Clostridium saccharolyticum WM1 uid51419

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|302384596|ref|YP_003820418.1| arsenate reductase-like protein [Clostridium saccharolyticum WM1]
    MSILFLQYPPCSTCKNAKKWLDAHEISYDSRNIKEENPTAEELAAWIKKSSLPIKRFFNTSGILYKEKNIKNLLPDMSED
    EQITLLASDGMLVRRPLIIGDHFVLAGFKKKEWETALLP

    >gi|302385041|ref|YP_003820863.1| thioredoxin reductase [Clostridium saccharolyticum WM1]
    MNEIYDVVIIGSGPAGLSAAVYGKRAELKMVVIEKEMASGGQVLNTYEVDNYPGLPGINGYDLGMKFREHAEKLGAEFST
    DEVLRIEASNGEFTVVGEEKTYATKTVIIATGAQHRKLSVIGEEELTGMGVSY
    CATCDGAFFRNKVAAVVGGGDVAIEDA
    IFLARMCKKVYLIHRRNKLRGAKTLQTQLFHQKNVEVIWDTVVEEIEGGDQVESLTIKNSKTEETQKLAVDGVFIAVGIN
    PQSEAFNNLVEMDHGYIKAAEDCETNVPGIFAAGDVRTKQLRQVSTAVSDGANAITSVERYLTRI

    >gi|302385118|ref|YP_003820940.1| Rhodanese domain protein [Clostridium saccharolyticum WM1]
    MFRTIPIWEVDHYINYYDNIMIIDLRSQSSYRQSHIMGAVNLPYEDMDQWMSSLPKDKLLIFYCSRGGQSMMACRKLEQA
    GYNVVNIANGIAYYKGKYMVRG

    >gi|302385361|ref|YP_003821183.1| FAD-dependent pyridine nucleotide-disulfide oxidoreductase [Clostridium saccharolyticum WM1]
    MGKRVLIVGGVAGGASAAARIRRLDADASITILERGEHVSFSNCSLPYYLSRTVEDKDELVLMTPEGFKNSYDIEVRVNS
    EVCGIDRTLKKIRIKDRVSGREYEESYDELVLSPGSYPIRPNSIEGVTLPHVFTVRNVKDIETLDQYISREEVRRVVVIG
    GGFIGLEVAENLKSAGKQVAVAEAANQIMAPFDYDMSQILQKELYDQGVELAVGDGVKAITEDKVILNSGRELPCDAVVL
    SIGVLPETELAKQAGLETGETGAIKVAPDYRTSDPHIYAVGDAIEVYQRLTHKPIKLPLAGPALRQARAAADAMYGMPSR
    NNGVIGSCAVRLFRLNAAATGLNERTAKANNIPCDFVYTIAMDKVGLMPGSSPMHFKLVFEVPTGRILGAQAIGKGSVDK
    RIDVIATLIAMNGTLEDLKDLELCYSPVFGTARDVVNLAALVALNVLHGVVKQVPVSNVRELVESKACIIDVRSRDEFEM
    GHLIGAVNIPLGELRQRISEIPHDRPVFLH
    CRTSQRSYNAAMALKGRGFDNVLNISGSFLGISYYEYFTDMTTGREKILT
    EYNFL

    >gi|302385435|ref|YP_003821257.1| selenide, water dikinase [Clostridium saccharolyticum WM1]
    MIPDREVRLTQMTKTAGCAAKIGPGTLAGILENLPKFQDPNLLVGIETSDDGAIYKVNEETALIQTLDFFTPVVDDPYTF
    GQIAAANALSDIYAMGGEPKVALNIVAWPNCVNPALLGKILEGGASKVLEAGAVLAGGHSIQDDEPKYGLSVTGFVHPDK
    VFKNSEARPGDVLILTKPLGTGIVNTAVKADMASEEAKEEVIRVMTSLNKKAKQVAEHYEIHSCTDITGFGLAGHSVEMA
    EGSGVTIEIFVKDLPIQKEAISLAKMGLIPEGAYRNRSYTEEKVDFGDTEEYIRDIFCDPQTSGGLLLSVSLKTGESIME
    DLKKAQMDTAFAIIGRVVEKEEKSVKLR

