Agrobacterium radiobacter K84 uid58269

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|222081250|ref|YP_002540613.1| glutathione S-transferase protein [Agrobacterium radiobacter K84]
    MTEQNLTLVSHPLCPFVQRAAIVLLEKGVAFDRVNVDLSAKPDWFLALSPTGKVPVLKVRQPNGEEAILFESVVICEYLN
    EKQGGAAMYPDDALLRARHRAWIEFATQTFAEGWQFLHAKDMATADAKRAAFRDRLSKIEAELGDGPYFAGANFGLVDAV
    YAPLFRYFGIIDPEVADPIFAGLPRVTAWRAALAERSSVKNAVIDTYPDLFRDHLRQQGAMIAA

    >gi|222081364|ref|YP_002540727.1| hypothetical protein Arad_7679 [Agrobacterium radiobacter K84]
    MTDTVIHPEIENRPNVFTQAEIGWTPWLEPLVEGDLTERHWAGLVDASRSKSPYFMLLARDPEILQARTKTDKDIFYNVA
    AGLPRADRELAATAASRTNGCIF
    CASVHSRFASHHSKRTEDVQRLLDEGTETDLGSRWNALVSASSTLSETPAEFGTADI
    GKLRDEGLSDLEIADLIHASAFFNWANRLMLSLGEPTPAK

    >gi|222081577|ref|YP_002540941.1| hypothetical protein Arad_7958 [Agrobacterium radiobacter K84]
    MSEVVHTFTTTIPRWQPYVVPVDFATATEEQHAAMQMTPSNKGISPYVLTLAHDPETLAVRSPLFNLIMYGKDGLAGSER
    ELGAVAASVVNRCVY
    CAAVHASRFNNLTKRTDVIEAVFADGLAATLDEHLQAIFDFSARLSTTPPEATVADAQALADVGL
    DELEALDLVLSSAIFGWANRLMHTLGEPMQD

    >gi|222081723|ref|YP_002541088.1| redox protein, regulator of disulfide bond formation [Agrobacterium radiobacter K84]
    MTTLNEYLGKKREALLDRRARVKSGELSAVTLKASASAEGRSGVRRIRIRDFQVISDSPPDFAGYNLGPSSPELLLGALS
    S
    CLTHTYLIHASDQGVPLESLHAEVSATIDPRAGAEGHENIPVYPQDISYLVTLVSPASSEDVAKLYATVEKLCPILNLL
    KRGNEVRGRLDHQQPEHRTTNAA

    >gi|222081804|ref|YP_002541169.1| glutaredoxin protein [Agrobacterium radiobacter K84]
    MSGRYRVPFKDTRTTMSITVYSKPACVQCTATTRALDRHGIDYRIIDVSIDDAALELVQGLGYRQVPVVVAGEQHWAGFR
    PDMISALA

    >gi|222081954|ref|YP_002541319.1| ferredoxin reductase protein [Agrobacterium radiobacter K84]
    MLDDALKSQLKAYLEKVVRPIEILANVDDSAKSKEMVALLEDIAGLSDKITFAQQRDASERAPSFALTSPGHDISLRFAG
    IPLGHEFTSLVLALLQTGGHPPRVEQAILDQIRDLDGQFRFETYFSLS
    CQNCPDVVQALNLMSILNPKISHVAVDGAVFP
    QEVADRQVMSVPTVYLNGEVFGQGRMEVEQIIAKLDTGAAKRAAEKLADLEPFDVLVVGGGPAGAASAIYAARKGIRTGV
    VAERFGGQVLDTMAIENFISVPHTEGPAFASALEAHVKDYPVEIMNLQRAEKLTPRGDLFEVELASGATLKSRTLILSTG
    ARWRQMGVPGEEQYRNKGVAY
    CPHCDGPLFKGKDVAVIGGGNSGVEAAIDLAGIVKHVTLIEFDSKLRADDVLQRKLRSL
    SNVRIILSAKSTEVLGDDSKVTGLVYEDRNKDEKHTLTLDGIFVQIGLLPNTEWLKGTITLSPRGEIVVDHHGQTSLPGV
    FAAGDCTTVPYKQIVIAVGEGAKASLAAFDHLIRTSAPSEEEAKAA

    >gi|222081955|ref|YP_002541320.1| anti-oxidant protein [Agrobacterium radiobacter K84]
    MSVLNTAVKPFKAQAFKQGKFIEVTEADIAGKWAVFFFYPADFTFVCPTELGDVADNYAELQRLGVEVYSVSTDTHFTHK
    AWHDSSETIGKIQYAMIGDPTGTVTRNFDVMREAEGLADRGTFVVDPDGVVQAVEITAEGIGRNAADLLRRIKAAQYVRS
    HPGEVCPAKWEEGEKTLAPSLHLVGKI

