTVNLATDTATIQGTASHSELITAVIEAGYQVPVKVKQFGIGKMSCS
    SCVKRVEQALLKVTGMVSASVNLATEHVQVKTLSFVTDEQLAQAVTQAGYLFIPLNNDSVIKITSQHQPFYTKAWWPVLG
    AGLLTLPLVLPMLGMLFAQQWMLPPVWQWLLATPVQFYFGARFYRAGWGALKAGMGNMDLLVSIGTSAAYGLSLYLWWSF
    DSAHGMPHLYFESSSAVITLVLLGKYLEHKAKRRTTDALRALENLKPVEATVQRLGKWQKVAASSVQSGEKVKVIPGESV
    PVDGEILQGQSHLDEALISGESIPLSKKEGDIVTGGSLNLDGILEIRATNVGTESTLSKIIELVEQAQGAKAPVQAIVDK
    VSSIFIPVVLLVALTTLLVTGLVFDDWTNGILNAVAVLVIACPCALGLATPAAIMAGTGTAARLGVLVKDAVALEQAKKI
    DLVVFDKTGTLTQGKPVVNEMTVISGSEETVLQLAYSLQINSEHPLGKAVVEKALTKGTQALPVNEFQVVAGYGVKGNIA
    DNLVLMGSSHWMQEVGVTLPTEQIKIAGASVSWLACQQQDQITLLGLFCFSDKLKSDALQAVKLLQQQGIKVAMLTGDNQ
    ASATSVATELQLDDFKAEVLPADKAKYIIQYQEQGYQVAMVGDGINDAPALAQADLGMAMASGTDVAVSAASFTLMRSKP
    SLVPTALIIARLTYRKIQQNLFWAFIFNAVGIPLAAFGYLDPIIAGAAMAFSSLFVVSNALLLQRWTLKEK

    >gi|71278249|ref|YP_268653.1| pyridine nucleotide-disulfide oxidoreductase [Colwellia psychrerythraea 34H]
    MKTLTTDVAIIGAGPVGLFQIFELGLQGLSTVVIDSLPEIGGQCSELYPDKPIYDIPALPNAKASEVIDNLWQQAAIFDP
    TFLLAERVEHIEKVSEHSFIVTTHKQTQIHCRAVVIAAGNGAFSPVKLKLPLIDKFEDTQLFYRISNIEHFRDKNVVVLG
    GGDSALDWSLTLQKTAKSVLLIHRSSNFKAAKSSVNKMYELCEQLKMQFLCGQVSSFQEKENKLTGLTITSKDGVNRRVE
    LDELVVLFGMSPKLGPIDNWQLEMHQHQIKVDTQSFQTSVTGIYAVGDINYYPGKRKLILSGFHEAALAAFSIAETVLEK
    DRIPTLYTTTSPVVHQRLGVEHSLEAMLS

    >gi|71279318|ref|YP_268720.1| copper-translocating P-type ATPase [Colwellia psychrerythraea 34H]
    MTSQCFHCNEAVPHGINLSVEISQIQQPMCCIGCQAVAQTIVDNGLTKYYAVRTEPAHKGQSLVPEQLQKNKLLDEAILQ
    TEFIYQDNDCKEAILTIDGIS
    CAACAWLIEMQLEKLKGLVKINVNATSQRATVRWQDDALKLSEILQAIEHIGYQALPFK
    ANEAELRNKKQSKAFIKRLGISGILMMQIMMIAFGLYFGAFSEMAEHNKVYLRWVSFILTIPIIFYGALPFYTGAIKAIK
    AKRLSMDVPVSIAILLAFSASAWATITQQGEVYFESVSMFTFLLLIGKFLEFRARSHAAQVSANLLKLMPMTATKVIVSS
    DNIVKETQNNESQTREVLVAAKQLIQGDLVIIKPGEVVPADGVILSGLSQLNEAMLSGEQVPISKTINDNVFAGTLNGDG
    NITVQVKQATNQSFLSQLIRLSEEAQAHKPKIAKLSDKIAQYFVALILLTSIATAIYWQQHMPEEAFWITLSVLVATCPC
    ALSLATPTALTCATTHLNRAGIMIKGGHVMETMPKIDCFAFDKTGTLTTGEFTIDRVELINNDSSYNQGQILAIAAALEA
    HSEHPIAKPFAEHRDYNLTAQEVKVHSGQGVTGTINTIDYAIGKYSWLENSLAEEDGQAKSLKINVNGASCILIANKEII
    AVFYLIDKIRDEAFEVISELNNHNKTLLLSGDSQIACDTIAQTLPVNTVLGGLSAQDKMEQIKQVQAQGYTVAMAGDGVN
    DSPVFGAAHISIAMGCGADITKSGADVILLNNKLNSIDTLIKVAHRTRRIILQNYLWAFGYNAIVLPLAVAGYITPYMAV
    IGMSASSILVITNSLRLLKK

