Clostridium sticklandii DSM 519 uid59585

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|310657486|ref|YP_003935207.1| NADH oxidase (noxase) [Clostridium sticklandii DSM 519]
    MNKIVIVGANHAGTAAANTIMGNYKDAKVTIFDANSNISFLGCGMALWIGEQIAGAEGLFYSNKEKLEAQGAVVHMEAPV
    ESIDFDKKIVYATLKDGSKVEESYDKIILATGSMPIIPDIPGRDLENVQKVKLYQHADEVIQKLKTEDIKDVVVVGAGYI
    GVELAEAFERNGKNVTLIDIADTCLPAYYDEEFTELMKQNLKDHGIKLAFGEKVLELKGDTKVKEVVTDKGTHKADMVVL
    SIGFRPNNELGKDKLELFRNGAYVVNKNQETSIKDVYAIGDCATVYDNSIQGTNYIALATNAVRSGIVAAHNAGGTALES
    AGVQGSNGICIYDLKMVSTGLTLAKAKSLGIDALATDYDDLQKPEFIESENPSVKIRIVYDKNTRVIIGAQMASTYDMSM
    GIHMFSLAIQEKVTIDKLALTDIFFLPHFNKPYNYITMAAISAK

    >gi|310657877|ref|YP_003935598.1| zinc, cobalt and lead efflux system [Clostridium sticklandii DSM 519]
    MIMMELTLYINGMMCANCSQKLEEKASKLAEIEEIHVNYASAKINVKFKKDSDKNTVFEKLNKLCTQIEPKAYLTDKEPM
    SLGLASSVPVNKKENDSCDCDGHNHSHDEDHSHGHSHSHGHADINVSHSLADHKKETLIIGITIAIYAFGIMYKGSDMIK
    LAIFIIAYIIIGKDVLLSAFKNILRGEVFDENFLMSIATLGAFAIGEYPEAVAVMLFYNVGELFQDMAVNRSRKSIKALM
    NIKPDYANLKVDNNFEIVKPEAVNIGDIILVKPGEKVPLDGTLLSESTQMDTSNLTGESVPRIVNKGDTVLSGFINKTHA
    IEMKVEKTFGESTVNKILELVENASAKKAPTEKFITKFSRYYTPAVVFFALALAIIPPFFTGFNFSEWLYRALIFLVVSC
    PCALVVSIPLGFFGGIGAASKHGILIKGGNYLEALKNAEIAVFDKTGTLTEGIFKVQEITPMHGMNDNELLELAAYAESH
    SSHPIGVSILKAYNTPIDYDRIQSYENLPGYGVRAVIDGKKVLAGNEKLMQEEKIDYINDKFGTIVHLSVDGIYAGSISI
    YDKIKEDSKLAMQKLKSVGIHSIAMLTGDNEKTALDIAEKIGIDNVKYDLLPDQKVAAFEELMKMASPKGKVIFTGDGIN
    DAPVLARADIGIAMGSLGSDAAIESADVVIMTDEPSKIAEAIKIAKFTNKVVWQNIYFSLGIKGLVLILGAFGMANMWEA
    VFADVGVAVIAVLNATRISKI