    >gi|302385577|ref|YP_003821399.1| dihydrolipoamide dehydrogenase [Clostridium saccharolyticum WM1]
    MIIKMPAIPGGKMSKVGKINVNAGDKVDAGVILVQVETAKGNRPVKAVSEGTVCKILCEEGAEIAPGAPMFEITEYQADE
    KPAKEDFNDMTQTGTTQLSADLLIIGGGPGGYVAAIYAAKNGRTVTLVEKSQLGGT
    CLNVGCIPTKALVKSAEICHSVNN
    ASVFGVEIDGNIRVNMKKVIDRKDQVKNKLVSGIDYLMNKNNINVISGQASFMDQHTVAVTGNESCIIKAKDIIIATGSK
    ISKPPIPGMDLPFVRNSTTALSDTELPKSIAIIGGGVIGMEFAFLYRNLGVDVHVIEFMDRILTMVDHEISSEMQAIAED
    AGIKIHTCSKVLKIQSSMNGTAVTSYEDKNGEHLLVSDKVLVAIGREPDLEGLSLELSGVLLNSRGRGIEVNSAMRTNID
    HIYAIGDVTDKIQLAHVASHQGMVAVDNLLGKHTAMDYSAVPNVIFTTPEIASVGINEDEARAKGLNISIGRFSFEGNGK
    ALTMNEPRGFIKLLKDNESQKIIGGSIIGPDASSLISTLTLAIANGFTEKQITETIFSHPTTSEVIHEAALDFGIGALHQ


    >gi|302385578|ref|YP_003821400.1| OsmC family protein [Clostridium saccharolyticum WM1]
    MLTTFKATAKKLPNGLQVETNSRGFKILLDEPEDLGGTNAAMNPVEALLCALGACQSIVASAFAAAHDVSFEEFHVELEG
    DLDPDGFLGLADVRNGFQEIRFVMHFKTNEPKEKIEKFAKFIEQTCPVGDCLSNGVKLVLSGVAID

    >gi|302385579|ref|YP_003821401.1| Rhodanese domain protein [Clostridium saccharolyticum WM1]
    MKKGILSPLLCMAMAASLLAGCAANSESKPADREKMAGEKETSDVKADPVDQKKVYVSPDWVQSVIDGNQKESSDYVILE
    CAWGEEADNPAYTEGHIKGAYHMNTDDIESEEYWNIRTPEEIKKLMADYGITKDTTVICYGADGVNSADDRVAFTLLWAG
    VENVKCLDGGLEAWTKSGYAMEKGSNKPKANDKGFGTTVPAHPEYIITIEDVKEKLENDSNFKLVSIRSKAEFSGETSGY
    GYIDKAGEPKGAIWGHDTDDGSYNKEDGTTAGVDVVEGFLKESGASLDNELAFY
    CGTGWRATIPFLICYENGYSNAKLYD
    GGWFQWQMDDSLPVQVGDPEGGKCEYTTVGELSADKAKK

    >gi|302385674|ref|YP_003821496.1| Heavy metal transport/detoxification protein [Clostridium saccharolyticum WM1]
    MKKIIKLEGLCCANCAAKIEEEVKKLDGVESASISFMTQRMTMEVQDGKTDEILEAAKKISNKIEPEAEFKVLR

    >gi|302385754|ref|YP_003821576.1| FAD-dependent pyridine nucleotide-disulfide oxidoreductase [Clostridium saccharolyticum WM1]
    MGKGKKKMVKCLVCGAVFEAENEVCPVCGVGTENFVPYEEEERDFHKDTEELYLILGNGAAGVSAAEAIRERNSTCSIVM
    VTKED
    CLPYSRPMLTKSVMGKERKEELLLHDPAWYEEKRILNLTGKRAEKIDTREKEVTFDDGIRLKYDKCIYALGSECF
    IPPIPGNEKQEVVAIRRLSDIEKINSLLSTSARAVVIGGGVLGLEAAWELKNAGLSVTVLEQGSQLMKRQLDEEAGEFLK
    AIILEKGIDVKFKAVTGEIEGEDKVTGVRLEDGTVLPADLVVISAGVRANVSLAEDAGAKSGQAVIVNEHMETTVPGIYA
    CGDCAEYEGINYAIWPQAVEMGKAAGANAAGERISYKTVTAALTFHGMDTSLFAVGDPGKDSGKTYEISREIDEEKKIYK
    VYYHEAGKLVGAILIGDTSDMGRILEEIE