    >gi|222082022|ref|YP_002541387.1| organic hydroperoxide resistance (osmotically inducible) protein [Agrobacterium radiobacter K84]
    MSTLYSTKVTAIGGRSGTVHSEDGVLDLPLALPTTMGGKGGATNPEQLFAAGYAACFETAAIHVTHNKATRVKDPDIVVV
    AEVGLRPNGSGGFVLSVALDVAIAGLDQATAEEIVQAAHAT
    CPYSNAVKGNIDVAITVTTS

    >gi|222082107|ref|YP_002541472.1| glutathione peroxidase protein [Agrobacterium radiobacter K84]
    MVVNVASKCGLTVQYESLEKLYEDKRDDGLVIAGFPANDFKGQEPGTDDEILSFCTLTYDVQFPMFSKIVVTGAERHPLY
    NSLIGSGVEITGDGPMRERLAKHGLETGQNGGVIWNFEKFLIGRDGKVAARFAPDVTADDPRLLSALEKELARAG

    >gi|222082269|ref|YP_002541634.1| anti-oxidant protein [Agrobacterium radiobacter K84]
    MSLRINDIAPDFTADTSQGPIQFHDWIGSGWAVLFSHPKNFTPVCTTELGAMAGLEQEFARRGVKVIGISVDPVESHAKW
    KGDIKTATGFNVEYPLIGDKDLKVAKLYDMLPAGAGESSEGRTPADNATVRSVFVIGADKKIKLILTYPMTTGRNFNEIL
    RAIDSIQLTAKHQVATPANWQQGEDVIITAAVSNEDAISRFGSFDTVLPYLRKTKQPAL

    >gi|222082825|ref|YP_002542190.1| ferredoxin reductase protein [Agrobacterium radiobacter K84]
    MPHFVIVGAGECGARAAFALREKGFEGDITLIGAEPVAPYERPPLSKEGLAHAAEPKFVATLERYTEQRIDLRLGIDVIN
    IDPTAKAITLAGEEKLGYDKLLLATGASARAFPGVARTGERIRVLRTHTDA
    CALRAALHPGQHIAIIGGGFIGLELAATA
    RKLGAEVTVIEGLPRVLKRGVPEEIAEVITERHRREDVVIRCGETIVAVEEGADSAVIRLGSGEIISADLVLIGIGALPN
    VALAEKAGLAIDNGIAVNEWLETSEADIFAAGDCCSFPLALYGGRRVRLESWRNAQEQGTLAAGNMLGEGNSISAVPWFW
    SDQYDLTLQIGGLADGATRMLRRDLSDGAFILFHLDDTGRLLAASGIGHGNAVARDIRLAEMLIAARAHPDPEALTASHV
    KLKSLLAA

    >gi|222083089|ref|YP_002542454.1| thioredoxin reductase (NADPH) protein [Agrobacterium radiobacter K84]
    MPVAIEETIIIGAGPAGLACASALRAKGCPSVVLEATDKLAASWRRHYDRLHLHTDKRCSALPGRPMPAGFPKYPSRLQI
    IDYLEDYARANDLQVIAGKTVGSVRKKASWVVETADGDVFEPRTVIIATGLSNSPVRPRWTGQDTFEGDIIHS
    CEYRNVF
    DLKARRILVVGFGNSAGEIALECAEAGLEVAMSVRGPVNIVPREMFGVPTATIAIAQQHLPYRLVDAFNAPLLYLRYRDI
    ETMGLTRSKHGPLTTMIERGRTPLIDIGTIAKMRDGRIKVFPGIEMLDGSNVLFTNGQSAEFDAIVQATGYKPSLDTLLP
    DLAERLPDAGKPARNELHPAKDGLYFCGFNAATTGLLRQISIEARLIASSIAKTRSASI

    >gi|222084226|ref|YP_002542752.1| thioredoxin [Agrobacterium radiobacter K84]
    MATVKVDNANFASEVLQSAEPVIVDFWAEWCGPCKMIAPSLEELSEQFEGKVKVAKLNIDENPELAAQFGVRSIPTLAMF
    KAGEVADIKVGAAPKSALESWIKGAAAA

    >gi|222084290|ref|YP_002542819.1| methylated-DNA-(protein)-cysteine S-methyltransferase protein [Agrobacterium radiobacter K84]
    MAKTVHDARQEHVFKLMTSPVGELKLVASHKGLAAILWDNDRPGRVPLTIVAEDEDHPVLVETERQLRQYFGGERRVFDL
    LVDFSGTAFQKKVWQALLTIPFGETRSYTQIAGQIGAPKAIRAVGAANGRNPISIIAP
    CHRVIGAAGDLRGFAGGLERKT
    YLLGFEGSETKAFDFAA