    >gi|310657880|ref|YP_003935601.1| fad-dependent pyridine nucleotide-disulphide oxidoreductase precursor [Clostridium sticklandii DSM 519]
    MKKILIVGGVAGGATTAARLRRLDEESQIVMFERGEYISFANCGLPYYIGEIIPQRDALLVQTVDGMSERFNMDIRNLSE
    VTAINREKKTVTVKNLKLGTTYEERYDVLVLSPGANPIKPPIKGLDEADNVFTLRNIPDTDAIKAHVDNKKPKSAVVIGG
    GFIGVEMAENLVHRGIKVTLVEMADQIMAPFDSEMVSILHKHVTDMGVELILSDGVSYFDQKGTKIGLNSGKVLDTELTI
    LSIGVRPENELAKSSGLELGERGHIKVDQNMMTSDPNIYAIGDAIETIDYIYNEPAMVPLAWPANKQGRIVADRICGIDS
    KYPGTLGTSIAKVFDLTAASTGHNEKALARLGKTNYKTIHIHPGSHAGYYPGAFPISLKLIFEVPSGKILGAQGIGYDGV
    DKRIDVIATAIKGNLTVRDITNLELAYAPPYSSAKDPVNMAGYVASNILDGLVDVVYYNEIDKLIADGGLLIDVREPMER
    EMGFIEGSINIPLHEIRERLDEIPKDKELYVS
    CQVGLRGYLAARILKQHGYNVKNLDGGYKTYSDVYGAPEAAGCAYVDD
    AGEMHIADHNIDSFTGSTSPDLTVDARGLQCPGPIAQVYAAVSTMENGQMLEVLATDPGFSKDISAWCKKTGNTLISSEF
    DKTHFRTLLRKGTDTPRVAPALGATNAPVVKEKNGATMVVFSGDLDKAMASFIIATGAASMGKEVTMFFTFWGLNVLRKP
    GVKVEKDALENMFSKMMPEGAKKLKLSNMNMGGMGSKMINYVMKKKNVDDVETLIANAQKMGVKLVACAMSMDIMGIKQE
    ELIDGVEIAGVASYLAETEDSGLNLFI

    >gi|310657992|ref|YP_003935713.1| pyridine nucleotide-disulfide oxidoreductase, class i [Clostridium sticklandii DSM 519]
    MKLIVIGGVAAGMSAASKLKRLDPQAQVVVYEKGSFLSYGACGLPYYVSGVNDDYKKMIIRTQEDFEKAGISTFTNHEVI
    KVDPQNKTIMVRDLISKSMFIDKYDKLMISTGAHPIVPNFKGKDLSGVFVLKTLEDGIKLREAASKSEMKNVVIVGGGYI
    GIELAEAMVELGKNVKVLEKSERILTSFDKEISEIAEKTLKNHSVELLLDEELEIIKGTETVTGIKTSKGDYDADMVILS
    IGVMPSTDFLKGSGIDLAKNGAVIIDREMRTSVSDIYSAGDCAEVYHMVKEENSYIPLGTTANKCGKIVGNNLSGQHQKF
    IGALGSAAIKIMDMEMARTGIGESEAKAMKLDYDTVFVKDYNHPPYYPNREALYIKLIYEKRTHRILGAQIAGKQGAVLR
    VDMFAIAIQAKMTAEDIGMADLCYAPPFSGVWDAVNIAANAVK

    >gi|310658060|ref|YP_003935781.1| hypothetical protein CLOST_0750 [Clostridium sticklandii DSM 519]
    MNSNNGYVFINSLEELESIKQNNVYILYFSSEDCNVCHSVFPKLLELNETAKLPIGRIDVNQNLEIAGQHLVFNIPTILI
    FNENSEVLRESRFIDFSKLERILNLLGDGED

    >gi|310658072|ref|YP_003935793.1| redox-active disulfide protein 2 [Clostridium sticklandii DSM 519]
    MVIKILGSGCANCKKLEQSAQQAVKELGLEATIEKVEDFQEIMAYGVMKTPALVVDEVVKSSGRVLSAEDVKKYL

    >gi|310658158|ref|YP_003935879.1| glutaredoxin [Clostridium sticklandii DSM 519]
    MKNVTIYTSSSCSYCHAAKDYFNENNIPYTEKNVSEDPEARKTLIQKKIMGVPAIFIEDEVVVGFDKERINELLEI

    >gi|310658172|ref|YP_003935893.1| hesb/yadr/yfhf family protein [Clostridium sticklandii DSM 519]
    MSITVDKKASDELKSILSEKNINTDTLRIFLSGMGCSGPMFNLAQDEAKDSDLKVEFEGLNFVVDKTLVSQYDGFEVLYV
    EQGDMGGVYVQALNVGESSGCSSCSGCN