    >gi|71278506|ref|YP_268736.1| glutathione peroxidase family protein [Colwellia psychrerythraea 34H]
    MSNIYQFTVKNNKEETIELNQFTDKVLLIVNTASNCGFTPQYQGLQSLHDSFQTNGFEVLAFPCNQFKQQESGNNEEIQQ
    FCDLHFNIKFPLFDKIDVNGSNAHPLFSFLKQQAPGILGSKSIKWNFTKFLVNRKGEVVKRYAPTTKPEAITADIEKLLV


    >gi|71280248|ref|YP_268865.1| putative lipoprotein [Colwellia psychrerythraea 34H]
    MVKTTESKLKRLFFTVSLAVVLSACQALPLNQSQAIVHDEYVSSGDLLPIEAITTIDGEELDLQQLGKRKLVILFATWCH
    DSNRLLKALNSSPLLEMEGIEIVAIAREEDLETVTAWRDKRGIKVALAVDNDRSIYRRFASGGIPRLITIGENNKIIKMN
    LAEGEQQLAKIVWQ

    >gi|71280959|ref|YP_268919.1| SoxR-reducing system protein RsxE [Colwellia psychrerythraea 34H]
    MSNEIAPPNSNDADITDNTDEQEAAAVLKAERKAEYKELAIQGLWKNNPGLVQLLGLCPLLAVTSTVTNALGLGLATMLV
    LICSNITVSAIRHWVPKEIRIPIFVLIIAAFVTCVQLLMNAFTYGIYQSLGIFLPLIVTN
    CAIIGRAEAYASKNPIKQSA
    FDGLMMGSGFAIILILLGVIREILGQGTLFDGANLLLGDWASVLRIEVMQLDSQFLLAILPPGAFIAMGILIALKNAIDS
    HIKSKKVVDTEQVIERVRVNFDS

    >gi|71279765|ref|YP_268923.1| electron transport complex protein RnfB [Colwellia psychrerythraea 34H]
    MNILIAILVLGSIAAVFGALLGFASVRFKVDADPIVDQLDALLPQTQCGQCGYPGCKPYAQAVADGEAINKCAPGGEDTI
    KKIADLMGVEVQPIDDSHVSGDAPKSNRPKVAFVIEEDCIGCTKCIQACPVDAIIGAAKQMHTIIIDECTGCDLCVAPCP
    VDCIEMRELPDTIHNWQWDLTSIPVKQLD

    >gi|71280304|ref|YP_268924.1| electron transport complex, RnfABCDGE type, A subunit [Colwellia psychrerythraea 34H]
    MTDYLLLLVGTVLVNNFVLVQFLGLCPFMGVSSRTETAIGMSFATVFVMTLASLLSYLVTTYLLVPLNLEYLTTMSFILV
    IAVVVQFTEMVVHKTSASLYRLLGIFLPLITTN
    CAVLGVALLNLRLQHGFFESIIYGFGAALGFSLVLIMFSAMREKLAN
    ADVPAPFKGTAIAMITAGLMSLAFLGFTGLVKI

    >gi|71280338|ref|YP_268961.1| thioredoxin [Colwellia psychrerythraea 34H]
    MNIVCANCFTTNRIPDDKDYNKGKCGKCQQGVYSPKPTELTANTFYPFIERNDLPVIVDFWASWCGPCQNMAPVYSKVAQ
    SSPSLLFTKVNTEQVQQISADANIRSLPTLVFFHQGEEVDRISGGLNEMQMKQWVVQCLQKIAN

    >gi|71279901|ref|YP_269062.1| methionine-R-sulfoxide reductase [Colwellia psychrerythraea 34H]
    MKNNDEYKDKLTDAAFKVCRLAATEQPFSGIYNDHWQQGLYHCACCEQPLFSSYSKFDAGCGWPSFFAAIETKVAYKSDE
    SHSMQRVEIQCDNCQSHLGHVFDDGPKPTGKRY
    CVNSLSLKFYSE

    >gi|71280004|ref|YP_269069.1| putative sulfur oxidation protein DsrE [Colwellia psychrerythraea 34H]
    MKTLAVVVTTPPYSHLTITALTYVETALAAGINVIGVFFYQDGAMHANENISIASDEYQAIAHWQRLNQQYQLPLHICIT
    AAEMRGIACDSIDNEQINEAFTVSGLGELVELTTKATRLVQF

    >gi|71281592|ref|YP_269128.1| glutaredoxin family protein [Colwellia psychrerythraea 34H]
    MKRVVLYISDKCPHCREAQKYLDDNGIKYRLTNAKMQRGRKELDAIGARSVPALKIGTKVMIGWNQKHFIELYAAD