    >gi|222084352|ref|YP_002542881.1| molybdopterin biosynthesis protein [Agrobacterium radiobacter K84]
    MDPLTPDEIARYQRHILLPEVGGAGQQKLKAARVLVIGAGGLGAPVLQYLAAAGVGTIGIADDDRVSLSNLQRQVIHDTG
    TIGELKTQSAADAIARLNPHVRTIRFEERFSTETAARHLAGFNLVVDGSDNFDTRYAAADAAELARLPLVTGAVGRFDGS
    VTTLKPYEDGADGALNPGYRDLFPTPPPEGLIPA
    CAETGIIGALTGVIGTLMAMEAIKLITGTGEPLIGRLLLYDGLAAR
    FDTIRYRRKRARAAAE

    >gi|222084515|ref|YP_002543044.1| hypothetical protein Arad_0422 [Agrobacterium radiobacter K84]
    MSDKPRITILYCTQCNWLLRSGWMAQELLQTFTDSLGEVALLPGTGGVFEIRIDGELLWERKRDGGFPGPKELKQRVRDV
    IDPDRDLGHTDRASLES

    >gi|222084553|ref|YP_002543082.1| arsenate reductase protein [Agrobacterium radiobacter K84]
    MTITIYGIKNCDTMKKARTWLESHGIAYDFHDYKAAGIDRDHLERWTAEAGWEIVLNRAGTTFRALPEADRADLTKDKAI
    ALMLAQPSMIKRPVLEADGKLLIGFKPEIYASTLKSQ

    >gi|222084562|ref|YP_002543091.1| methylated-DNA-(protein)-cysteine S-methyltransferase protein [Agrobacterium radiobacter K84]
    MSDAQQYYLIFETAGGFCGIAWNDIGVTRFQLPTKDASSTERLLLRRLSDARLGTPTLDVANAIAAVKRYFAGEQIDFSG
    VKLDLGEQDAFFKQIYAAAREIGWGHTTTYGALAKQLGAGPEAARDVGQAMARNPVALIIP
    CHRVLAAGGKIGGFSAPGG
    STAKARMLELEGVQLAPPKPVQQSLGF

    >gi|222084577|ref|YP_002543106.1| thioredoxin reductase protein [Agrobacterium radiobacter K84]
    MDDVIIIGGSFAGLAAALQLGRARRKVTVLDTGLPRNRFAGHSHGLLGHDHKPPLDILAEARQQLARYPTIRLVNARADS
    ISGAIDNFSVLTGDGESLGARRLILSYGVVDQMPNVPGFAESWGTSIVP
    CPYCDGFEVAGQHWGLVWSGPQSMNQVRLFH
    DWTDRLTVFADGHDIPPDIRADLARRNVPVVDGRITGIAQRGAQNATVKLDTGPDVAVDILFAHPRNKPSASLHESLGLA
    TVKTPLGIILKVDERRETSMPGIYAAGDLANPITPPSVTLASSHGAMAGIFAQQSMLV

    >gi|222084618|ref|YP_002543147.1| thioredoxin reductase protein [Agrobacterium radiobacter K84]
    MYFDVIIIGGSYAGMSAGLQLARARRDILVVDADERRNRFAKSSHGFLGQDGRDPGLIAADAREQLQRYPTVHWLNAKAQ
    SAKRIEAGFSVTVGAGELLKGKRLILATGVVDRLPAIPGLQERWGKSVFH
    CPYCHGYELDQGRIGVIASSELSMHHALML
    PDWGTTTLFTNGAFVPDADQSSQLRARSVTIETAPVREIRGDRADVVLEDGRIIAMDGLFTLTQTSVPAPWAEQLGCAFE
    DGPVGRFISTDAMKQTTAKGVFACGDAARAAGSVALSVGDGALAGTAAHRSLMFDND

    >gi|222084807|ref|YP_002543336.1| hypothetical protein Arad_0800 [Agrobacterium radiobacter K84]
    MQARFNFAKASPEAYKAVAALENYVQISGLERRFIHLIKLRASQINGCAYCVDMHVKESRHDGLSEQWINLMCVWRESPV
    YDARERALLGWVDAVTKIAETGAPDADFEVLKQHFSEEEIVKITVAIGTINVWNRLAVGFRSQHPIDAASKAA

    >gi|222085139|ref|YP_002543669.1| peroxiredoxin protein [Agrobacterium radiobacter K84]
    MTIAIGDKLPAATFKEKTADGPVEITTEQLFAGKRVVLFAVPGAFTPTCSLNHLPGYLENRDAILAKGVDDIAVISVNDW
    HVMGAWAQSSGGLGKIHFLADWDGSFAKAVGLDVDLSAGGLGVRSKRYSMLVENGVVKTLNIEESPGQATVSAAAAMIEQ
    L