    >gi|310658285|ref|YP_003936006.1| glutathione peroxidase [Clostridium sticklandii DSM 519]
    MNIYDFTAKDIDGNLVSLQDYKGKVLIVVNTASKCGFTPQYEDLQKLYDNYKDKGVEILGFPCNQFMDQEPGTNQETKSF
    CSLNYGVNFPLFEKTDVNGKFAHPLFKYLVSEAPFKGFDMSNPTNKMLDAMLKDKFPEFAVGDAVKWNFTKFIIDKEGNV
    VNRFEPATEPMDMVSTIENLL

    >gi|310658364|ref|YP_003936085.1| betaine reductase complex component b subunit beta (selenoprotein pb beta) [Clostridium sticklandii DSM 519]
    MKKGILYINQFFGQIGGEEMAGYEPEIREGLVGPALELNKQLGDEVEITHTIICGDNFMGSNQDEAIKRILEFIKDKEVD
    IFFAGPAFRAGRYGSACGNICKAVNKSFNIPVLTSMNDENPGVEMFKKELIIFKGGASAASMRADIKAMASYALKLLRNE
    EVFSAEEEGYFGRGIRRQVWTNPPIKATDRVIDMLLKKINNEEFKTELPIPPSEFVPIAPAISIDELKNMEVAIVTSGGI
    VPVGNPDRIQSASATKWGKYDVSELNDLLPGEYMTIHAGFDPAAANADPDVIVPLDALREYQNEGRIKGVYKYIYSTVGT
    GTTQAEASRMGREIADELLAAGVKAVILTST
    CGTCTRCGATMTKEIEKAGITIVQMANLVPVALTVGSNRIVPTISIPYP
    LGDPATTSKEQFKLRYHRVGVALDALSTDIKEQTVFKVKI

    >gi|310658389|ref|YP_003936110.1| peptide methionine sulfoxide reductase msra (protein-methionine-s-oxide reductase) (peptide-methionine (s)-s-oxide r
    MNESNIKEAVFAGGCFWCMETPFVLTPGVLKVKSGYTGGDKKFPTYEEVCTGSTGHYEAVKIWYDGTEVSYKNLLGVFIQ
    SMNPTDPYGQFADRGSQYLGAIFYASDEEKQLANKLLSELDKSNIFENQVAIKLLPQADFYEAEEYHQEYYKKNKLHYKA
    YRRGSGRAPFLEKIWTQDNINKLNEILSKLQ

    >gi|310658414|ref|YP_003936135.1| thioredoxin reductase [Clostridium sticklandii DSM 519]
    MSKIYDLVIIGAGPAGLSAGLYGARGKMSTLIIEKDKTGGQIVTTEEVANYPGSIHDASGPSLIARMAEQADEFGTERIK
    DSIVDFDFTGKIKILKGTKAEYQAKAVIVATGASPKKLDCPGEKELTGKGVSY
    CATCDADFFQDMEVFVVGGGDSAVEEA
    MYLTKFASKVTIVHRRDSLRAAKSIQDKAFANPKIDFKWDSVIKEIKGDGIVESVVFENTKTGELSEHFADEEFGTFGIF
    VFTGYIPQTDIFKDKVDMNQSGYFVTNQNMETNIPGVFAAGDCREKVLRQVVTATADGAIAAIMAEKYIEHEGL

    >gi|310658415|ref|YP_003936136.1| thioredoxin (trx) [Clostridium sticklandii DSM 519]
    MFELDKDTFETEVLQGTGYVLVDFWSEGCEPCKALMPDIQEMEKTYGEQVRFTKLDTTKARRLAIKEKVLGLPTIAIYKD
    GQKIDELTKEDATAANVEAMVKKYI