    >gi|71278435|ref|YP_269211.1| putative glutathione S-transferase [Colwellia psychrerythraea 34H]
    MTKENSVKIYGDIQSGNCYKVKLLTSLLDIDHEWIEVDILASETQAESYLKKNPNGKIPLLELDDGTFISESNAILNYLA
    AGTSLVGTCRFTTAKVLQWQFFEQYSHEPFIAVARFIAKYLGLPEERKAEYEAKQLGGHKALKVMEEQLQCSPYLVGSEL
    TIADISLYGYTHVADEGGFELSEYPSIQQWIARIQANPKYIGME

    >gi|71278576|ref|YP_269225.1| putative thiol:disulfide interchange protein [Colwellia psychrerythraea 34H]
    MLNRIIILMIAMTSLNINAETVLELGEYPPNYLGRDVNGNDVTLEDNKGKIVVISFWASWCSPCLKELPILEGIQNKVGD
    DKVKVVAINFKENSKQYRRIKNKLSTLKLTLTHDKRGAIGKKFGVKGIPNLFIVGKDGKLLFHKIGYGASSINKIVKVLN
    EELAS

    >gi|71278816|ref|YP_269272.1| putative heme-binding protein [Colwellia psychrerythraea 34H]
    MLATDTPLTEVVTATQGLDIDKVPTLMGDTVSLNSQGKTTILYFFAPWCQVCHASIGNLQALFQKNENIDVVAIAMDYTG
    TKEVMGFTSQHQLTFPIALGNEAIKHAFEISGYPSYYVLNEENVIIGKSMGYSSELGLYLRSL

    >gi|71279544|ref|YP_269311.1| biotin biosynthesis protein bioC [Colwellia psychrerythraea 34H]
    MVQTEHKNTNRVKIGKSFGSASKSYDVSARLQRFSGKHLMPWLPNRNDLTVLDLGSGTGFFTDLLASTYNQVIGLDISNE
    MLHFAKEHRNKKILWLEADAHKLPLQDNSIDFIYSNLVIQWFDPLDEAITEMLRILKPGGLLIFTTLVDGTLHELKSSWK
    QVDDDQHVIDFKTVTELNTLFNNENGKLVEQK
    CQDIVLEYQNVIHLARELKGLGANHLAQKQNRGLSGKDKWFKMTEHYQ
    DFLEPSGIYPATYRLFSGLVVKLNN

    >gi|71281913|ref|YP_269316.1| anti-oxidant AhpCTSA family protein [Colwellia psychrerythraea 34H]
    MKVNINFTKINSMKKSILVICSLVSLVGFSALATDLKVGDIAPNFKLQATTGDYYQLSDYKGKQAVVLAWYPMANTRGCT
    IECKSLTEQGHLIREFDVSYVMASVDPIDDNRDFAEKTGADFPMLSDPTKTAAKAYQVLNMFKVASRVTFYISKEGKIVK
    IDDNISPKSAAQDMAYNLAALGIAKQ

    >gi|71280097|ref|YP_269352.1| methionine sulfoxide reductase A [Colwellia psychrerythraea 34H]
    MLRPNMKTQQTKNDVHEPETIYFAGGCLWGVQEFIKHLPGVIATAAGRANGLTNTTKSSYDGYAECVEVIFIPNTVNVIE
    LIGYFFEIIDPYSINKQGEDVGKKYRTGIYSKQSSHLKVAIGYITRRDDADKVVVEILPLLNYVKSDEEHQERLTRFPND
    YCHIPKKILHKYK

    >gi|71279955|ref|YP_269387.1| putative glutathione S-transferase [Colwellia psychrerythraea 34H]
    MYTLYYSKGACSVATQVVLRELGQEVTIIDVQQLSNFKTINPVGAVPVLVDGDKTLTEGAAIMLHILNKHNSALFPDTEN
    DRQQAIQDIMFANASMHPAYSKLFFLAEHINDEKVKQETLNSAAKTINQLWQIVENQLSNNKFLGGSAPSAADIMLTVYS
    RWGAYFPVDIIIGEKTIMMLNAVQAMPSFIKTDQAEQAMSSTE

    >gi|71279308|ref|YP_269413.1| dsbA-like thioredoxin domain-containing protein [Colwellia psychrerythraea 34H]
    MNNKTIFISVAAFIGVIFIAAVGVYKSQQPSTVASEQLPALERIGAPSKGGKQAKVTIVEFFDPACGTCSQFYPLINNLV
    KKYQGKVNVVMRYAPLHKGSDNVVKMLEAAHLQGEFWPALELLFANQQRWVEHHVSNPTRALAGIKTLNVDHDQLDTDWQ
    SSNIAKIIAQDIKDGQTLKVRATPQFFVNGKPLVVFGYEELVYLVEEAVAEAY