    >gi|302385888|ref|YP_003821710.1| NADH:flavin oxidoreductase/NADH oxidase [Clostridium saccharolyticum WM1]
    MSTKFKELFEPAYIGKLQIKNKLSMAPMGPVGYADALGAMNQRLQEYYVERAKGGIGLIITGICSVDLDIEGLVRPGLPC
    PTQNPLAFIHEAYQMNERIHAYGTKIFLQLTGGLGRSALPGFATKFIAPSENENRFDPRIRHREMTIEEIKNMIQKFVMS
    AVVAKKAGFDGVEIHAVHEGYLLDQFAIALFNRRTDEYGGSLENRLRVATDIVKGIKAACGPDFPVSLRYSLKSCMKGIR
    RGGLPGEDYEEAGKDIEEGIEAAKILEAAGYDALNVDAGTYDSWYWNHPPMYFEDGMYREFGRLVKQNVDVPVILAGRME
    NPEMAIEALGDSCDIIGLGRQLLTDPYYPEKVRTGRLDEIRPCLGCHEGCLGRISNAPVSCAVNPACGREKIYGLVPANK
    KKHVLVIGGGIAGMEAARVLAERGHCVTL
    CEKSGSLGGNLIPGSVPHFKRYDRALVKWYQRQLELLNVEVRMNCEITAEN
    ISDFKPDEIITATGSKPIQSKFGSEAFAATADDILLGKAEAGKNVVVIGGGLVGCETALWLAQNGSKVTVIEMLKDILGG
    HGALPHMNHDMLVDLLAFHKVDIHTSSTVKSIEGGKVTAKTPEGERSFPADTVISAIGYRENHALYDELKDLDIPVHNIG
    DSQKVHNIMYSIWNSYELAREL

    >gi|302385920|ref|YP_003821742.1| protein of unknown function DUF395 YeeE/YedE [Clostridium saccharolyticum WM1]
    MSEVNTSVSGERVRKPRKPKKSQIPYAILVTILIIAFGFYLAGGSNKLPVYWGFGIAFGYILQRSRFCFTAAFRDPCITG
    STSVTRAVLVAVAVASVGFWAIKYASVMANAESNFSMTGVAPIGLPLAVGAVMFGIGMVIAGG
    CASGTLMRVGEGFAMQM
    LSLVFFIAGSFWGAHDMNFWSKFNENAPKIFLPDVFGWFGAIVVQGLIIVLLYIAAVKWQEKKMGSAE

    >gi|302385922|ref|YP_003821744.1| protein of unknown function DUF395 YeeE/YedE [Clostridium saccharolyticum WM1]
    MKQFFIKLGDHPIYKKLLKEPLTYVAGAVLLAVFQIAHFAALGSGWGVTSAFANWGTWNYKALGGDASGWVYYASEKMQK
    ELNTSFLADGGSIRNLGIVLGAFAATLFASQFKVKKIKSLRQVVAAVLGGLLMGYGARLANG
    CNIGALFTAISAFSLSGW
    VFGAFLLVGAFLGSKLLAKYFM

    >gi|302385923|ref|YP_003821745.1| FAD-dependent pyridine nucleotide-disulfide oxidoreductase [Clostridium saccharolyticum WM1]
    MTKKTESYDVVIIGGGAAGLTAGIYCGRAKLKTLIIEKTLVGGLATYTNEIENYPGFPDGATGLGLMDLFHKQAKKFGVE
    FKLTDVKSVSLAGDMKQVETFRTIYQAKAVIIGSGGKPRLTGAKNEDLYLYDKGISF
    CATCDAAANTGKTVMVIGSGDAA
    IEEGIFLTKFADKVIVSVMHENGKMDCNEIAKAQALSNPKMEFLWNTVVDRFEGDERLHTVVLKNLKTEEKIPVSVDSCF
    LFIGYLPNTELFRDILDMNRGGYLITNERMETNIPGVFAVGDVRDKYLKQVATAVGDGAVAGYGAEKYVSESEIFEKQIM
    NEGRPSLVYLYNAIDPQARELLPVFKEYEQEHGDLRVSCIDIYKSDGIAKRLDVENTPCMVWIKESRIMEKYYGEMTRDR
    ILDICR

