Clostridium phytofermentans ISDg uid58519

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|160878280|ref|YP_001557248.1| heavy metal transport/detoxification protein [Clostridium phytofermentans ISDg]
    MKKVVKLENLDCANCAAKMEDGISKIAGVEKVTVSFLMQKMTIVASEEQMEDILNQAEKIIHKLEPDVVIK

    >gi|160878289|ref|YP_001557257.1| methylated-DNA--protein-cysteine methyltransferase [Clostridium phytofermentans ISDg]
    MEELTTFQRIYEVVKEIPYGKVATYGQVAALAGNRHLAKVVGYALHVNPNPVIIPCYRVVNAKGEVSKAFAFGGVNRQIE
    LLEKEGVQFLEDGSVDMEVSRWAKLVF

    >gi|160878357|ref|YP_001557325.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Clostridium phytofermentans ISDg]
    MKKWLSMLILAICMFSLVACSNNEIEGTKQPFPEFEGVDFEGNSVSNDIFKDYDATIINFWTNGCGSCIAEMPELEEYYQ
    KFKEKNINLIAVAASAGDSDEMRLGAEKILKEKGVTFTNIIPDINSSFYKDFICEITGFPITYIVDSEGNMIGAPLIGVV
    KKQEDTLMKRLDKITEQ

    >gi|160878364|ref|YP_001557332.1| arsenate reductase and related [Clostridium phytofermentans ISDg]
    MSYQYLEYPKCTTCIKARKWLEKNQIAFESRDITVNNPTKEELKLWHEKSGLTLTKFFNTSGLLYREQNLKEKVKVMTVE
    EMIEILSTNGMLVKRPILVGDDFILVGFKEDEWKKRLLPPVLKRY

    >gi|160878372|ref|YP_001557340.1| electron transport complex, RnfABCDGE type, E subunit [Clostridium phytofermentans ISDg]
    MSKALERIYNGVIKENPTFVLMLGMCPTLAVTTSAINGVGMGLTTTAVLIMSNMLISMLRKAIPDKVRMPAFIVVVASFV
    TIVQLLLQAYLPSLNDSLGIYIPLIVVN
    CIILGRAEAYASKYPVYPSIFDGVGMGLGFTVGLTLIGLFREILGAGTAFGF
    SIMPDSYEPFSIFVLAPGAFFVLAMLTALQNKLKLKSATNVPMADKLACGGNCSSCSGSACHSNHELLDSVKEEATKKAA
    AEKARAANQTEKK

    >gi|160878373|ref|YP_001557341.1| electron transport complex, RnfABCDGE type, A subunit [Clostridium phytofermentans ISDg]
    MKELLLVLIAAALVNNVVLSRFLGLCPFLGVSKKISTAAGMGGAVIFVITIASALCSVIYDVVLVPLDLKYMNTIVFIIL
    IAALVQFIEMFLKKFSPGLYNALGVYLPLITTN
    CAVLGVAIDNVQKGNGFVISVVYGAGTAIGFLIAIVIMAGVRERIEN
    NNVTKSFQGSPIVLITAGLMSIAFMGFAGLL

    >gi|160878412|ref|YP_001557380.1| thioredoxin reductase [Clostridium phytofermentans ISDg]
    MNKIIHDLAIIGSGPAGLTASIYASRAELNTIVIEKEPMSGGQIINTYEVDNYPGIPGIGGFDLAVKFREHSDKLGATHV
    YGEVKAFEVEDGIKKIVLDNGEEFYAKSLIIATGAASRKLDVKGEAELQGMGVSY
    CATCDGAFFRGKTVAVVGGGDVAVE
    DAIFLARICKEVHVIHRRDEFRAAKTFITKLLSLENVTVHWNSVVDEIVGTDAVNAVKVRNVATEETSELNVDGVFIAVG
    NVPNSEVYTPAVAVDRGGYIIADESCETNVPGIFAAGDIRTKELRQVITAASDGAVAVTGVERYLNHL

    >gi|160878444|ref|YP_001557412.1| methylated-DNA--protein-cysteine methyltransferase [Clostridium phytofermentans ISDg]
    MKNVFYYNTMIGKLRIEEEDNFIIGVSSSDGDKTDQIKEKQIRETEQINEAEQVKESDLIKRTYLQLMEYFEGKRTTFDV
    PIRLDGTSFQTKVWEELRKIPYGETRSYGEIAKQVGVPKGARAVGGANHNNPVLIIVP
    CHRVIGSSGALVGFGAGIPVKE
    LLLKLENQESENILS