    >gi|310658417|ref|YP_003936138.1| glycine reductase component a selenoprotein [Clostridium sticklandii DSM 519]
    MSRFTGKKIVIIGDRDGIPGPAIEECLKPIDCEVIFSSTECFVCTAAGAMDLENQKRIKEATEKFGAENLVVLIGAAEAE
    AAGLAAETVTAGDPTFAGPLAGVELGLRVYHAVEPEFKDEVDAQIFDDQVGMMEMVLNVDEIIEEMQSIRSQFCKFND

    >gi|310658418|ref|YP_003936139.1| glycine reductase component b (47 kda, subunit gamma) [Clostridium sticklandii DSM 519]
    MGKVKVVHYLNQFFAGIGGEEKADTLPHIAESQPPISQQLQKLIEEDAEIVGVVVCGDSYFNENLEEAKAKVLEMIKSFN
    PDILIAGPAFNAGRYGMACGTVVKMVQDELNLKAFTAMYEENPGLDVFRKEVYVIPTSDSAAGMRKALPAVAKFATKLAK
    GEEILSPQEDGYFARGVRVNAFVDERGSMRAVKMLVKKLKGEEFETEYPMPVFDRVAPNPAVKDITKAKIALVTSGGIVP
    KHNPDHIESSSASKYGRYDISSFDKLSEADHETAHGGYDPTYANNEPDRVLPVDVLRDLEKEGKIGELFKYFYTTVGNGT
    SVANSKQFAQEFSKELLENKVDAVILTST
    CGTCTRCGATMVKEIERAGIPVVHMCTVVPISLTVGANRIIPTIAIPHPLG
    NPALDAAEEKQLRRKLVEKALKALETEVEDQTVFED

    >gi|310658470|ref|YP_003936191.1| dihydrolipoamide dehydrogenase [Clostridium sticklandii DSM 519]
    MKIVVVGAGPGGYVAAIKAALLGAEVTVIEKYKPGGTCLNWGCIPTKSLLAASERIDMVKEAEDFGVEIGSDIKVDFNKI
    MDRKNKIVTNLVKGIEHLFAQKKITVVKGHGKILSSTEVLVTDEDNNTQTIPADKIIIATGSAPIVPPMFPYDKTKVITS
    DEAMNLTEIPKSMIIVGGGVIGCEFGQFYRKLGTEITIVEMADHLLPFEDDDVAKQLARSFKKDKIKVMTSDSITKVEVN
    DNGVTAELGSGKSLTAELMIVSVGRRPYLDNLGVEELGLASERGKLIVDENMMTNVDGIYAIGDVINSPMLAHVASKEGL
    VAVDHAVGKKSSVNYDAVPRCVYTDPEVAAVGKTERELTEKGIAYHVGSFEFRGLGKAQAIGKLQGSVKVLTDDNDVIVG
    ASVVGPHATDLLTELTLAVHLKLTAAQVGDVIHPHPTLSEALMEALHDVHGQCVHKV

    >gi|310658664|ref|YP_003936385.1| peroxiredoxin [Clostridium sticklandii DSM 519]
    MNKRQNIVTMKGNPITLLGNEIKVGDNAPDFTVVDNDLNPFVFSSEPASVKIISVVPSLDTSVCEFQTTHFNETASELGD
    VKIITISVDLPFAQKRFCVGKGIDKVKVYSDYKDLSFGLNYGFVIEELRLLARGIVVIDKNNKVTYVEYVKEATDHPNYD
    KAIEEARKLI