    >gi|71281844|ref|YP_269474.1| thioredoxin-disulfide reductase [Colwellia psychrerythraea 34H]
    MSDVRHCPLLILGSGPAGYTAAVYAARANLKPVMITGMQQGGQLTTTTDVENWPGDADDLTGPALMERMQKHAEKFDTEI
    IFDHIESVDFSSKPYKLTGSSEYTCDALIICTGASAQYLGLPSEEAFMGRGVSA
    CATCDGFFYKNQKVAVVGGGNTAVEE
    ALYLSNIASEVHLIHRRDTFRSEKILTDRLYEKVANGNIVLHTDRTLDEVLGDNMGVTGLRLKEMGSDATEELEVSGVFI
    AIGHKPNTDIFKDQLDMKDGYLTIQSGTQGNATQTSVEGVFAAGDVADHIYRQAITSAGAGCMAALDSERYLDAL

    >gi|71281814|ref|YP_269502.1| putative electron transfer protein [Colwellia psychrerythraea 34H]
    MKKTLALVLFLIAFTASATAAEQVDSPQQSLEQALLKQEGKVVYIDFWASWCGPCVKSFPWMNKIQQQFKEQGFTVISIN
    LDADETNAQQFLQDNPASFAVIYDPKGTIAKHFSIQGMPTSMLINRDGVIKYRHSGFFTGKINQYEDEIKRLLNSSSPTL
    SKDIPNKTHNMAHNKTKRDNHESE

    >gi|71280835|ref|YP_269766.1| putative peptide methionine sulfoxide reductase MsrA [Colwellia psychrerythraea 34H]
    MDNIMHSEEFSKIGFGGGCHWCTEGIFESLIGIKAVNQGWIASIGCDAELSEAVEVYFDESIISLQTLIEIHLHTHASTA
    NHSMRQKYRSAIYTYNDAQNQDAKRVLDSLQCDFDKKIITQVLPFDAFKKNKDELTNYLYSSPDKPFCKTYIHPKLRILL
    TRFKHQVNERKLALCIPNND

    >gi|71281656|ref|YP_269767.1| methionine sulfoxide reductase A [Colwellia psychrerythraea 34H]
    MTIERTILAGGCFWGMQDLIRKLPGVTSTRVGYTGGDVINATYRNHGNHAEGIEISFNTDVVSFRSILELFFQIHDPTTK
    NQQGNDLGASYRSAIYYCSTEQNTIAMQTIIDVDASGLWPGPVVTELVPVGDFWEAEIEHQDYLQNTPNGYTCHFPRSDW
    VLPSVK

    >gi|71282193|ref|YP_269768.1| methionine sulfoxide reductase B [Colwellia psychrerythraea 34H]
    MTKYHKSTHVISALTKEQYRVTQESGTERAGSGEHLNNTSPGIYVDIVSGEPLFASSDKYESGCGWPSFTKPITSKNIQE
    LSDSSHAMVRTEVRSSHGDSHLGHVFKDGPTSKGGLRY
    CINSASLRFIHRDEMVSNGYGDYIDQVEDLSI

    >gi|71278105|ref|YP_269845.1| putative phage shock protein E [Colwellia psychrerythraea 34H]
    MKHILVKKIATTIVFVLAVTTTWQVSAKDISQTELQQIMKNDKQVILLDVRTEEEFEEGHIPNAVNIPHKELEARLAELT
    GAKNTQVVIY
    CRSGRRAEVAREVLVKNGFNELDHLSGDFNEWSSNNLPIIKVK

    >gi|71277796|ref|YP_269874.1| ArsC family protein [Colwellia psychrerythraea 34H]
    MITLYGIKNCDTVKKATKWLEANDIAHQLYDFKKQPLTAELLTEFVSQSDWSLLLNKRSTTFRNLPDEIKNNLTDEIMFA
    AVLEQPTLLKRPLLPLNGELNLGFKVDQYQTLFADK

    >gi|71280359|ref|YP_269882.1| thioredoxin-dependent thiol peroxidase [Colwellia psychrerythraea 34H]
    MNTLNVGDTAPLFTLNNENDEPVSLTDYIGKQQVLIYFYPKAMTPGCTVQAQGLRDIKAELTELNTVAFGISPDEVKRLI
    KFCQRDELNFSLLSDVDHQVADQFGVWGLKKFMGKEYDGIHRLSFLIGLDGKISHVFNKFKTKEHHDVVLAVLNELKK

    >gi|71279048|ref|YP_269887.1| arsenate reductase [Colwellia psychrerythraea 34H]
    MFTIYHNSRCSKSRQTLALLEEQAQKTNQEITIVEYLKTPIDHAQIKQLLAQLNCTAIEMMRVKEAEFSENNLKGANEEE
    LINAMANTAKLIERPIVTDGNKAIIGRPPENVLTFFKQ

