Clostridium tetani E88 uid57683

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|28209917|ref|NP_780861.1| thiol:disulfide interchange protein tlpA [Clostridium tetani E88]
    MINLKKKVTIFLILILIILSSVFYKFYVDKNQKDIDNKSNTTTQTEISEDKPKRIASLDFKLKDLNDKEITLSEFKGKKV
    MLNFWATW
    CGYCVQEMPYMQNIHNETKDKDIVILAVNVGENKDKIKKFMEKKSYDFPVVLDERQEVAQNYGVQAFPTTLF
    IDEEGFVYSGIQGPMTDDIMRKELKIK

    >gi|28209920|ref|NP_780864.1| methionine sulfoxide reductase A [Clostridium tetani E88]
    MKGVKFMKEIILAGGCFWGVEEYFSRIYGVVDTKVGYVNGVTKNPSYEEVCNGNTGYAEGCYIKFDESIIGLKRILDKFW
    DIIDPTILNRQGPDVGHQYRTGIYYYDKEDLDDILKSKDEISKKYDKPIVTEVEKVTYFYLAEEYHQKYLKKNPNGYCHI
    NLDN

    >gi|28210151|ref|NP_781095.1| putative permease protein [Clostridium tetani E88]
    MQNEMDKLIEERQGKLNKKKNQTPHGVIISFIILILCCILFPNQYKYAICLGAGVIIGIILRYSRFCFAAAFRDPFISRN
    TALLRGMILAMMVSTIGFAVIQSGYTYDKVINYDLIPGAVSSVGIHVMIGAFIFGIGMVFAGG
    CASGVLMRIGEGHALHL
    VVLLGFIIGTLLGARDYSFWYHRFIKNAKTIYFSEYMDLKYVVFTQIIVLIILYRLALWYENKSQEDI

    >gi|28210152|ref|NP_781096.1| hypothetical protein CTC00398 [Clostridium tetani E88]
    MGSIYPKINRKIGTNRMESIKKYLKRPCPYWVAGILLGLMNVILLGTIRISWQITSGFLLWGIGILQWFGLEPLNWEYFK
    YFKSYYQPVILYENVFINQYTILNLGVLIGSLIATLLVSQFKWKRIKSKKQFIMALIGGVMMGYGTRLAVG
    CNIGAFFSG
    IPSFSLHAWIFGVFAMLGTWVGVKILTKYFI

    >gi|28210154|ref|NP_781098.1| putative transporter [Clostridium tetani E88]
    MKKKQVYIGFIILILMAIFGVMQYTKDYKLALHLIIGLTIGYVMQRSRFGFAGGIRKLYLTGDSSLTKALMFLFSITLII
    TAAIHYGAYVNGADVYYRAVESGVAAIPGSDYVEPANLATILGGIVFGIGMMLGGG
    CASGTLTDAGEGEGRGLIVLFFFC
    TGALWGAHDMPWWKQSIFFQVKKQLYLPDIFGYMGTIIISLLGYLCIYIIAKKYEDKRRRENTLSLEQYADWEKELSQPA
    EYKFFSKETYHKFFVKRWSYYTGAVCIMIMFVTILVTTGTSWGVTAVFAEWAGWFYQSLGLIDISTWPWFQGMMPTMKAG
    FFNDPGSMRNSGILIGALISPLLAGRFSFKKGFKLRDVVFYAIGGLMMGYGARIALG
    CNVGALYSGLSNMSLFGWVFLPS
    LTIGGILGVNLAKKLKVTI

    >gi|28210514|ref|NP_781458.1| thiol peroxidase [Clostridium tetani E88]
    MNVTFKGNSVTLVGNELKIGDKAPDFTVVNNNMEDFSFKDTKGVRIISAIPSLDTPVCDLETKTFNKEASAIPNVTIYTI
    SMDLPFAQVRWCGDNGIDNLTTLSDFKDRIFGKNYGTYVKELGLLARAVFVIDSDDNIVYVEYVSEIGNQPNFEKVLEAA
    KNAK

    >gi|28210526|ref|NP_781470.1| hypothetical protein CTC00809 [Clostridium tetani E88]
    MLQTLKATTKKLPEGLQVNSTSRGFKVLLDEPEELGGTDKGMNPMELVLCALGACQTIVAFAFAEQNGIDLEDFWVDLEG
    DFDADGFLGLSDVRPGYSEIRYKMHFKSNSSEEELNKFAQFIEKTCPVGDSIENGVKLVQAGIVVEK