    >gi|222085162|ref|YP_002543692.1| thiol-disulfide oxidoreductase protein [Agrobacterium radiobacter K84]
    MPMSDMLLTKRHLLGGSAVAALSVAFAAFADTASAANATTAGGAQETTSTASTPEDEIPTADGSVDMNEVLKPGSLPEIA
    LGKEDAPVKIVEYMSLT
    CPHCAHFAVTTFDAIKQKYIDTGKVRFIIREFPFDPRAAAAFMLARCAPQEQYMPMVEMLFKQ
    QIAWASPDVDGRAALLQMSKLAGFTEDSFTKCLTNQKLLDDVNSVRERAAKDFGVNATPTFLINGKRYAGDMSVGAMSKL
    IDSLL

    >gi|222085188|ref|YP_002543718.1| peptide methionine sulfoxide reductase protein [Agrobacterium radiobacter K84]
    MRNYSKTSEAIAKLSPEQYRVTQQSGTERPFTGELLDNKQPGIYVDIVSGEPLFASSDKFDSGCGWPSFTKPIETANVNE
    LTDLSHGMLRTEVRSLHGDSHLGHVFPDGPRDRGGLRY
    CINSASLRFVHRDRMEAEGYGAYLDQVEDIR

    >gi|222085189|ref|YP_002543719.1| peptide methionine sulfoxide reductase protein [Agrobacterium radiobacter K84]
    MTTERAVLAGGCFWGMQDLIRRYNGVISTRVGYTGGEVRNATYRNHGTHAEAIEIVFDPEKISYRDLLEFFFQIHDPSTR
    NRQGNDVGTSYRSAIFYTSDEQKRVAFDTIADVDASGLWPGKVVTEVVPASDFWEAEPEHQDYLERIPNGYTCHFVRPGW
    KLPVRQADTTQRAAS

    >gi|222085238|ref|YP_002543768.1| organic hydroperoxide resistance (osmotically inducible) protein [Agrobacterium radiobacter K84]
    MPILYTTKASATGGRAGHAVSDNGVLDVTLTVPKELGGDGATGTNPEQLFAAGYSACFLGALKFVAGQQKVKIPEDAKVT
    ATVGVGPREDGGGFGIEVALSVHIPGLDKAEAEKLVAAAHIV
    CPYSHALRTSTEVPVTVA

    >gi|222085375|ref|YP_002543905.1| arsenate reductase [Agrobacterium radiobacter K84]
    MDVIIYHHPDCGTSRNTVALIRNAGIEPHVIEYLKTTPSRAMLIQLIARMGIATRELLREKGTPYAELGLGDPSLTDDQL
    LDAMMQHPILINRPIVVSPKGVKLCRPSEEVLDLLPPQLGEFFKEDGERIVDEHGRRVAST

    >gi|222085642|ref|YP_002544172.1| outer membrane protein [Agrobacterium radiobacter K84]
    MTLFSKTLLTVSAVAIAASLAFVQPAAALDDQQKKEFGEFIKEYLVEHPEVLLDAQAALEKKQEAARLAQSSQAVTQNKD
    AIFNSKNDVSIGNPKGDITVVEFFDYN
    CTYCRHALGDMDTLLKQDTNVRFVLKEFPILGPDSVAASRVSDAFRKLAPEKY
    AAFHRALLGSDGRASEDSAIEVAGSLGVNEAAIRAEMAKSPNTDSVKATYQLATDLNVTGTPAYVIGNETISGAIGLEAI
    QQKIANVRSCGKTTC

    >gi|222085726|ref|YP_002544256.1| heavy metal-transporting ATPase protein [Agrobacterium radiobacter K84]
    MTRKRIMAAATQTRYRVGGMDCASCAAKIDTAVRRMPGVEDVSVSVTAGTMTVRHDETSNLVAIEKKVAGLGYSVAPLAG
    KAAPSPTEHQHDDHGHQCKGDHDHSHDHSGHDHSAHDHASHDHHTDQKHAEKEIEGLHGHDHAPTNGPWWASKKGRLTIL
    SGGALVAAYAIGHLVPSIAPYAFIVAMLVGLVPIARRAVMAALAGTPFSIEMLMTIAAIGAVIINAGEEAATVVFLFLVG
    ELLEGVAASKARASIQSLTTLVPKTALVEEDGQTHEVQADSLKVGTIILIRPGDRIAADGVIVEGESAIDEAPVTGESTP
    VRKGIDAKVFAGTINTDAVLRVKVTAAAADNTIARVVKLVEEAQESKAPTERFIDRFSRYYTPAVVAVAALVAVTPPLVA
    GASWMEWVYKGLAILLIGCPCALVISTPAAIAAALSAGARNGLLLKGGAVLETMGKVTTVAFDKTGTLTEGKPKVTDVAG
    FGHTEAQVLSRAAALESGSSHPLALAILERAKADRLPVPPAAEAKALPGKGVSGRVGGEAILLLSPQAAREIEVFSTEQD
    AQIVALNDEGKSVSVLVVESRIAGLIAMRDEPRTDARAGIEALRAAGIGAVMLTGDNARTAAAIAKGLGIEPRAQLLPED
    KQRIVRELQAQKQIVAKVGDGINDAPALAAADVGIAMGGGTDVALETADAAALHGRVTDVANMVVLSRTTMSNIHQNITM
    ALGLKAVFLVTTVVGITGLWPAILADTGATVLVTANAMRLLGWKGARS