    >gi|71280679|ref|YP_270006.1| organic hydroperoxide resistance protein [Colwellia psychrerythraea 34H]
    MTTLYTTTATASAGRNGQVSTDDNMLDLALSYPKEMGGTGAATNPEQLFAAGYAACFSNAILHVAGGQKLKLATAPVSAE
    VGIGPNEAGGFALSVSLAVTLELDDEQAIALVKTAHQV
    CPYSNAVNGNIDVKLTVNGAAL

    >gi|71281861|ref|YP_270029.1| methylated-DNA--protein-cysteine methyltransferase [Colwellia psychrerythraea 34H]
    MDNFESHRHYQVVEKAIQFINTNFDKQPTLLDIAGSVHMSEHHLQRVFSQWAGISPKRFLQFITKQAALDALQNTNNLLD
    ASHSIGLSGSGRLHDLLVTCEGMTPGELKGGGEGVMIQYGVCSTPFGEAILAWTLRGVCYLQFIKDKQQPVIDELYRQWP
    NASITPNREEAVQMGNGIFSSSIERGKIHLLLKGTNFQIKVWEALINTHSSQQLSYSQVSQLIDSPKSARAVGTALANNT
    IGYLIP
    CHRVIKNNGEIGNYRWGIERKTAMLAWERASLEESS

    >gi|71281389|ref|YP_270032.1| redox-active disulfide protein 2 [Colwellia psychrerythraea 34H]
    MKEIKVLGTGCAKCTKTVEVITKIANELNIDVHVVKETDLEVIMGYGVMSTPAVIIDEINVHSGSIPHREHIESWLRK

    >gi|71281050|ref|YP_270043.1| peptide methionine sulfoxide reductase MsrA/MsrB [Colwellia psychrerythraea 34H]
    MKNILFIIALALISILTVYAVAPKSTEYSTTNSTINSTNTQSDIEKMMPKSSNSTKEMPATTHLDSIVLGAGCFWGAEKR
    YQAIPGVVDAISGYADGKNVSASYREITQRKNKYNEDNHAEVVKVIFNSAKVSLETILQSYYEGHDPTQLNRQGNDIGTQ
    YRSTILTSNEQQNDIAQKVTAQYQTLLNDAGYGNIATKISSLSKFFEAEQYHQDYLAKNPNGYCPDHSTGVKFDADASKP
    GLASQKIDNTPLLTGKHIIVIESENYCPYCEKFKKNVANDYKGSIAINFRLASQLKGLTIKTETWATPTIIFIEDGEEVF
    GKQGYMSPDYFYKALGAFKLGKSEAFNVAFDEGTDSRFCKEYEIFKNTPDGVFIDKLSGAPLFDTDDRFNSASGWLSFTK
    AVDGSVIEKPDNRYGMVRTEIRSKTSGIHLGHVFPDGPNGQPRF
    CINATVLEFKAR

    >gi|71278810|ref|YP_270071.1| putative thioredoxin [Colwellia psychrerythraea 34H]
    MKQLTSADSIDDLLSQHQYSLLYFTASWCGPCKSMSPIVEDVSGLMNGRFNTIKIDIDNMANVAADYGIRSVPTLMLVKN
    NEIIDQRVGGLPPQQMMQWLDKLA

    >gi|71282444|ref|YP_270148.1| anti-oxidant AhpCTSA family protein [Colwellia psychrerythraea 34H]
    MSVLVGRQAPDFTAAAVLGSGEIVDSFTLSEAINGKKAVVFFYPLDFTFVCPSELLAFDHRMEEFKSRGVEVIGVSIDSQ
    FSHNAWRNTPVNDGGIGPVQYTLVADTKHEICKAYDVEHPEAGVAFRGSFLIDEEGNVRHQVINDLPLGRDVDEMIRMVD
    ALQFHQDHGEVCPAGWNKGDKGMTASPEGVASYLTDNADKL

    >gi|71280607|ref|YP_270149.1| glutaredoxin,-like protein [Colwellia psychrerythraea 34H]
    MDTIERIKEQISENTILLYMKGSPKLPNCGFSSQASQALISCEEKFAYVDILQNPDIRAELPKYADWPTFPQLWVDGELV
    GGCDIIMEMFQQGELQTLVKAAASKNASAEDSSADA

    >gi|71281406|ref|YP_270187.1| disulfide bond formation protein B [Colwellia psychrerythraea 34H]
    MNYLSNITTSQRPWLLLALAALGLELSALYFQYVLGLAPCIMCVYQRLAILAIFSAGAIGAIGHQNIVARILAYVLWGVG
    AIWGLIIALEHVEMQKNSGSLFFS
    CEFIPNFPTWAPLHEWIPFLFEATGDCGEISWRFFNYSMPQWMVVVYALFSIVFSI
    VLINRLVCAKKP