    >gi|28210548|ref|NP_781492.1| hypothetical protein CTC00831 [Clostridium tetani E88]
    MWNIFCLSVTIININNLIKGGLLMNIVTMSDIAYEEFLDFLKENGVENNVLRIHLAGMGCSGPVFNLIIDEEKPNDEIVK
    IHDVTFLIDKNLISQFGGFVIECAEENGLAGFSLEPIVKPDTGGCSTCSGCH

    >gi|28210559|ref|NP_781503.1| thioredoxin reductase [Clostridium tetani E88]
    MNKEEKILDLVIIGSGPAGLTAAIYASRMKLDFIVLENELVGGQIRSTYSIENYPGFRSISGEELVNKIYDHAVDLGAKI
    DEFDEIQYIKLTEEEKLIETYEYIYKPKAVIIAAGAKYRPLPIPEEKKYHGNGIHH
    CELCDGEFYQNKSIMVVGGGNSAL
    EGAIFLSRYAKNITMVHQLDYFQGEKSLQDEVFNNSKIKILWNTDIKNAFGENKLEEVLVEDLKTKEQYKINVDGIFVYI
    GMVPNTDLYKDYINLNERGYIIADESTKTNIEGVFAAGDVRAKQFRQLVTANADGAVAALSAEKYISKKRRENND

    >gi|28210596|ref|NP_781540.1| putative thioredoxin [Clostridium tetani E88]
    MIYNGEVSMEELKDIKEIENKIKQNEMVLIYIWGNSCNVCHDLKLKVEEVIKAYSNIKCYDIELDKVKGVQSKFSVFTVP
    IILFYIKGKETLRESRYLNIREFKNNIDRYCKLYYN

    >gi|28210605|ref|NP_781549.1| peroxiredoxin [Clostridium tetani E88]
    MKDCKEEKHKCLNIGMKAPDFCATTTFGSIRLSDFRGKWVILFSHPGDFTPVCTTEFIGFAQCYPYFKKRNVQLLGLSID
    SNPSHLAWVYNIYINTGIQIPFPIIADRDGSISRMYGMVSPYISSTETVRSVFIIDEDGIIRTILTYPLTNGRNIGEILR
    MVCALQTTDEEKVVTPANWIPGRPVMVPPPKTYNELINRRKDNPELCCIDWYWCYKKQNKNFA

    >gi|28210673|ref|NP_781617.1| thymidylate kinase [Clostridium tetani E88]
    MRNIFNLLVLAAFKIYSIFFILGYNNIKQLIKGSDSMTNSNRVPNRLAQEKSPYLLQHAYNPVDWYPWGEEAFQKAKEED
    KPIFLSIGYST
    CHWCHVMERESFEDEEVAKVLNDNFISIKVDREERPDIDNIYMTFCQAVTGSGGWPLTIIMTPDKKPFF
    AGTYFPKEDRYGVRGLMYILKEMSNQWKNNRELILNSSEKLLKDMSQYISVSQREDLNKEVIKECFEVLKESYDPIHGGF
    YDAPKFPTSHKLMFLLRYYRLYKDEEALNIVEKTLKSMYKGGIFDHIGYGFSRYSTDDKWLVPHFEKMLYDNAMLTIAYA
    EMYQITKEELYKEIIEKTISYVIRDMKDKKGAFYSAEDADSEGVEGKFYVWTLEEIEDILGKEDAKLFSKYYGITDRGNF
    EGENIPNLIETPLEDLEPDVKDKLENIRKTLFINREKRIHPHKDTKILTSWNGLMIAALAYSGRVLKRKDYIESAEEAVK
    FIMKNLIDENGRIYVRYRDGERAHKGHLEDYSFLIWALIELYQSTFKTEYIEKALKINYDMIELFWDEENHGFFHTGKDG
    EELILKLKESYDSAIPSGNSVAMYNMVRLSRITGDSKLDEIIQQNLNYFSGRIKSTLESHTFFLISYMHYVLESEEIVIV
    KGEDEDIFKAMIKVINEKYHPFSMNIVKDEKVEKLMPELKEKNNIQNKTTVYICKNFACGNPIISLEDLIDKY

    >gi|28210727|ref|NP_781671.1| electron transport complex RsxE subunit [Clostridium tetani E88]
    MSMGDRLYNGIIRENPTFVQVLGMCPTLAVTSSAMNGAGMGLSTTVVLIGSNVAISLLRKVIPDEIRIPAYITIIATFVT
    VLQFLLKAYLPDLNKSLGIFIPLIVVN
    CIILGRAEAYASKNGIVSSLFDGLGMGLGFTLSLTVLGIIRELLGNGTVFGWR
    LMPQAYNPALIMILAPGAFFTLGILLAILNARKLKKAKNN