    >gi|160878523|ref|YP_001557491.1| rhodanese domain-containing protein [Clostridium phytofermentans ISDg]
    MYFEGVRLDEISRYIDRKDAIIVDLRKKEDYDKGHIPNAVSVPYTSSEELAEKVRYFKVIILYCYRGNLSMLAARDLSGI
    QGKVYHICGGIHAYPYRLER

    >gi|160878621|ref|YP_001557589.1| peroxiredoxin [Clostridium phytofermentans ISDg]
    MEINHLSIGMTAPDFTAVTTFGPLKMSDFKGRWVVLFSHPGDFTPVCTSEFLAFAQNAPEFDKLNANLVGLSIDSNPSHL
    AWVNSIYLNTGVQVPFPVIADRSGDIARLYGMLAPDVSTTQTVRNVFFIDPKQIIRAILIYPLTNGRCISEILRLLQALQ
    TTDEFNVVTPACWQPGEPAMVPAPATYEQLVERESNPTGEGLECKDWYWCYKSIE

    >gi|160878884|ref|YP_001557852.1| arsenate reductase and related [Clostridium phytofermentans ISDg]
    MNIQVFGKSKCFDTKKAERYFKERGVKFQSIDILSKGLSKGEFLSVSNALGGFEAMMDKTTKEYCMIQYLSTEDQIEKLL
    EMPKYYKTPIVRNGSKATIGYCPEIWRTWE

    >gi|160878893|ref|YP_001557861.1| redoxin domain-containing protein [Clostridium phytofermentans ISDg]
    MKNKKILWILAIFVVLIVGATVLYKNLSKNYAEQEENNEVNKQENITPTTEPEDSSNNTSDPTITEDPEPTMFPAIDFSM
    QDIDGNTVSLSDYYGKPIVLNFWASW
    CGPCKSEMPEFNKVYLDLKDDVNFLMVDLVDGTRETIKKGSKFVENNGYEFPVF
    FDVEQEGAYYYSVMAIPSTIIIDKDGNIANYYQGAISESVLKKELDALLGE

    >gi|160878895|ref|YP_001557863.1| rhodanese domain-containing protein [Clostridium phytofermentans ISDg]
    MKLRPLRKGFIYILLMLTGAMILAGCSRKQDASKEETDLKEQSYIEITQSEAKEMMDSEEELVILDVRTDEEFIEGHIVG
    AVLLPVGEIPDRAEEMLPDKDKKILVY
    CHSGRRSKVASYELAELGYKNVYEFGGIIDWEYDIVK

    >gi|160878897|ref|YP_001557865.1| thioredoxin [Clostridium phytofermentans ISDg]
    MDILHITKENYKAEVLEEDKVVLLDFWAPWCGPCRMLSPVIEEIAKEEENIKVCKINIDEQSELASAYRVMSIPTLAVMQ
    KGNLVSSSVGFKSKKDILKMLPAQ

    >gi|160878988|ref|YP_001557956.1| redoxin domain-containing protein [Clostridium phytofermentans ISDg]
    MNKKKTYIITGVFTAILVVSVFLYKQLAKGFENEESFKPQSESRLASEESDVPYPTEESDDSTTKSIDPTILPDTNSVEE
    KASDTDNLNEKSNGTIAPLNEQSDIVENSNNSSTNIQEKKATHNVANAAPTKAPAKQENAVQPTKAPQATNTPVPTKTPV
    STSTPVPTSTPFPTSTPVPTSTPVPTKPVNKNAATNFTVYDSNGNAVSLSDYFGKPIVVNFWASW
    CGPCKSEMPGFDTMY
    QRYKGSVTFLMVDMVDGYRETKETGQSFISKNGFSFPVFYDTKQSASYAYSVTSYPTTLFIDANGSIATIKKGAMSESTL
    ENEINKILN