    >gi|222085742|ref|YP_002544272.1| redox protein [Agrobacterium radiobacter K84]
    MSDKKHSYHVNVVWTGNDGTGTSSYRSYRRDHEIRAEGKPTIPGSSDPSFRGDPTRWNPEDLLVASLSACHKLWYLGLCA
    QAGVIVLSYEDAAEGTMLEESGGAGQFTSVVLRPRIVIDATSDARTALELHHKAHEM
    CFIARSVNFPVTNEPQISTSA

    >gi|222085754|ref|YP_002544284.1| thiosulfate sulfurtransferase protein [Agrobacterium radiobacter K84]
    MTAEKSRFVVSADWLQNELGAKDLRILDASFYLPAQKRDADAEYASGHIPGAIRFNQDKIADHSTGLPHTVPSPEFFAAE
    VGKLGISENDRIVVYDGPGLFASPRVWWLFRAVMGAKNVFVLDGGLDGWKAEGRPLETALPAFAPVTFQPNFNAARVVSF
    DEMRGIVDSGSLQIADARSAGRFAAAEPEPREGMRSGHMPGAKNLPSGVFAVNGKFKSLPELRETIEKAGIDLEKPVVTT
    CGSGITAAIITLALESLGHDANRLYDGSWSEWGSRPDTPIVTGKD

    >gi|222085880|ref|YP_002544411.1| dihydrolipoamide dehydrogenase [Agrobacterium radiobacter K84]
    MAENYDVIIIGSGPGGYVAAVRAGQLGLKTAIVEREHLGGICLNWGCIPTKALLRSAEILDHSNHLKDYGLVLEGKVSAD
    VKAVVARSRGVSARLNQGIGYLMKKNKVDVIWGEAKITKPGEIVVGKSTKPVVEPQHPLPKNVKGEGTYTAKHIIVATGA
    RPRALPGIEPDGKLIWTYFEALKPDVLPKSLLVMGSGAIGIEFASFYRSMGVDVTVVEVMPTIMPVEDAEISGIARKQLE
    KRGLKIFTKAKVTKVEKGANNITAHVETEDGKVQQIVADRMISAVGVQGNIENLGLEALGVKTDRGCVVIDGYGKTNVAG
    IYAIGDVAGPPMLAHKAEHEGVVCIEKIAGLPNVHPTDKSKVPGCTYCNPQVASVGLTEAKAKEQGRDIRVGRFSFVANG
    KAIALGEDQGMVKVIFDKKTGELLGAHMVGAEVTELIQGFVVAMNLETTEEELMHTIFPHPTVSESMKEAVLDAYGRVLN
    A

    >gi|222085975|ref|YP_002544507.1| dithiol-disulfide isomerase protein [Agrobacterium radiobacter K84]
    MERITIDIVSDVVCPWCYLGKARLELAIAEVQDEMGVDLNWRPYRLNPEYPPEGVDQKKALAQKLGGEERVAQAHKMLSD
    LGRDVGIKFDFDAIKIGPNTLDAHRLIHWAGTENREKQEKVVNALFKANFEEGRNVGDHAVLLDIAEGAGLDRSVIAALL
    SSDADRDLIIGEIEAAQKIGVTGVPFFIFDQQYAVSGAQTPDVLVEALRDIAKMKAEARAGMN

    >gi|222086035|ref|YP_002544567.1| rhodanese domain sulfurtransferase [Agrobacterium radiobacter K84]
    MSSRVSEIPTASPSAIAEYYSQKLAFETDCSDVQLSMTSGNADFVLLDVRGPSLFEQQHIPDAINLPHGKMTVRRMAEWP
    DDTLFVVY
    CAGPHCNGTDKAAWRLGTLGKRVKVMIGGMTGWADEGFIFERG

    >gi|222086098|ref|YP_002544630.1| FeS assembly scaffold SufA [Agrobacterium radiobacter K84]
    MGFAVITMTETAAARVKAIVENSGPDAKGVRVGIKKGGCAGMEYTIDLVIEPNAKDDLIEYNGAKVWVEPSAVLYLLGTQ
    MGFETTTLRSGFTFTNPNQTSACGCGESVELKPADLAALAAQRQAAPAA