    >gi|28210728|ref|NP_781672.1| rnfA/nqrE [Clostridium tetani E88]
    MKIFTIFLSALLVNNFVLSRFLGICPFLGVSKKVETATGMGAAVTFVMALASIMTYLVEKFILVKFEITYLSTLAFILVI
    ASLVQFVEMVIKKVSPDLYKALGIFLPLITTN
    CAVLGVAVINSDEGYTLIESLVNSVGAALGFTLALVLLAGIREKLDTN
    EYIPEALKGLPITLVTAGLMAIAFLGFQGLI

    >gi|28210867|ref|NP_781811.1| transporter [Clostridium tetani E88]
    MSMNEIDELIKKRQGKTESKKSNQILYAIIVIIIAVITFLFIWKNNEKHAYSWILGVSIGIVLRYSRFCFAAAFRDPFLT
    GNTKILRGMLLGIIISTLGFAIIQSYYIKNNGINYNYIPGSIGSVGAHVALGAFIFGIGMILAGG
    CGSGVLMRIGEGHAL
    QWIVLLGFLIGTAMGAKDYSFWYQHIIRKAKTVYFPEYMNFKVAVVVQITILIILYKIVTKLSDKKR

    >gi|28210868|ref|NP_781812.1| membrane spanning protein [Clostridium tetani E88]
    MENIKKWIKKPWPYWVGGVLLGILNIILLWTTGTSWHITSGFLLWAVGVLQWLGLEPLKWEYFTYLQHNYQSIIENNNLF
    INKYTILNMGTVIGALIATLLASQFKWKKIKDKKQVLFALLGGVMMGYGTRLAFG
    CSVGSFFSGVPSFSLHAWVFGIFIT
    LGAWIGVKIIIKFLS

    >gi|28210870|ref|NP_781814.1| NADH oxidase [Clostridium tetani E88]
    MEGYAMSKKYLIVGGVAGGASTAARLRRLSEEDEIIMFERGPHVSFSNCCLPYHLAGLIKTANQLVLMSPEQFKKQYNIE
    ARVNSEVIDIDRAKKEITIKDTLTGKEYTENYDKLILSPGAKPIVPPIKGIEDINLFTVRNVIDIDKLNKFVSTMKTKNA
    TVVGGGFIGIEVAENLKEAGFNVTLVEAMPQVMKIFDYDMVQILHKELHDKGINLIVNDKVASFEKDTVVLESGKRVEAE
    AVVMAIGVTPETDLAVKAGLELGELGGIKVDQNYRTKDEDVYAVGDAIEVYHALTGKMTKLPLAGPAQKQAREVADHIHG
    RLVPNTGYIGSSVVKCFEYNGASTGLNEGMIKALNLDIQYETVKVIPGDKVGLMPGCEPLHFKLLFEIPTGKILGAQAIG
    RGNVDKRVDVIATAIKFGATINDLRDLEFCYAPPFGTAKDVVNFAGYVGSNLLHDEFKQVHEYDVRDLVESGACIIDVRE
    KHEYELSHIIGAKNIPLSEIRDRVAEIPKDQPVYLH
    CRSAQRSYNAAKALKHLGFDNIYNVSGGFMGISFYEYFNDQTTG
    REKIVTDYNFL

    >gi|28210871|ref|NP_781815.1| transporter [Clostridium tetani E88]
    MPLLYEIIMRIGSEQGIMSKKETSGLELAENTSKVELVSTDKKQTYIGLALLIALSIFGSFQYAKDSKLALFLITGLAVG
    YVMQRSRFGFAGGVKKIYVTGDGTLTKALMFLFAITLLITAAIHYGAFMAGAKIPGASSVKPTNLGTVIGGVLFGIGMMF
    GGG
    CASGTLTDSGEGEIRAFIVLFFFVTGSLIGVKHMPWWEQSIFFKLGGKVYLPDTFGYLGSIIVSLLGFLLIYVITMK
    YEAKRKRENTYTKEEYSDWEKPLPETTDYKFFSERTYHKFFIQRWSFYTGAVCLTIMFIAILVTTGKSWGVTSTFADWGA
    WLYQSVGIVDVSNWPWFASRMKKINGGFLNDPSSMRNIGILLGATLSLLLARRFSFKKNFKFRDVVFYAIGGLIMGYGAR
    VGLG
    CNAGALYSAICNFSLSGWVFLPAMTVGGIIGVNLVKKFNVTI