    >gi|310658701|ref|YP_003936422.1| electron transport complex, rnfABCdge type, b subunit precursor [Clostridium sticklandii DSM 519]
    MSSILNSVLSLSAMGLVFGAGLAYASQKFAVEVDPKEEAILNALPGANCGGCGFPGCGGLATAIAKGEAATNACPVGGAE
    VAEKISEIMGVNASAGTKMIANVICNGTNSNAKNKSLYSGILDCKAASLVANGPKSCSYGCLGFGTCENVCPFDAIHVYD
    DGIAHVDEEKCVGCGKCIEACPKAVIHWIPYGQEVSIDCNSKEKGKDVKEKCSVGCIGCQI
    CVKSCPFQAITFENNLAKI
    DYSKCTQCMVCVEKCPTKAISGDLSKRKTARVIEDLCIGCTICAKNCPTNAIEGELKAIHKVDPDKCIGCKVCYQKCPKK
    AIEMI

    >gi|310658702|ref|YP_003936423.1| inner membrane subunit of an electron transport system [Clostridium sticklandii DSM 519]
    MIKSILIIMLSSILVNNFVLSRFLGICPFLGVSKKVETALGMGMAVTFVMVLASIFTYLIQKLILVNLGIEYMQTIAFIL
    VIASLVQFVEMVIQKTSPTLYQALGVYLPLITTN
    CAVLGVAILNIQSEYNLIETIFNGFAAAVGFTLAIVLFAGIRERLE
    ISDIPEIFQGFPIALISAGLMSIAFLGFSGLVK

    >gi|310658703|ref|YP_003936424.1| inner membrane NADH-quinone reductase [Clostridium sticklandii DSM 519]
    MNLFKIIKNGIIDENPIFSQVLGMCPTLAVTTSAMNGLGMGLATTAVLTMSNLAISLLRKVIPSKIRIPAYVVVIATFVT
    IVGMLLKAYVPALDKSLGLFIPLIVVN
    CIILARAESFASKNSVVSAAADGIGMGLGFALSLTLLGSVREILGAGSIFGLM
    LFGEAFKPAIIMILPPGAFLALGMMLAMFKKITKGKKNKKQEIQSAS

    >gi|310658729|ref|YP_003936450.1| rhodanese [Clostridium sticklandii DSM 519]
    MKRLKSKFSVISLALIMSLSLAACAPSQEPAQEAPQAPVESTETEQVEEADVVKDAANAYFANMPENIYKIDEKELVEKV
    KAEEDILVVDIRSNEDYNKGHLKNAVNIPWGPAIAENLENLPVDKDIYLY
    CYTGQTAGQATALLNMAGYNVRSINLGWKL
    GLSNVEGIEEVTQTEAVELVKSTPADIAPELKDAIKVYFDELVAAKGTTYENHKISEDDAKALLDAKDETIQFLSVRKAE
    DYAKGHIEGAINIPFGKGMQESFGTLPTDKKIIVY
    CYTGQTAGQAVAGLRILGYDAVSMNFGAGTPATGEGGWINKGYPL
    VQE

    >gi|310658739|ref|YP_003936460.1| hypothetical protein CLOST_1435 [Clostridium sticklandii DSM 519]
    MSEINSTETSASSRRSSRASSSSRRKPKKNQIPFGIGIFFFIVLFGIYLSTKSSSLAFFWITGNAFGFILQKSRFCFTAS
    MRDPLLTGSTSVTRAVMVALAIATLGFTAIKYGAHINGLPIPGQGYIVPISFATIVGGVIFGIGMVIAGG
    CASGTLMRVG
    EGFQMQMLSLVFFVIGSLVGANNFGWWHKVFISKGPSVFLPDIFGWAGALVVQLLIIAGVYILADKWENKKTNEAN

    >gi|310658741|ref|YP_003936462.1| hypothetical protein CLOST_1437 [Clostridium sticklandii DSM 519]
    MDIKNNKYYKLWFKDPMTYVMGAVLLSVFQIITFAVTGNPWGVSGPFANWGAWVFELFGGSVDSWSYFSTKSAQATLKAG
    FLNDPGSIRNLGVIVGALFSTLMASQFKFKKIKSKKQVIAAVLGGFLMGYGARLAYG
    CNIGAFYSGIASLSLSGWVFGIA
    LFIGAFLGSKLLVKYFM