    >gi|160879148|ref|YP_001558116.1| hypothetical protein Cphy_0997 [Clostridium phytofermentans ISDg]
    MSPNISLDNTYITLPEEFYTEQLPSKVPSPKLVKWNSTLAKELGLDSDFFQSEEGALVLSGNQILEDTTPIAEAYAGHQF
    GYFTMLGDGRAVLLGEIVTNDEERYDIQLKGSGRTPYSRGGDGKATLGPMLREYIISEGMKGLGIPSTRSLAVLTTGETI
    LRETALPGAILVRVAKSHIRVGTFQFANQFLDTKELKALADYTIKRHYKEIFTKEDRYRHFLHEVVKNQARLIAQWQLVG
    FIHGVMNTDNMVISGETIDYGPCAFMDTYHPETVFSSIDTEGRYAYQNQPKMASWDLARLAEALVPLLNDNTEKAIEIAQ
    EEINQFSKLYLTFWYEGMRKKLGLFHENDMDEDLIEALLGLMVKYEADYTNTFRDLTLNQTTQPNLKGSAEYQQWLDLWQ
    DRRKKQEESLEDSIKLMESVNPTVIPRNHRVEEALERAVNYHDYNAMDSLVSVLQHPYDYKNQNDYYATPPGKTACGYRT
    F
    CGT

    >gi|160879631|ref|YP_001558599.1| selenide, water dikinase [Clostridium phytofermentans ISDg]
    MEKEIVFCKGGGCTAKLGPEALKHVLDKIPKAKDPNLLVGFEGSDDAAVYRISDDVAIVQTLDFFPPMVEDPYIFGQIAA
    ANALSDVYAMGGDVKTALNIVCFPEKMDLNILGKILTGGNEKVMEAGGILAGGHSIADVDVKYGLSVTGTIHPDRIFKNS
    GVRPKDKLILTKPLGVGIIATADRVGEASEEAMDKAIKSMTTLNKYASEIIRKYDIHACTDVTGFGLLGHLHEMLQNEYT
    AVIQSKSVPYIKEAYDYANEFLITAAGQRNRNFVESFIEYETDDFAMQEILFDPQTSGGLLFSVNPEDANKILEDLHGLE
    MPCGIIGEIMELQEKEIIIR

    >gi|160879647|ref|YP_001558615.1| peptide methionine sulfoxide reductase [Clostridium phytofermentans ISDg]
    MNKTIYIAAGCFWGGEKYFSLIHGVLSTKVGYANGTTSNPTYEEVCHNNTGHAETVEIQYDDSILPLEKLLRLYYEVIDP
    TSVNKQGGDQGIQYRTGIYYIDEADLEIIKPSLEELAKKYDKPIAIEVKQLLHFYDAEEYHQKYLDKNPSGYCHIGQCAF
    DSAKNA

    >gi|160879648|ref|YP_001558616.1| thioredoxin-disulfide reductase [Clostridium phytofermentans ISDg]
    MANVIIIGNGPAGISTALYTIRAGIETTIIGKDFGALGKASEIENYYGFSQPISGEDLVKEGIEGAKRLGVNFISDEVLG
    LSYIDQLVVNTKNEDYTAKSVVIATGTARNTPKIKGLKDLEGHGVSY
    CAVCDAFFYRGKDVAVLGDGEYALHEALELLQT
    SNSVTLLTNGKTPAIEIPDFIKVNTTPIESLEGQEALETIIFEDGSKLSISGLFVAVGVAGSTDLAKKIGAITENNKIVV
    DNNMATNIPGLYAAGDCTGGMLQISKAVYDGAKAGTSIVKYLRNPKSKTPQI

    >gi|160879688|ref|YP_001558656.1| dihydrolipoamide dehydrogenase [Clostridium phytofermentans ISDg]
    MEKIYDLLVIGAGPGGYVAAIKAAKLGMKTAVIENREVGGTCLNRGCVPAKAMLHAAKLYQEVLSGEQFGILVEEVSFDY
    GKVMSYKNETSESLRLGVEQLLKGNKVERLQGIGTLLKDGRVRIKTKEGEEILQAKNILLATGSKPVLPPIEGIHLPGIM
    TSDEMFQLDHVPESLLIIGGGVIGVEFATVYSSFGSKVTLLEAEERLLPGLDKEISQNIKLLLKKRGVDIHTRAFVQKIE
    KVDCEFICTFLEKGKDQEKAEVRKIPYLLSATGRIPNTHGLLEETTLLEMDRGRILVNENFETSMPNVFAIGDVIGGSQL
    AHVASSQGICAVERMNGKEPSIDLSVVPSCVYTDPEIACVGITEQEAKEKGIETVTGKFLTHANSKSLITKEERGFVKVV
    IDKETNVLLGAQMMCARATDMIGEMGTAISNKLTAMQLLKAMRAHPTYNESIAEALEDCNHGAIHALPRR