    >gi|222086112|ref|YP_002544644.1| bacterioferritin comigratory protein [Agrobacterium radiobacter K84]
    MTKIPAVELAIGDKAPDFDLPRDGSGRISLADFAGKPLVIFFYPKDNTSACTAESIAFTALAADFKKAGASIVGMSPDSV
    KSHDKFVKKYDLSVPLAADEEKTAAEAYGVWREKSMYGRSYMGVVRSTFLIAADGRIARIWDKVKVAGHAEEVLAAVKEL


    >gi|222086143|ref|YP_002544675.1| glutaredoxin protein [Agrobacterium radiobacter K84]
    MSGINEFIENEVKTNDVVLFMKGTPQFPQCGFSGQVVQILDYIGVDYKSVNVLADAEIRQGIKDYSNWPTIPQLYVKGEF
    IGGCDIVREMFQAGELQQHLQEHGISVRGAA

    >gi|222086213|ref|YP_002544745.1| glutathione-disulfide reductase [Agrobacterium radiobacter K84]
    MSSFDFDLFVIGGGSGGVRSARVAASLGKKVGIAEEYRYGGTCVIRGCVPKKLFVYASQYSEHFEDAAGFGWTVGESSFD
    WKKLIGAKDKEIERLEGLYRKGLDNAKAEIFDTRAELVDAHTIRLLKTGKTVTAETIVVATGGTPNLHTALPGHEF
    CISS
    NEAFHLDELPKSILIAGGGYIAVEFANIFHGLGVETTLIYRGAEILSRFDQDLRKGLHEAMEAKGIRILCHDIIESVTKT
    EAGLSVRTKNDKALTVDTVMLALGRTPNTRDLGLEAAGVATNEQGAIVVDEYSRTSVPNIYALGDVTDRVQLTPVAIHEA
    MCFIETVYKNNPTRPDHELIATAVFSQPEIGTVGLTEEDAAKRYPEIEVYRAQFRPMKATLSGGSEKMIMKLIVNAADRK
    VIGAHILGHDAGEMAQLLGIPLKAGCTKEDFDRTMAVHPTAAEELVTMYSPSYRIRNGERV

    >gi|222086561|ref|YP_002545095.1| thioredoxin-disulfide reductase [Agrobacterium radiobacter K84]
    MPARHTKVLIIGSGPAGYTAAVYAARAMLEPVLIAGMEQGGQLMITTDVENYPGFADPIQGPWLMEQMLQQAKHVGAEIV
    NDLVTEVDTNQRPFVARTDSGQVWTADTLIIATGAKAKWLGIETEQHFQGFGVSA
    CATCDGFFYRNKDVIVVGGGNSAVE
    EALYLSNITKSVTVVHRRDSFRAEKILQERLFAKPNVKILWNTEVAEITGTPAKPPMPPSVSGARLRDTRTGVITDVTID
    GIFVAIGHAPATELFKGKLKLKDNGYLWTAPDSTATSVEGIYAAGDVTDDTFRQAITAAGMGCMAALEAERYLTGHMPVA
    VAAE

    >gi|222086907|ref|YP_002545441.1| carboxymuconolactone decarboxylase protein [Agrobacterium radiobacter K84]
    MLNDAEAEAIPAVKAVFDDIRTVRKSDFINNFWRGLANDPTLLKRTWKGLKAVMMAEGALDPLVREMIYIAVSTANGCTY
    CVHSHTAAARAKGMTDAQHGELLAVIGLAGQTNHLVTAMQIPVDPEFDVSRG

    >gi|222087210|ref|YP_002545745.1| 6-O-methylguanine-DNA methyltransferase protein [Agrobacterium radiobacter K84]
    MNAIAQLKKDITPEGPDYDTVRRVIELITEDYRDQPSLEAIADRLGQSPTQLQKTFTRWAGLSPKAFLQAVTLDHAKRLL
    RQEDLPLLETSFEVGLSGPSRLHDLFVTHEAMSPGEWKAKGGGLTIRYGFHISPFGLALIMVTDRGLAGLAFSDTGDEKA
    CLEDMTCRWPNAQYVEDLQATMPYAARIFEPSKWTSDQPLRVVLIGTDFQVRVWESLLKIPMGRAVTYSDIARDIGQPTA
    MRAVGAAVGRNPLSFVVP
    CHRALGKNGDLTGYHWGLTRKRAMLGWEAGQA

    >gi|222087250|ref|YP_002545785.1| osmotically inducible protein [Agrobacterium radiobacter K84]
    MQINRTGSAQWSGGLKDGKGQISTQSGALNHYPYGFASRFEGVAGTNPEELIGAAHAGCFTMALSLILNEAGFTAETMET
    TAKVTLESVEGGFAISAIHLTLTGKVPGADEAKFTELANKAKAG
    CPVSKALASVPISLEVRLA