    >gi|310658742|ref|YP_003936463.1| fad-dependent pyridine nucleotide-disulphide oxidoreductase [Clostridium sticklandii DSM 519]
    MNKKVESYDVVVIGGGAAALTAAIYCGRARLNTLVIEKSLVGGLATYTNEIENYPGFPEGTTGLGLMDNFHKQAKKFGVK
    FKLTDVKSVDLEGEIKKVETFRNIFEAKVVIVASGGKPRLTGAKNEELFLYDKGISF
    CATCDAASNTDKTVLVIGSGDAA
    IEEGMFLTKFAKKVIVSVMHDTGKMDCNEIAKNEALQNSKMDFKWNTVVDSFEGDERLTRVNLRNVKTNEIIPIDVDSCF
    LFIGYIPNTEIFKGILDMNKNGYMLTNEKMETNIEGVFAAGDVRDKFLKQVATAVGDGAIAGYAAEKYLAESETFHTQIM
    SKDLPGVVYIWNAVDEKCRELLPIIDNFEAKYKDKVKVTKVDIYKSTGLANRLGVTTFPALVATRDGKISKIIKEIDNEQ
    DIEAAFI

    >gi|310658763|ref|YP_003936484.1| rhodanese-like domain protein [Clostridium sticklandii DSM 519]
    MKNFIEAYEVKSNLDEYVIIDCRFDLVETDYGVKAYKNSHIKNAFFFDLEGDMSAKKSVHGGRHPLPDMAMFINKLEAIG
    ISNDTKILVYDDDISVAARLWWMLKYIGITNVKILNGGINAAAQAGIEMETGELNKSDYLKGKIDAKINNDLLIEMDELK
    TIISKGKNYILIDSRSTERYKGLIEPYDKIPGRIPTSINIFFKDVMNENKIKEIEDLKKVYNNIESDKMVIAY
    CGSGVTA
    PINIVAMDELGLYSRLYLGSYSDYVSYKDNVIEKD

    >gi|310659102|ref|YP_003936823.1| exported protein of unknown function [Clostridium sticklandii DSM 519]
    MNKNIKILIIVLVIGALAAIYFNKNLSDSSENIQKDNIDPSNNKTEESYETTTNEYYDLAIENGYPTFLEFTTSTCPACK
    YMEPTIEEAKIKFKGKANVVVVNLDLQENAHLAMAYNVRVVPTLVFLDNDAVIKSRTEGVTTLDDIEKMLKEAGMQ

    >gi|310659254|ref|YP_003936975.1| pyridine nucleotide-disulphide oxidoreductase family protein [Clostridium sticklandii DSM 519]
    MKYEVVVIGGGPAGLGAAVEAKKCGANSVLIIERDRELGGILNQCIHNGFGLHEFKEELTGPEYAQRFIEQAKKSDIEIM
    LNTMVLNIDDEKKIIALGEQGIMEIRAGAVVLAMGCRERTAGAIAINGYRPAGVYTAGMAQRIINMEGYMVGKEVVIYGS
    GDIGLIMARRMTLEGAKVKAVVEIMPYSSGLYRNIAQCLEDYDIPLMLSHNIHEIHGKDRINGVTISKVDENRRPIKGTE
    EFISCDTLLLSVGLIPENELSQKAGIAIDKITNGPIVDSKMHTQVDGIFACGNVLHVHDIVDFVTKESRIAGKNAAYYVR
    QSLNKDSYVSTKSDKGIRYIMPHKILLNSEEDVNLYMRVDGIYKDSKVIVKCDNKEILSKKMRHMIPSEMINIVLKNELI
    KDLSGEITVEVEGEKHA