    >gi|160879714|ref|YP_001558682.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Clostridium phytofermentans ISDg]
    MLEIGSKAPEFTLNNQEGVEVSLKDFLGKKVILYFYPKDNTPGCTAQACGYATLYPDFMEKGAVVIGVSKDSVQSHKKFA
    EKYNLPFELLSDTELEVIKAYDVWQEKNMYGKKTMGVVRTTYLIDENGFITGVSGKVNAAKNPEDTLKLI

    >gi|160879799|ref|YP_001558767.1| DSBA oxidoreductase [Clostridium phytofermentans ISDg]
    MNNVTVEFFHDVICSFCFPMSYRMRQLQKMMPEAQIVHRSYALIKSERDFDEMFGSRATAKSEILSHWEQANQNDDLHRF
    NISGMHKAEFPFPASMKALTACKAAYFTAGDAGYWDVFDALQNALFVQNSNIEDPDIISECIRHSGIDFAKWEQHYNSGD
    TKEAVEKDLILAKQYGIEGVPCLIIDGKDRISGAQPLAQIIQAIRGAAEIQEKTSPEGAACRLDGGKINCD

    >gi|160879817|ref|YP_001558785.1| redoxin domain-containing protein [Clostridium phytofermentans ISDg]
    MKKNIISKILTVLLCTFTLTVLLAGCTQGETSKNDQSTVRQEENYDYTDYKDYTEDGMGITLKLPIKYLDNQTIIPGKYE
    VMFGDLSLLEKDIPKAETDPSDHLDIFFMPQKGEYCPFKVLEYPAEKWDGWMSSNKRAADITKCETSEEICRKDGTVYIY
    AQPIVDTSAFDSNMKADYDEIVQMLPAIKASIKPATFTVGDLGAFSANDLDCKAVDNSIFAGHKLTMINIWATF
    CQPCIK
    EMPDLQKMSEDMPAGTQLISIVGDVKDEELLKLAKKIAKDAGVSFTSIVPDNSLKEYLDNNMIAYPTTLFVDSAGKIIGE
    PIIGERDMSVYKEVLNDRLTQVGS

    >gi|160879888|ref|YP_001558856.1| methylated-DNA--protein-cysteine methyltransferase [Clostridium phytofermentans ISDg]
    MIKDENKKHQYYQALLNKDSKYDGIFFAGIRTTGVFCHATCPAKKPRYENCTFYETAEEALLAGYRPCKRCNPLFYPQEL
    SPLVKQMVSLVEKNPEKKWRDSDFAELGIHSATARRQFKQKYGMTFVQYARARRMGIAMKTIRTGEKIINAQIDVGYDSS
    SGFHDAFSKIMGRTPKKSNEFKILYADWVDTKLGPMMSIADEKYLYLLEFVDRRGLEREVERLRNRLNASIIPGKTNISN
    CIKEELNQYFDNKLLKFETPVMLLGSDFQKKVWGELVKINMGETKSYKDMAISIGNAKSVRAVGNANGANQLALIIP
    CHR
    VIQSDGSLGGYGGGIERKKWLLNHENQNRNF

    >gi|160879923|ref|YP_001558891.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Clostridium phytofermentans ISDg]
    MKILIIGGVAAGTKVAAKLKRENRDYDVTILTKSKDISYAGCGLPYYVGNVIEQREQLIVNTPASFSALTGATVLTETEV
    IKINRDQKTVEAKSLTTNELSTYSYDKLVIASGASPIKPAIEGVNLDGVYYMRTPEDAIGLREAVEAGKMKRAVVVGGGF
    IGLEVAENLSIQGVRVSVLDMADHILPGFDPEFADYVENHLADHVIMAMTNTRLEAILGDGKVEKVQTEKRAIKCDAVIL
    AMGIRANTSFAVDTGLELMKNQTIKVNEYLMTNDPDIYAVGDCACVSNALTKESAWSPMGSSANIEGRIVARNIAGGSIS
    YRGVLGTGVCKLPELNVGRTGLTEKAAMESGYDAVSVVTVVDDKAHYYPQASYFIVKMVADRATKKLLGLQVLGKGNVDK
    MIDIAVTALTMKATLEDIVDMDLAYAPPFSTAIHPLSHTVNILLNKISGAFNSMTPADYMADKAEGYQLIDASLNPSITG
    APHLDLTKVTGKVADYALDDKLLLVCSKGKRAYLLQNRLKHFGYTNTLVLEGGSIFNSI