    >gi|28210873|ref|NP_781817.1| arsenate reductase [Clostridium tetani E88]
    MNYLFIQYPKCSTCRKAKKWLEDNNINFEDRHIVEDNPRKEELKQWIERSGFPIKKFFNTSGILYREMNLKDKIKTAEFE
    ELVDILSTNGMLIKRPFLIADGFVLLGFKEEEWKEKLL

    >gi|28211090|ref|NP_782034.1| methylated-DNA--protein-cysteine methyltransferase [Clostridium tetani E88]
    MNSIYSYQTEIGKIYIVENGIAITHLYFNECPILDNFKKKETELIKKAYNQLKEYFLGKRKEFDLPLLPKGTDFQQKVWK
    ALREIPFGETKSYGEIAKNIGNPKAARAVGMANNKNPISIFIP
    CHRVIGSNGKLVGYGGGLKIKEYLLKIEKNINS

    >gi|28211155|ref|NP_782099.1| hypothetical protein CTC01479 [Clostridium tetani E88]
    MKKRMKKIILLAVFVITIISLVGCSSDKKDNTSQNSKSIQSTSNAKVFPKFQGEDFEGNTVDEKVFSKHPVTVVNLWFAG
    CKACVDEMPDLEKMSAEFQKKNVKMLGIDIDSTDDKEEVKKLLKAKGVTYQNLMLKSDKEIDEFLSKISAFPTTFLINSK
    GEIVGEAIEGVINSPKRIEEINRKIDEIIGQDK

    >gi|28211667|ref|NP_782611.1| dihydrolipoamide dehydrogenase [Clostridium tetani E88]
    MNFKKTIAILIIRIAMVFKICKKRGVYMIKEIKLEKLFPGSKEGKVGKIHKSIGDGIKSGEVLVEVEGKKGNIPIKAKEE
    GKIHSIEIEEGTTVKIGDVLLKIEIEEVTLDEFVIDKDEFAKKSELKSLECDVAILGAGPGGYVAAIQAAKLGAKVVIVE
    KDKVGGT
    CLNRGCIPTKAFVRSSEVYSNVKNSEKYGISLENPSIDIKKVVARKDNIVDKLVGGIQYLIQKHNIELISGNG
    KLIDRNTIETKDALIKAKNIVIASGSKASVLPIKGSNLKQVITSEEALDLKEVPEKIAIIGGGVIGMEFAFIYANMGVEV
    SVIEYFDNILSMLDEDVIKEITDIGKEKGIKFYTSSKVEEILEDENEGCIVKFTNKGEEKFIFCDKVLMSVGRQPYMENM
    GVEELGIELNQNKRGIKVNTKMETSVSNIYAIGDVTNVIQLAHVASHQGIVAVKNIMGKDIQIDYSAVPSVIFTEPEIAV
    VGVCEKIAKENNLDVEVGKFPFSANGKALTLGEDRGFIKVIKEKATGKVVGASIIGAHASDLIAELTLAVKNGLTSEQIA
    ETIHAHPTTAEVVHEASLAVEGGALHFAE

    >gi|28212131|ref|NP_783075.1| thioredoxin reductase [Clostridium tetani E88]
    MTIRYDIAVIGSGPAGLSAAINAKIRNKNIIVFGNKDLSNKVAKAPLVNNYLGLPNIKGKDLKETFQNHIDKMGIQITYE
    RVNAVYAMGEYFSLMVNDKMYESTSLIMATGIEYTKPLKGEEEFLGRGVGY
    CATCDAPLYKNKNVIIIGHNKEAEDEANF
    VSELTSKTYYVPMYKGNYSLNNNIEVIKDRPLEVKGQDRVEKLVFKNGELNTDGIFVLKDSISPGQLVPGLEIEDGHIKV
    DRNMKTNIEGCFAAGDCIGKPYQYIKAAGEGQVAALNAVSYLDSIKNK

    >gi|28212132|ref|NP_783076.1| thioredoxin [Clostridium tetani E88]
    MIKEINDSVFNSEVLNSDKVTVVDFWAPWCGPCRMLGPVIEELSQEMSEQVKFVKVNVDENPMSATEYKVASIPTVAVFK
    DGKIQETLVGFRPKQAMQSSIEKHI