    >gi|310659284|ref|YP_003937005.1| methylated-DNA--protein-cysteine s-methyltransferase [Clostridium sticklandii DSM 519]
    MKKLLVMDSPIGKLTLIEENKELICLDFGEIIIKDIPREETAFLKEVKNQLAEYFEGRRQSFDVKLNPKGTEFQKKVWTN
    LLTIPYGETASYKKIAILSGNEKASRAVGMANNRNPIPIIIP
    CHRVVGSTGKMVGYGGGLEIKEYLLKLEEK

    >gi|310659318|ref|YP_003937039.1| hypothetical protein CLOST_2014 [Clostridium sticklandii DSM 519]
    MKNKIGIIIAGAIIGILSVASVKLGNPLNMGLCIACFIRDIAGGLGLHRAEVVQYIRPEVIGIILGAFIMSKASKEFNPK
    NGSSPFTRFILGFIVMIGALMFLGCPLRMILRLGGGDLNALFGILGFTVGIFAGVKILDKGFSLGRTYNASPLEASSISI
    LALVLLGILVFIPTLLIFSESGPGSMRAPWIFALIVGLVSGIAAQKTRLCMVGGIRDMIMFKDSYLLTGFLSIFVFVLIG
    NMLTGQFKLGFIEQPVAHTDALWNFLGMALAGWGSVLLGG
    CPLRQLILAGEGNVDSAVTIIGMLVGAAFAHNFKLASAPT
    GPSLNGQVAVILGFIVLGGISYFYIEKEIKFKEVELKEGA

    >gi|310659334|ref|YP_003937055.1| alkyl hydroperoxide reductase [Clostridium sticklandii DSM 519]
    MERIVGMKAPSFNMATALGDGSGFGRVSLDDYKGKWLVLFFYPLDFTFVCPTEITGYSKKYDAFKGMDAEVLGVSIDSEH
    SHKAWINSDLGKLNFPLAADLTKKVASDYGVLIEEEGIALRGLFIIDPQGVVRYSVVHDLNVGRSVDETLRVLKALQTGG
    LCPVDWSEGEDLL

    >gi|310659354|ref|YP_003937075.1| copper-importing atpase [Clostridium sticklandii DSM 519]
    MSKKKVILGIDGMTCASCSAAIEKTLNKKEAVEANVNLAMEKASIEFDDSVIGLKEIEETIEKLGYTVVKNKVLLEVDGM
    T
    CAACSSIIEKVVGKLEGVYSVSVNLTTNTAQIEYNEKLISLDEIQKKMDKLGYPSRLKTDDKDKKAKQKDELATKKTKL
    IISIILSLPLLYTMVGHMPWETSLPMPDILMNPWFQMLLATPVQFIIGWSFYVGAYKSLMNKSANMDVLIVIGTSAAYFY
    SVYEGLKSIGTHHMPHLYFETSAVLITLVLLGKYLESNAKGKTKEAIEKLLSLQAKEATVIREGKEIRLPLEEVKKGDVV
    VVKPGEKIPVDGIVISGNSSVDESMLTGESIPVEKSSGDEVIGATINKNGNFTFEATKVGKDTALAGIIKIVEEAQGSKA
    PIQRMADKISGVFVPVVVAIAFVAFLVWYFIADKGNFAHALEVAISVLVISCPCALGLATPTSIMVGTGKGAENGILFKG
    GEYLETTHKIDAVLLDKTGTVTKGKPEVTDYFEHEKGALAYIVSAEAKSEHPLADAIVLYGETKNINKLEISSFEAIPGK
    GLHAKVDAKDVLIGTRALMKMYDINIDSGEDEYALLENEGKTVMFAAIDGKFSASIAVADTIKQSSKSAIEKINKLGIAV
    YMVTGDNQRTANAIASQVGIENVYAEVLPEQKADVVKDLKDKGYKVAMVGDGINDAPALAFADIGMAIGTGSDVAIEAAD
    VTLVGGDLDHIPKSIDLSRKTMRNIRQNLFWALFYNTIGIPVAAMGFLEPWVAGAAMAFSSVSVVSNALRLKKVKL