    >gi|71281238|ref|YP_270247.1| anti-oxidant AhpCTSA family protein [Colwellia psychrerythraea 34H]
    MNFPTSNIALCAFFIASFTIAFTSHSDNFDSKKLKSTQNLVKAGDKYVTLLGEQVNVGEQAPQFKVVDKNFAPVTLADFQ
    GQTVLISVVPSLDTGV
    CSIQTKRFNEEAAKLPENITILTISNDLPFAQKRFCDAEKVDNIKVLSDSVWRDFGTSYGLLIK
    DMGLLTRAIFVINNQGKIVYKELVANISQHPNYDKALAKVRYTAPVIVIDPEAEVDATKELPVKETEK

    >gi|71281752|ref|YP_270302.1| hypothetical protein CPS_3634 [Colwellia psychrerythraea 34H]
    MLMKAIRWPIGQLILLLNLTFSPRSPKRAADEQAKIDDKTRTLSLYQLPSCPFCVKVRRTMKREGLKIELRNINGNNDYS
    AELVREGGKRKVPCLRIEKEDGQVQWLYESSDVVSHLQALTKAA

    >gi|71279960|ref|YP_270485.1| putative thioredoxin [Colwellia psychrerythraea 34H]
    MNHIFRTMFFVFVSLIIGASFTVNANETAKPWQLKTQNGEVISLEQYKNKPVILHFWATWCPYCKKLQPTLVALQKKYQA
    QGVELISISFNEDEGAKPQDEINRRGYSFLTGVMGEEVAKLYGVRGTPTTFFINRKNEIIWKTSSSDKADPRFDLALQEI
    IKNN

    >gi|71281156|ref|YP_270598.1| alkylhydroperoxidase [Colwellia psychrerythraea 34H]
    MSRINLVTPEQANPEQAELYAAITSQLGMVPNFLKVFANSPAALKAFLGLHSIANEGELTSKTKERIALGLAEQNACEYC
    VSAHTAIGKGVGLTEDEMAENRAGGSQDAQAAIAVKFARSLAEHNGEVTTAELLEIRNAGYSDAEIVEIITHVGMNIMTN
    ILGKASRVAIDFPKISLQKAS

    >gi|71281370|ref|YP_270750.1| thiol:disulfide interchange protein DsbC [Colwellia psychrerythraea 34H]
    MFKTFIISALLATFTLPLLLQYTNAAEQTNVPATLAKPVSDQIALDADFLKEKINSSIGLTVVKVEETALPGIALLVTNQ
    GLFYASYDGEFFIQGKVYNLGSTVKDIGEESLAKVRLEGLKSFEDNMIVYKAENEKYVVSVFTDIT
    CGYCRKMHEKMADY
    NARGITFRYLAYPRAGIKDQNGNLTQGFKDLRSVWCSEDNATALTKAKSGTGIAYRICEAPIEAQFKFGRQIGVSGTPAI
    ILSNGMMVPGYQPPEQLEELLKNT

    >gi|71280566|ref|YP_270888.1| hypothetical protein CPS_4238 [Colwellia psychrerythraea 34H]
    MSLILSNNYQALGESFSQQTLPAPVGQPSLLLWNEPLAKALTIPFTKDNDAELLSQYFSGNQLIEGSKPVAQAYSGHQFG
    HFNPQLGDGRAHLLGDIADTQGQRWDIQLKGSGVSDFSRQGDGRCALGPALREYIMSEAMFALGVPTTRCLAVVTTGENV
    YRERPYDGAVVTRIAASHIRVGTFQYFAARGDTDSLKKLTNYAINRHFPELIANSSENSSDNSDALKADNVISSQQVLEF
    FSAVLSKQIPLVLSWLRVGFIHGVMNTDNTTISGETIDYGPCAMMNAYHPETVFSSIDRNSRYAFGKQISIMQWNMTRLA
    ETLLPLVDSDEDDAVEKIEPLLTQFHQDLQQGYLTMMAAKIGIDEPAEGDGKLINDLITLMKEQKLDYTQTFTALTDSLN
    DNTTEEPLTDVLNEWLPHWNSRIESFKSSAHTLMVSNNPIVIPRNHHVEAFLDSCQETGDLTALNKFLAVLRQPYTEIAE
    TKNYQDAPVDGDKDYHTF
    CGT

    >gi|71280687|ref|YP_270931.1| thioredoxin [Colwellia psychrerythraea 34H]
    MIKVEEILAEQFYQEVEQASGKVLIDFYAPWCAPCKMLAPVVEQIAQEHEDIKVIKINADNSQELMAEFGIRGIPTLLLM
    NKGELVATQVGAASVSQVTKFVQQ