    >gi|302385929|ref|YP_003821751.1| dihydrolipoamide dehydrogenase [Clostridium saccharolyticum WM1]
    MDVIYDLLVIGAGPGGYVAAIKAAKLGMKTGLIENREVGGTCLNRGCVPAKALLHAAKLYQEVLSGERFGIVSKEVSYDY
    GKVLSYKNETSESLRLGVEQLLKGNKIEQIHGTGTLIKDGRVRVKTEEEERILQAKNILLATGSKPSFPPIEGIRLPGVM
    TSDDMFLLDHVPESLVIIGGGVIGVEFATVFSSFGSRVTILEAEDKLLPGLDKEISQNVKMLLKKRGVTIHTRAFVRKIE
    TEGLDFICTFTEKGKEKEKTEVLKTPCLLSAAGRIPMTEGLLEDGTLLEMDRGRIKVSKNFETSMPGVFAIGDVIGGIQL
    AHAASAQGICAVEWMNGKEPSIDLSVVPSCVYTDPEIACVGMTEEDAKEKGIETVTGRFLTHANSKSLITKEERGFVKVV
    ADKETNVLLGAQMMCARATDMIGEMGTAISNKLTAKQLLKAMRAHPTYNESIGEALEDCIGGAIHALPRK

    >gi|302386021|ref|YP_003821843.1| arsenate reductase-like protein [Clostridium saccharolyticum WM1]
    MNIQIFGTKKCFDTRKAERYFKERGIKYQFIDMKEKGMSKGEYQGVRQAVGGLGAMLDENCRDQEALSLIRYIADEDKDE
    KILENQQVLKTPIVRNGKLAAVGYRPEVWKSWN

    >gi|302386034|ref|YP_003821856.1| FAD-dependent pyridine nucleotide-disulfide oxidoreductase [Clostridium saccharolyticum WM1]
    MERIVVIGANHAGTAAINTILDHYKDKKVVIFDSNDNISFLGCGMALWIGDQIHSSEGLFYCSKDIFEEKGAKVYMETKV
    DRIDYDKKLVYAEDKYGRRYQQEYDKLILATGSLPISPDIEGKELDNVQYVKLFQNAKDVIDKLHHDSLKNVVVVGAGYI
    GVELAEAFRRVGKNVTLIDNMHTCLSGYYDQEFSDIMSENLESHGIELVYGETVKKLTGNGKVEKVVTDKKEYNADMVIL
    GIGFKPNNQLGKEDLELFPNGAFLVDKRQQTSRPDVYAIGDCATVFDNSIQKTNYIALATNAVRSGIVAAHNVCGTPLES
    IGVQGSNGICIWNLKMVSTGITYGKAKKLGYDAEAVDYEDTQKPAFIDHDNYKVKIRIVYDKKTRIILGAQLCSEYDISM
    AIHMFSLAIQEQVTIDRLKLTDIFFLPHFNQPYNYFTMAALQAK

    >gi|302386045|ref|YP_003821867.1| electron transport complex, RnfABCDGE type, E subunit [Clostridium saccharolyticum WM1]
    MNKKCMERLFNGIVKENPTFILMLGMCPTLAVTTSAVNGVGMGLSTTVVLLFSNMLISALRKIIPDRVRIPAYIVIVATL
    VTIVQLLLQAYVPSLYSALGIYIPLIVVN
    CIILGRAESYASKNGVIESTFDGIGMGLGFTIALTCIGLVRELLGSGAVFG
    QTIIPEDFHVAIFVLAPGAFFVLSILTALQNKFKAPSATNGSAPKSELACGGNCASCTGSSCMSNHEVLQARKKQMEEEA
    SAARKAQAAKKEAEAKNAVSGKDE

    >gi|302386046|ref|YP_003821868.1| electron transport complex, RnfABCDGE type, A subunit [Clostridium saccharolyticum WM1]
    MKELLLIAIGSALVNNVVLSQFLGLCPFLGVSKNVKTSAGMGAAVIFVITIAAFVTSVIYKGVLVNLHLEFLQTIVFILV
    IAALVQFVEMFLKKSMPALYEALGVYLPLITTN
    CAVLGVALTNVQKGYNILESVVNGVGISVGFTIAIVMLAGIRERIEY
    NDVPHSFKGSPIVLITSGLMAIAFFGFSGLIK

    >gi|302386211|ref|YP_003822033.1| FAD-dependent pyridine nucleotide-disulfide oxidoreductase [Clostridium saccharolyticum WM1]
    MKIIIIGGVAAGMSAASKIRRMDPNMEVTVYEKGGFLSYGACGLPYYVGDYNDDYRKMIARSRETFTKMGIKTFLRHQVL
    SVDADRKEVLVRNLENGQEWKDRYDKLMIATGASSVVPPFPGRELLGVHVLKSMEDGIFLKEYAKMPEIQNVVIVGGGYI
    GVECAEAFLSLGKKVRILEAAPRILTPFDEEITALAQEELVRCGIELNLGEKVEGFYGDGLYVKRVKTDRGTYEADLVIV
    AVGVRPCTEFLKDTGISMAKNGALIVDREMKTSLPDVYAAGDCILVHHEVLEEDSFLALGTVANKCGRIAGTNLAGGHEQ
    FLGALGSAAIKVCGLELGRTGMGEGDAKRLQKDYKTLIVQANDHPAYYPDPTPITIKLIYEKGTKRLLGAQTCGQKGAVL
    RADVFAVAIHCRMTTAELGMTDLIYAPPFSGVWDAIQIACNAAKG