    >gi|222087257|ref|YP_002545792.1| peptide methionine sulfoxide reductase protein [Agrobacterium radiobacter K84]
    MKDTIRKALSHVARPAAFAVGAVLLAGVALQFVGHASAEDARVIPAPAVDEKPGSGSTETTVLAGGCFWGVQGVFQHVNG
    VISATSGYAGGKKDTAQYETVSGGDTGHAESVRIVFDPHKVSYGHLLQIYFSVAHDPTELNYQGPDSGTQYRSAIFPTTA
    EQADVGKAYIGQLNHAKVFDAAIVTKIEPERQFYAAEGYHQNFLTMNPNYPYIVVNDLPKVKNLQRLFPGDYRSDPVLVA
    ANASEN

    >gi|222087310|ref|YP_002545847.1| glutaredoxin 3 [Agrobacterium radiobacter K84]
    MASVVIYTREFCGYCARAKSLLEAKGVDYVEHNATYSPELRQEMIEKAKGHSTFPQIFINGEHVGGCDDIHALDRAGKLD
    PLLAA

    >gi|222087335|ref|YP_002545872.1| hypothetical protein Arad_4180 [Agrobacterium radiobacter K84]
    MSQTLTSSRAGLGYSALLAIGMIIVVGSALGFQHIGGYIPCALCLEQRQPYYYGIPVAIVAALTAILRLPSWITRTLLAI
    AGLMMVVGGGIGVYHAGVEWHFWAGPTT
    CSTSASSMTQNAGDLLNELSTIKGPSCTEAALRVLGISMAGWNVVASVILAV
    IAFVGVKKAA

    >gi|222087346|ref|YP_002545883.1| thiol:disulfide interchange protein [Agrobacterium radiobacter K84]
    MTAKKPFGLPSVKLVLLAAVAGVVAGAAAVYVKEAGYGNGIGETASSGQCETAKDRAAALTPFTKGQVAAMAAPQTPISL
    HDVSFKGADGQPLSIANFSGKTLLLNVWATW
    CVPCREEMPALNALEKSMGNDKFEVVAVNIDTGDDEKPKAFRTDYGIDK
    LGYYRDSTMGVFNALKKQGLAFGLPVTLLIDGKGCLVSAMNGPAAWDSDDAKNLIKAAVGI

    >gi|222087451|ref|YP_002545988.1| dihydrolipoamide dehydrogenase [Agrobacterium radiobacter K84]
    MSYDVIIIGTGPGGYVCAVKAAQLGLKVAVIEKRATYGGTCLNVGCIPSKALLHASEVFHHAGHGMDALGVEVSAPTLNL
    PKMMAHKDATVKSNVDGVAFLFKKNKIDTFQGTGKIVSAGKVSVTAEDGKVTEIEAKNIVIATGSDVAGIPGVPLEIDEK
    VIISSTGGIALDKVPENLVVVGGGVIGLELGSVWSRLGSKVTVVEYLDNILGGMDGEVSKQFQRMLAKQGITFHLGAKVV
    AVEKSGKGAKVTFEPVKGGDKVVLDADVVLVSTGRKPYTAGLGLEEAGVALDNRGRVEIDGHFKTNVPGIYAIGDVVKGP
    MLAHKAEDEGVALAEILAGQAGHVNYDVIPSVVYTQPEVASVGKTEEELKAAGIAYKVGKFPFSANGRARAMLATDGFVK
    ILADKETDRVLGGHIVGFGAGEMIHEITVLMEFGGSSEDLGRTCHAHPTMSEAVKEAALATFFKPIHM

    >gi|222087515|ref|YP_002546052.1| thiol disulfide interchange protein [Agrobacterium radiobacter K84]
    MSIETEKSGEPKSGGTARYLMALIPLIVFACIALAVGKVMYDQEVHGTDISAIPSALIGTKAPALAMAPLDGSNLPPLTD
    AAIKGKLTLVNVFASW
    CIPCREEHPVLKQLAQDGRLNIVAINYKDTSENALRFLGELGNPYTAIGIDPNGSAAIDWGVYG
    IPESYLVAPDGTILYKQVGPFSATSLKEGLYPAMEKALGKPGA

    >gi|222087564|ref|YP_002546101.1| thioredoxin [Agrobacterium radiobacter K84]
    MSGSNNPYNASFGGQMSASASFGAAPAASGGASPIKDTTTANFAKDVIEESRNQPVLVDFWAPWCGPCKQLTPVLEKVIN
    EANGRVKLVKMNIDDHPSVAGQLGIQSIPAVIAFVDGRPADGFMGAVPESQVREFIDRLGGPAGGAGDPVAEIAAVLEEA
    TGLLAGGDINGAAELFGAVLQADPENAKALAGMAECMIAAGQSQRAREALTDLPETLANDAGIQAVVKKLDQIEEARKLG
    DPVALEQELAANPDNHEQRVKLAKIRNVEGKRDEAAEHLLTVMRRDRAFDDDGARRQLLEFFEVWGPKDPATIAARRKLS
    SILFS