    >gi|71278306|ref|YP_270997.1| thiol:disulfide interchange protein DsbA [Colwellia psychrerythraea 34H]
    MNKLLKSLLLMPLLALSVNAAAAQYTEGEQYTKVNETVTKKKEVREYFSVYCGHCFKFEPIMHSLKKSLPEDASFERNHV
    DFLRAASPKIQQMITKATVVAEQLGDSDKLIGAVFNYIHVQRAVITTEKDLRNIFVLNGADGDKFDKLMKSFSVNSQAKT
    MKKYQENMTAKRVLTGVPTIIVNGKYKIDPAKLDRNNFEQDYQNLVKYLLELDS

    >gi|71278241|ref|YP_271004.1| peroxiredoxin/glutaredoxin family protein [Colwellia psychrerythraea 34H]
    MFTDITGQKVPSVTFPIIADDTWSTRNSEEIFANKTVVVFSLPGAFTPTCSSSHLPRYNELATKFSANGVDEIICISVND
    TFVMNAWAKDQDADNISFIPDGNGEFTQGMGLLVDKAAIGFGKRSWRYAMLVKNGVIEKMFIEPDLPGDPFEVSDADTML
    NFINPEAVQSTEVAIFTKHG
    CSHCTKAKALLAEQGLQYEELVLGEDTTITAMRAISNADTTPQIFIDGKHIGGNDELVKH
    FS

    >gi|71281919|ref|YP_271038.1| glutaredoxin [Colwellia psychrerythraea 34H]
    MAKVEIYTKEYCPYCTHAVALLKSKQTEYNEIKIDDDMEMRSTMIERTNGGYTVPQIFINDVHIGGCDQLVALERNTQLD
    ALLDAK

    >gi|71279073|ref|YP_271039.1| rhodanese domain-containing protein [Colwellia psychrerythraea 34H]
    MEQLITFASDNGMLSAVWVALVVMIIVTTVKMKMSPIKQISTQDLTFLMNKEEGIALDIRKEKEFKAGHILDAINLPSEK
    INKNDFTSLEKYKDKPIIVV
    CAAGMSAVQIANDLYKGGFTRASVLKGGMNSWTSAGLPVAK

    >gi|71279029|ref|YP_271246.1| thioredoxin family protein [Colwellia psychrerythraea 34H]
    MVNSLKTLVNLLIITMALLLTCKSTHASGPVKEFEQAMAQHKGKIVYVDFWASWCVPCRKSFPWMNAMQAKHQEQGFVVL
    SINLDAEETLSTKFLKQTPANFAIIYDAKGKLAQKFKLKGMPSSYLFDRQGKLISAHTGFNGKKQQQYEHEISQALAQ

    >gi|71277930|ref|YP_271269.1| HesB/YadR/YfhF family protein [Colwellia psychrerythraea 34H]
    MSNPELPIKFTDSAASKVLSLITEEENPALKLRVYVTGGGCSGFQYGFTFDEKVNDGDMTIEKQGVMMVIDPMSLQYLVD
    GEVDYLESLEGSRFVVNNPNATTTCGCGSSFSI

    >gi|71280283|ref|YP_271289.1| adenylyltransferase ThiF [Colwellia psychrerythraea 34H]
    MLSNQEQLKYSRQIILDKIGNQGQIALRNAKVLILGVGGLGNPASLYLAAAGVGTLYIADGDYIELSNLPRQILFSEDNI
    NENKADVAAEKLQQQFPDVTIEAIDEMFDEELSDYYLPQVDLVLDCSDNIQTRYLINQACVQHKVPLIVGAATGFDGQQL
    TIDPRDETSACYHCLFPASEKAPTDN
    CQTIGIIGPVLAMIAGMQSLQAIKLLTGNKVQLNQLNLLDGLANQWQQFTMKKQ
    KSCTVCGSN

    >gi|71281858|ref|YP_271360.1| alkyl hydroperoxide reductase, F subunit [Colwellia psychrerythraea 34H]
    MLDTNLQTQLKSYLDNLKTPVELITFTDESPKAKELAQLVTQIAELSPLITEINGNNSEQAANERVPSMLVRSVASNSEM
    RFAGLPMGHEFTSLVMALLHSGSHPLKIEAEQIEQVRNLEGDFVFETYISLS
    CQNCPDVVQALNMMAAINPNIKHTMIDG
    SLFQTEVFDRDVMAVPSVYLNGESFSQGRVSLTDILNKVDTNAGARQAKALENKDTYDFLVVGGGPAGAAAAIYAARKGI
    NTGLVADRFGGQVSDTMAIENFISVKATQGPKLVASLEEHVREYDVDIMNSNKASKVKRNEATGLVEVSLENGAVLKSKS
    VVLATGARWREMNVPGENQYRGKGVAY
    CPHCDGPLFKGKPVAVIGGGNSGIEAAIDLAGIVEHVTVLEFADTLRADDILV
    RKANSLTNVTIITNAQTTEVHGDGTRVTSLSYTDRGTGEHHSLALAGIFVQIGLMPNTEFLQGEIELTNRGEIIAGSRGE
    TSITGVFAAGDVTNNPYKQIIIAMGSGANAALGAFDYLIRQDV