    >gi|302386874|ref|YP_003822696.1| anaerobic ribonucleoside-triphosphate reductase [Clostridium saccharolyticum WM1]
    MIQVVKRNGESAEFSLNKITEAIKKAFKATQKEYNNEILELLSLRVTADFQGKMSGGQVTVEQIQDSVEHVLEQAGYTDV
    AKAYILYRKQREKIRNMKDTILDYKAVVNSYVKVEDWRVKENSTVTYSVGGLILSNSGAVTANYWLSEIYDQEIANAHRN
    ADIHIHDLSMLTGYCAGWSLKQLLLEGLGGIPGKITSSPAKHLSVLCNQMVNFLGIMQNEWAGAQAFSSFDTYLAPFVKA
    DHLSYREVKKCIESFIYGVNTPSRWGTQAPFSNITLDWTVPSDMAELNAIVGGKEADFKYKDCKAEMDMINKAFIETMIE
    GDANGRGFQYPIPTYSITRDFDWSNTENNQLLFEMTSKYGTPYFSNYINSDMEPSDVRSMCCRLRLDLRELRRKTGGFFG
    SGESTGSVGVVTINMPRIAYLSRNEADFYKRLDHMMDLSARSLRTKREVITKLLNQGLYPYTKRYLGTFENHFSTIGLIG
    MNEVGLNANWLEKDLTSEKTREFTKAVLNHMRERLSDYQEMYGDLYNLEATPAESTTYRLAKHDKKHYPHIITAGKQGDT
    PYYTNSSHLPVDYTVDVFDALEIQDELQTLYTSGTVFHAFLGEKLPDWEAASKLVRTIAENFKLPYYTLSPTYSICSEHG
    YLSGEHKVCPVCGKNAEVYSRITGYYRPVQNWNEGKTQEYKNRTVYEPSRSVLKKGCAEEIKDKAMEKKPEIPTGTYLFT
    TKT
    CPNCRMAKQFLQHMDYEVVDAEENAELATRFGIMQAPTLVVVKNGQIRKITNASEIRKYAESPVC

    >gi|302386913|ref|YP_003822735.1| Rhodanese domain protein [Clostridium saccharolyticum WM1]
    MFDGSMSREQDLSLDQMKQMSPEEYVLVDVRDQTSYNHGFIPGAINIEKEALLNGDRPLPRDKKIILYCLKGIISEDAAR
    DLTEKGYEAYNLRGGYGEWLLRTMEREDKSDDRLENIEKSIRKKFHKELFSRFAKAINEYELVKENDRIAVCISGGKDSM
    LMAKLFQELRRHNKFPFELVFLVMDPGYNETNRQVIESNARLLNIPITVFETQIFDAVYDVEKSPCYLCARMRRGYLYNK
    ARELGCNKIALGHHYDDVIETILMGMMYGAQIQTMMPKLHSTNFEGMELIRPMYLIREDDIKDWRDYNGLHFIQCACRFT
    DTCTTCRTDGSTGSKRVEIKNLIRQLKETNPYIESNIFKSVENVNLNTIIAYKENGTTHHFLDGYDLVGRAEPADE