    >gi|310659535|ref|YP_003937256.1| d-proline reductase gamma chain [Clostridium sticklandii DSM 519]
    MSDLTVVKGLQSEIYVPITPPPVWTPVTKELKDMTVALVTAAGVHMKADKRFNLAGDFSFRVIPGDASVNDMMVSHGGYD
    NGDVNKDINCMFPIDPMRTLAKEGFIKALAPINIGFMGGGGDQKKFSEETGPEIARQLKEEGVDAVLLTAG
    CGTCHRSAV
    IVQRAIEESGIPTIIIAALPPVVRQNGTPRAVAPLVPMGANAGEPNNPEMQKAICTDSLKQLVEIPSAGKIVPLPYEYVA
    KV

    >gi|310659707|ref|YP_003937428.1| peroxiredoxin [Clostridium sticklandii DSM 519]
    MPEQFKAGCQRPAVKKNVPKEESPENTVLIQKEEKQSMIKVGKPAPDFSAPAYYKGQFANVDLSEYKGKWLVLCFYPGDF
    TFV
    CATEVSAVAEKYDELQGLGVEVLSISVDSVFVHKVWNDQELSKMVNKDIPFPMLSDQDGTIGKLYGIYDEDAGVETR
    GRFLIDPDGIVQAFEVVTPPVGRNVSELIRQVKAFQHVRNSGGTEVTPSGWKPGKKTLKPGPDLVGNVWKEWKVQEAFED


    >gi|310659708|ref|YP_003937429.1| hypothetical protein CLOST_2408 [Clostridium sticklandii DSM 519]
    MKKIIVFGSKHCPDCQPMQDYLKENNIDFIYLDITENMFYLKTFLKLRDTREEFSEIKAKGLVGIPCVNINDGEALYFEK
    PSIESLV

    >gi|310659725|ref|YP_003937446.1| thiosulfate sulfurtransferase ynje precursor (fragment) [Clostridium sticklandii DSM 519]
    MKKKLVTLFLSGLLVMSLATGCSAKPAEQGTQEQAAPEAEQTIASVEKTKVYVTPEWVKSVIDKNQPESENYIILEAAWG
    TEKDSPDYLKAHLPGAIHLNTDEIEEPEYWNIRNAEEITAVMSKYGITKDTTVIVYGPDSGTERVAFVMLWAGVENVKVL
    DGGLASWTEAGYETEEGNILPTATTEEFGVQIPAHPEYVIAMPKDAREAMKANDKFRLVSIRSLDEFTGKISGYSYIEKT
    GEPEGALWGHDEFDYYNEDGTIADFDKAVQMWSEQGITKENEIAFY
    CGTGWRACVPWLMAYENGWTNVKLYDGGWFAWQM
    DETNPVQKITPEEAAARYN

    >gi|310659746|ref|YP_003937467.1| glutathione peroxidase (fragment) [Clostridium sticklandii DSM 519]
    MSIYDIKLRTIDFEEITMDAFKGKVLLIVNTASNCGFTPQYEELEALYQKLGNEHFEILGFPCNQFGNQEPGDTAQIKSF
    CSFNFGVTFPMFDKVDVKGPNAHPLFVHLTNAKKGLVGKDIKWNFTKFIVDSKGNVVDRIASATSPLKLEEKIKQLIDEA
    S

    >gi|310659757|ref|YP_003937478.1| methionine sulfoxide reductase b [Clostridium sticklandii DSM 519]
    MSDYSKWEKAKASKDLKELTDIQYQVTQKEATERPFSNEFWDFNEDGIYVDIISGEPLFSSKDKFDAGCGWPSFTKPIDE
    HFIISKKDFKLLIPRTEVRSRYADSHLGHVFPDGPPPTGLRY
    CINSASLKFIPKADMIKEGYEDYIDK