    >gi|71279436|ref|YP_271361.1| alkyl hydroperoxide reductase, subunit C [Colwellia psychrerythraea 34H]
    MNQSIINTKLLPFNATAFHNGEFVELSEKDLADKWSVVFFYPADFTFVCPTELGDMADHYDELQKMGVEVYSVSTDTHFT
    HKAWHDTSDTINKIKYPMIGDPTGAITRNFGVMIEEAGLALRGTFVINPEGEVKIAEVHDLGIGRSAAELLRKVKAAQYV
    AEHDGEVCPAAWQPGAETLAPSLDLVGKI

    >gi|71277935|ref|YP_271437.1| hypothetical protein CPS_4798 [Colwellia psychrerythraea 34H]
    MSSSEKQLSTPATIQTASTITICALYKFVRLDAYEALREPLSNKMASVDVKGTLLLAAEGINGTIAGPQTGIDTVLAFLG
    EQPGLDNISHKESYSEENPFHRTKVKLKKEIVTMGIEGIDPNQVVGTYVKPKDWNALISDPEVVLVDTRNDYEIEIGTFK
    NAINPNTETFREFPDYVAKNLDKNKHKKVAMY
    CTGGIRCEKSTAYLKEQGFEEVYHLEGGILKYLEEVPSTETMWEGECF
    VFDGRVAVNHELEQGQYDQCFACRFPLTDVEKESEHYVKGVSCHRCHDKVSEQQRSRYAERQRQISLAEERGESHIGGDI
    QNIIEERRQEKNDKKAKQANK

    >gi|71277775|ref|YP_271444.1| dihydrolipoamide dehydrogenase [Colwellia psychrerythraea 34H]
    MSNNIKTQVVVLGAGPGGYSAAFRAADLGLDVVLVESRETLGGVCLNVGCIPSKALLHVAKVIDDAAAMASHGVTFGKPE
    IDLDKIRGWKESVIAQLTGGLGSMSKARKVATVYGYGKFTSDKTIEVEGNDGEKTTITFDNAIIAAGSSVIDLPFIPNDD
    PRVIDSTGALELKDVPEELLVLGGGIIGLEMGTVYSALGSNVSVVEFADQLVPAADKDIVRVYNNYNKKKFNIMLSTKVV
    AVEAKDDGLYVTFEGKKAPKEQVRYDKILVAVGRKPNGHLVAADKAGVNVDERGFINVTNELRTNVPHIFAIGDVVGQPM
    LAHKAVHEAHCAAEVISGKKHTFEPRCIPSIAYTDPEMAWVGVTESEAKEQGLNIEIANFPWAASGRAIASARTEGKTKL
    IFEKETGRILGGAIVGINAGEMLGEICLAVEMGADAEDIGLTIHAHPTLNESIGLAAEIFEGSITDLPNAKAVKKKK

    >gi|71278534|ref|YP_271456.1| peptide methionine sulfoxide reductase MsrA [Colwellia psychrerythraea 34H]
    MTDQRNDKAVQTATLAGGCFWCIESALNMVKGIITAKPGYMGGQSTAPTYEEVCTGSSGHAEVVQLEFDSEVISYREILE
    IFFSLHNPTQLNRQGNDIGTQYRSEVFTHDALQQKIALAIIEEINQEQLFDDSIVTEVSPAVTFYCGEDYHQNYFKNNPE
    NQYCQAVVSPKLAKFRKTFVAKLK

    >gi|71277811|ref|YP_271623.1| glutathione reductase [Colwellia psychrerythraea 34H]
    MTQHFDYLAIGGGSGGIASANRAAKLGKKAAVIEAKYIGGTCVNVGCVPKKAMWYAGQISDALKYASDYGFAQHLTQDTP
    QFDWAKLVANREAYIERIHAAYQRGFDANDVTVIDGFAKFVDKNTVEVNGELITADHITIATGGRPTLPNIEGADYGIDS
    DGFFALTEQPKSVAVVGAGYIAVELAGVFHALGTKAHLLVRKEKPLRGFDNMLSDTLVEQMAKHGPTLHNHSTPERIEKL
    ADGSLVIHLTNGKTIGPVETLVWAIGREPATDNINLAAAGVAMNERGFIETDKYQNTNVDGIYAVGDNTGRAQLTPVAVA
    AGRRLCERLFNNKPEEHLDYSGIATVVFSHPVIGTVGLTENEAIAQYGEENITVYKSQFTALYQAITEDHRDPTRMKLIC
    AGKEEKVVGLHSIGFGSDELLQGFAVAMKMGATKADFDNTIAIHPTSAEEFVTM