    >gi|302386946|ref|YP_003822768.1| copper-translocating P-type ATPase [Clostridium saccharolyticum WM1]
    MESQILNIRGMTCAACAQRIEKTVRKLSGISQASVNLASEKLFVEYDSSTLELSAIKAAVAKIGYEVVEKSENANVTIPI
    GGMT
    CAACAKRVEKAVGKLDGVINTSVNFATEKATVAYDPQKIRMSAIRAAIEKAGYKALEVNKADAADEDRARKQREIK
    TLWTKFIVSAVFSVPLLYIAMAPMIKFINLPFPAGIAPMEYPLIYALVELLLVAPVIGVGYKFYTIGFKALLQRSPNMDS
    LIAIGTTAAVFYSIYNMFQIADGHFMAVDALYFETAGVIITLILLGKSLEAVSKGRTSEAIKKLMGLAPKTAMIVEDGVE
    KEIPIDEVEIGDMILVKPGEKIPVDGTVLGGHTAIDESMLTGESMPVDKKEGDQVYAASLNTTGTIRFRAEKIGSDTALA
    QIIKLVEDAQGSKAPIAQMADIVSGYFVPVVCVIALLSGIAWYIGTAGDLKFALTIFISVLVIACPCALGLATPTAIMVG
    TGKGAENGILIKGGEALETAHKINTIVFDKTGTITEGKPTVTDVLTTEGLSKELLLQLTASAEKGSEHPLGQAIVHGAED
    AGLTLLAAEHFESLTGRGIEAKINGEDILAGNRKLMAERDISLTGMEEASDHLAGEGKTPMYVAINGNLAGIVAVADVVK
    ESSRAAIEQLHKMGIEVAMITGDNKRTAEAIAKQVGIDRVLSEVLPQDKSDEVRKLQAEGRKVAMVGDGINDAPALAQAD
    IGIAIGSGTDVAMESADIVLMRSDLMDVPTAIHLSKQTIRNIKQNLFWAFGYNVIGIPIAAGLLHLLFNGPLLNPIFAAA
    AMSLSSVSVLTNALRLKRFKPTTGTR

    >gi|302386993|ref|YP_003822815.1| methionine-R-sulfoxide reductase [Clostridium saccharolyticum WM1]
    MKKEIYLAGGCFWGTEKYLENIPGVLFTEVGYANGSTENPTYQEVCSHDTGHAETVKVEYDDSVIGLPHILMLYYDVINP
    VSVNRQGGDVGSQYRTGIYFTDDGDEAVIRDSLNQLQKKYKEKIAIEAEPLSCFYRAEEYHQKYLDKNPGGYCHIGSDKF
    EKAKKAEDKSRKFGKKTRDELKNSLTDLQFEVTQNSATEPPFQNEYFDTFEEGIYVDITTGEPLFLSTDKFESGCGWPSF
    SKPIDLESVKNYEDRSFGRIRTEVRSRLGDAHLGHVFEDGPIDRGGLRY
    CINSASLRFIPRKEMEKEGYGDYLKLF

    >gi|302387070|ref|YP_003822892.1| FAD-dependent pyridine nucleotide-disulfide oxidoreductase [Clostridium saccharolyticum WM1]
    MKNVDVLVIGGSAAGLVAAMTAKLNNPDKEVMLIRKEEKVMIPCGIPYIFGTLGNSDGNILPDGGLIQLGVEIRIDTVID
    IEKEKRICRTESGTDINFDKLVLATGSLPVKPGWLKGSELSNVFTVPKSKVYLDHLMECLKNFKNIVVVGAGFIGVEISD
    EINKAGKNVTLVEILPHILGLAFDEGVAVDAEEQLKSRGVNVITGIGVEQIIGTDKVEKIKLANGELIEADAVILSMGYR
    PNAELAQNMGLQLNEKGFIKVDQYMRTTEKDIFAVGDCAEKRDFATGKISGIMLASTACAEARVAGLNLYSLSTYQSFGG
    TIGIYSTNIGASSYGVAGLTEQAALNEGFSIVTGEFTGIDRHPGKLDNAHKQKVKLIVSKDSKKILGGEIIGGTSAGELT
    NVIGFIIQGGFTLTDLLVAQIGTQPMLTASPAAYPLIKAAEAVLMKLKK

    >gi|302387095|ref|YP_003822917.1| redox-active disulfide protein 2 [Clostridium saccharolyticum WM1]
    MALFGIGKKKEEVKTGCDCGGTCEPKTPVAEETGCCCGGNCDSEILVSAETEKNEVTEVKVLGSGCAKCNQLEAATKEAL
    ETLGMDTKIDHVTDFAQIAAYGVMSTPALVIDGKVVSFGKVLKTEEVIKILEKVRG