    >gi|222108946|ref|YP_002551212.1| sulfurtransferase (incomplete) [Agrobacterium radiobacter K84]
    MSAPITKHSLRYDEVRQHLLARSEILLADVREEDPFAQGHPLWAANFPIARLELDAWRRIPQRDMLIVLYGHDGIRDLAP
    IAVEKLKSLGYTNVHILEGGLEAWKADGGELFIDVNVPSKSFGELVEAKRHTPLWDATKVKALLDEGANAVVFDARRFDE
    YQTMSIPKGINVPGGELVLRARDLAPDPETLVIVN
    CAGRTRSIIGTQSLINAGIPNKVVGLRNGTIGWTLAGQTLEQGAS
    RSFAEVEARDRSEAQKSAAAVAARAGVRSIALSDIGSLQTPDRTTYLIDVRTEPEYLEGHLPGFMHVPGGQLVQETDHYA
    PVRGARIVLSDDETTRANMAASWLAQMGWEVYVVEQAPSDAFSEQGSFKSISPEVEPTPTICVRDLSSAISNPNSDIVVL
    DFTTSANYLKGHIPGAWFALRSQLPEAIKRAPPAKTYVVTCSTSALAIYAAVDLKKLVDVPVLVLEGGNAAWKAAGQILE
    TDESHLASPRIDRYRRPYEGTDAPVEAMQAYLDWEYGLVALLDRDGTHFFNVI

    >gi|222109097|ref|YP_002551363.1| hypothetical protein Arad_14218 [Agrobacterium radiobacter K84]
    MSQATAPHSVTSSPVSTGQLEEPISRLRVPTEDELPQKLRDIHMRIRKKFGFVPNFLTALSANPGTALRIMAFYEHLFDQ
    SNSHLSASERELIAVVTSVATGCSY
    CVFNHRPALAAALGDRVLADRIARNHNDVTLAPRERALADLAQKLAATPHSVGSD
    DFARLRAIGFSEPAILEVLEVSAFFSYGNRLTIALNVLPDPQFFVSA

    >gi|222109099|ref|YP_002551365.1| hypothetical protein Arad_14221 [Agrobacterium radiobacter K84]
    MTSVYSVAPSISTENGMTTIDGLARSQRISRLRIPDESELPEDIQALVDRHHHENWVRALSLNPDTARRFTGHFEHLFAA
    TGRRLPLQDRELIAVVVSATNGCGV
    CEIHHTRAFGDLLNDPGFARRVALDYHLADLSKRQRALADLAVKVTLSPKTISQA
    DFEKLRDLELSDEELLEAVETASWFNHTNRVTISLGILPDDKFFS

    >gi|222086789|ref|YP_002545323.1| NADPH-dependent glutamate synthase small chain protein [Agrobacterium radiobacter K84]
    MGRLETGIHKGRLTPAEYEANFSDLHPRLNDHEALVAADRCYFCYDAPCMTACPTSIDIPLFIRQISTGNPIGSAKTIFD
    QNILGGMCARVCPTEQLCEQDCVRNTAEERPVEIGRLQRYATDIAMAENKQFYARAASSGKKIAVVGAGPAGLA
    CAHRLA
    VKGHEVVIFDAREKAGGLNEYGIATYKAVDDFAQKEVDYVLSIGGIEVKNGQALGRDFSLADLASQYDAVFLGLGLAGVN
    ALRAEGEDLDGVADAVAYIAGLRQANDKADIAIGRRVVVLGGGMTAIDAAVQAKLLGAEEVTICYRRGKEHMNASEYEQD
    LAASKGVMIRHWLAPKRILDKNGKVAGIEVEYTELRDGKLTGTGDLGVIAADQIFKAIGQTFEASGLGALRIEAGRIAID
    GEGRTSLDHVWAGGDCVLGGDDLTVSAVAQGRDAAESINHALAASAQPNAAVA

    >gi|222086894|ref|YP_002545428.1| membrane-anchored protein (osmotically inducible protein) [Agrobacterium radiobacter K84]
    MAELRVKTRQTGATATVGRTGFPHVTSVTGGEIDIVTSPSQPGFNPLDLLYSSLSACLVLSARMAASSLGVLDKLTEVTA
    VVTGEKATEGLSRVEKFNIAFTIKGDFGDEIRNAIAHAAEDEI
    CTVSNTIRGNPKFEMVISG