    >gi|302387202|ref|YP_003823024.1| dihydrolipoamide dehydrogenase [Clostridium saccharolyticum WM1]
    MAEHYDIIVIGGGPGGYTAALKAAGLGIKTAIVEKEKLGGTCINKGCIPTKALLHASSIFQALQNSDEFGVSTDFISFDF
    KKMQNYKKRSVKAYRKEVEELVKAAGVTVIWGTATIRRGRTVEVNGPGGKDYYEADHIIIATGARPVMLKIPGEDLPGVL
    TSDRLLASDTWNYDRLTIIGGGVIGVEFATIFSALCSHVTILESEAHLLGPMDSEVSQALEEELRRKGITIHCKAKVKEI
    REESNQGLVCVFEVNGEEQTVRSGQVLMAAGRAPCLEGLMGQDVDLKMEHGHLKVDSEFRTSEPGIYAIGDVAAHTKLAH
    VAAAQGTYVVEKIGGVGHTIRLSVVPNGMFVKLPVVPSCIYTEPEIASVGLTREAARACSMKVSCGRYSMSGNGKSIITR
    EQNGFIHLVFEEYSGTLVGAQIVCPRATDMISEMATAIANGLTAEQLMLAMRAHPTYSEGIGAAIENYFETKGETKQ

    >gi|302387532|ref|YP_003823354.1| Peroxiredoxin [Clostridium saccharolyticum WM1]
    MSVYDFTVKEMNGTEKHLSDYAGKVLLIVNSATICGFTPQYTDLQAMYDEYKGKGFEILDFPCNQFGNQAPGENDEIHSF
    CTGRFGVTFPQFAKIDVNGENAIPLYRYLVNEKGFEGFDPGHALTSRLEQKFEAVNPNYKKEPDIKWNFTKFLVDRQGNV
    VRRFEPTADRKAVEESVKNLL

    >gi|302387533|ref|YP_003823355.1| FAD-dependent pyridine nucleotide-disulfide oxidoreductase [Clostridium saccharolyticum WM1]
    MKKIVIIGGVAGGASCAARLRRLDEEANIIMLERGDYISYANCGLPYHIGDVIKSRDALLLQTPEAMKQKYGIDVRVKNE
    VSSIDRENKKLSVRRLDSGEIYEETYDTLVISTGSSPVRPPIPGIGSSRIQTLWTVPDTDRIRALIKESNIKTAAVIGGG
    FIGLEMAENLRHAGLSVSLIEMLDQVMTPVDYEMAQLLHEHILQNGVDLHLEDGVAGFEDQDDAVAITLKSGKILSAELV
    ILSIGVRPNSQLAKAAGLSVNERGGIVVDDYLRTSDPDIYAVGDVIQVEDFIFQEPAMIPLAGPANKQGRIAANNIAGAK
    ESYEKTQGTSVAKVFDLAVASTGANEKALIRRGLEKGKDYESILITQNSHAGYYPGAVPITLKLLFSTDGKKIFGAQIIG
    RDGVDKRIDTLAVAIRLGGGISELKSLELAYAPPFSSAKDPVNMAGFVAENLITGKVAFSAWDEVEQNPDAVLLDVRETA
    ELMTFSLPNGTHIPLGQLRNRIKELDPSREIIVF
    CAIGVRAYNAARILMQNGFHNVRLYPGGVKFYQSTHYQADAVVPSG
    ADEFSDSGQRKTENIPTLAMRLDCSGMQCPGPIMKVFETMKEMPHGSVMEVSASDPGFSRDIGAWCRRTGNELMACEHRG
    NDYVALVKKGSPVSPVIKETAEGKTLIVFSGDLDKVLASFIIANGAAAMGRPVTMFFTFWGLTALRKEEKQPVRKSLMES
    MFGAMLPRGSKKLKLSKMNMGGMGTAMMKKIMNDKHVDSLETLIQKAMKSGVKIVACTMSMDVMGIHREELIEGVELGGV
    GAYLGDAEESNVNLFI

    >gi|302387585|ref|YP_003823407.1| alkyl hydroperoxide reductase, F subunit [Clostridium saccharolyticum WM1]
    MMLDAEIKKQLTEYLQLLENDVLIKISAGSDRVSKDMMDLIHELTGLSPRIKTEEGKLPRTPSFSINRMGEDTGVTFAGI
    PLGHEFTSLVLALLQVSGRAPKVEGYLIDQVKRIQGEHHFETYISLS
    CHNCPEVVQALNLMSILNPGITHTMIDGAAFKD
    EAERKNVMAVPTVYLNGEVFGSGRMTLEEILGKLGSAPDISEFEKKEPFDILVIGGGPAGASAAIYAARKGIRTGIVAER
    FGGQVRETLGIENLISVAYTEGPEFAEILEQHVKNYEVDIMDSQRAVRLERKELLEVELENGAVLKSKAVILSTGARWRY
    VGVPGEAEFKNKGVAY
    CPHCDGPLYKGKQVAVIGGGNSGIEAAIDLAGIAGHVTVLEFMPELKADSILQKRLYRLPNVTV
    IKNVQTKEITGTDKVNGISYMDRETGEVHHQELQGVFVQIGLTANTDWLGETVARSPMGEIIVDHRNATNVPGVFAAGDC
    TDSAYKQIVIAMGSGASAALSAFDYLIRN

    >gi|302387586|ref|YP_003823408.1| peroxiredoxin [Clostridium saccharolyticum WM1]
    MSLIGSEVKPFKAQAYHNGKFVEVTEGDFKGKWSIICFYPADFTFVCPTELEDLQNNYETFKKLGAEVYSVSTDTHFTHK
    AWHDHSETIRKLTYVMIGDPSHTLSRNFDVLIEAEGLADRGTFLVDPDGIIQSVEINAGNIGRDANILIDKIKAAQYVRN
    NPGEVCPAKWKEGGATLKPSLDLVGKI

    >gi|302387653|ref|YP_003823475.1| methylated-DNA/protein-cysteine methyltransferase [Clostridium saccharolyticum WM1]
    MKYTAFIKTTLGMMGISETDGVVTDLFFSNNVCETSGQKTPLLAKAEKQIGEYLNGTRRGFDLPLASQGTEFQKTVWEAL
    RRIPYGETRSYKQVADMIGRPKACRAVGMANYKNPVLILTP
    CHRVVGSDGRLTGYAAGLEVKEQLLELERTYAGR

    >gi|302387660|ref|YP_003823482.1| cytochrome c biogenesis protein transmembrane region [Clostridium saccharolyticum WM1]
    MGFSIDVSIPVLTVFLQGVISFFSPCVLPLIPLYIGYLSGGTGVRGEDGRIYYKRSKVMLHTLCFVLGVSFAFFLLGLGF
    SALGSFFKSNQLLFARIGGILVVLFGLYQLGVFGSSSVLGKERRLPFSLGTLAMSPLTALIMGFTFSFAWTPCVGPALAS
    VLLMAASAATKTMGFVLIGVYTLGFVLPFLAVGFFTTSVLEFFKAHGNIAKNAVKAGGILMVFMGILMFTGKMNAVTGYL
    SSIPSPAVTESKAVPETEAATEALEEESVPVQEKQEESDAENQPLPAVDFTLTDQFGNSHSLSDYKGKTIFLNFWATW
    CP
    P
    CRAEMPDIQKIYDTANIDGDDALIILGVAAPDYGREKDEKGIKQFLEENGYTYPVLMDQDAELFTAYGIYSYPTTFMID
    RDGNVFGYASGQLSEDTMRSIIEQTMKGQRK

    >gi|302387737|ref|YP_003823559.1| methylated-DNA/protein-cysteine methyltransferase [Clostridium saccharolyticum WM1]
    MKYWEVYESKIGPLTIICDDEALLSIDFGRTEPEHATKKRTELMNRICVQVEEYLSGERRVFDLPLKPEGTEFQRKVWNA
    LLTIPYGETKSYKDIAVQIENPKGCRAVGMANNRNPIPIIIP
    CHRVIGANGSMVGYGGGLDIKVKLLELEG

    >gi|302388178|ref|YP_003824000.1| Peroxiredoxin [Clostridium saccharolyticum WM1]
    MNVSIGMKAPDFTAMTTFGPLKLSDYKGQWVILFSHPGDFTPVCTTEFIAFAQANDHFEALNTQLMGLSIDSNPSHLAWV
    NQIRLLTGIEIPFPVIADRMAEVANLYGMIAPDANKQETVRNVFFIDPNQIIRAILIYPLSNGRNINEILRLLTALQTTD
    KCSVVTPANWEPGNPALVPPPGTYDQTLARINDPETAGLNCVDWFWCYKNKSCQ

    >gi|302388339|ref|YP_003824161.1| thioredoxin [Clostridium saccharolyticum WM1]
    MAVITLTQENFESEVVKSSGIALVDFWATWCGPCKMFAPVIEEIAEGNFPDVKVGKVDVDQQPDLAGQFKVMSIPTLVLF
    KDGKAAATSVGVKSKKEVLEMIEKLR

    >gi|302388359|ref|YP_003824181.1| Rhodanese domain protein [Clostridium saccharolyticum WM1]
    MSIFGFLTNRSDFAVGMEQARNTPNAVLLDVRTAQEYTGGHVPGSMNLPLDCLESIKIDKNNPVFVYCQSGARSGQACRY
    LRAKGYTVTNIGGIADYRGALEKG