    >gi|160879991|ref|YP_001558959.1| cytochrome c biogenesis protein transmembrane region [Clostridium phytofermentans ISDg]
    MEHINFIIVFLEGVLSFLSPCVIPILPIYLAILSNSRNDRNRNRDMKSVTINNENHTVKQDSRANKRVLLTNTLLFVFGI
    STTFFLLGTGIGIFRTFLTEYKRYFLIVGGGFIFLMGLFYVGDIKIPFLQKEKRIQLKTNQMNPIIAYLLGFTFSFGWTP
    CIGPMLASVLVLASTKQDIWTGNLLIGIYTLGFIIPFLIVAAFSDKMLKLLEKVKLKSDKLKTFGGYVILLMGFLVLLNG
    ITTPKFIRPTYVQGENSNGESKSILAPDFTLIDQYGDTHTLSDYKGKTVFLNFWATW
    CPPCKREMPHIEEIYKEYGSNKE
    DVIILGVAFPNDGGEKSKRGIMSFLEEKNYTFPVVFDETSNLSYYYNISVFPTTFIINPEGSIEGYFQGGMRKDDMRNII
    DRVKNNSVK

    >gi|160880008|ref|YP_001558976.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Clostridium phytofermentans ISDg]
    MKKVVIIGGVATGASTAARLRRLDETIEIVMIERGEYISFANCGLPYYLGDVITDRDELLIATPKLMKDRFHIDTRIHSE
    VTKINPFKNSVTIQSADRGTYEETYDYLVLAPGAKPIDFNFEEVSSDKVFTLRNMNDTDRIKTALDGVQKAIIIGGGYIG
    VEMAENLVEKNIEVTLVQALPHILAPFDDDMVILAENEMRKKGINLLLSEMAVALHETEVGVSLELESGNVVEGNILISA
    IGVVPDTDFLKDSGVSLGKRGHILTNEQMQTNIPNIYAGGDAVTVTDFVTKQVTAVPLAGPANKHGRIIADNICGIPSKY
    KDTQGSTVIKVFDLTLAATGNTERQLSLQGIEHQTIIIHPNHHAVYYPGAEQITLKLIFNSSGAILGAQAIGIAGVVKRI
    DVIATLLRMGGTIYDLTELELCYAPPYGSAKDPVNFAGYVAENVLTKKTDLVHPRELENIKDNPNIVVLDVRTLGERNFG
    KVDGSIHINVNDLRDHLDELDKEKEYWIY
    CAVGVRAYVAERILKQHGFQCKNIIGGYKTISALGLLVP

    >gi|160880009|ref|YP_001558977.1| rhodanese domain-containing protein [Clostridium phytofermentans ISDg]
    MGFLDNLLNSFGGNSSIKKLKYEDAANNLNKDKNIILIDVREKYEFQSGHIKGAKNIPLSVVDKTIETIAKDKNSTLYVY
    CQSGARSARACQVLSTKGYTNVYNLGGIMGWPYGIVR

    >gi|160880185|ref|YP_001559153.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Clostridium phytofermentans ISDg]
    MKVVVVGCTHAGTATVVNLKELHPDSEITIYEKNDNISFLSCGIALNVGKVIKDTNSLFYNSPENLNKSGVITKMKHEVL
    DIDFENKVLKVKNLVTGETFEDSYDKLVLTLGSWPIVPKFEGGELENIEL
    CKNHDHALRIIEKSQNASNVVIIGAGYIGV
    ELVEAFEVLGKKVTLIDAEQRILPKYLDKDFTDIAENEFTSRGVQLVLGEKVNKFLGEDGKVNQVVTENGTYDADLVILC
    IGFAPSTKLVQGKLDTLPNGAIIIDEYMRTSQEDVFAAGDCCVVKFNPSGDYRYIPLATNAVRMGTLVARNINKPTIKYM
    GTQGTSGIKIYDYNIASTGLTVEVARTTTTMNVASVSVTDNYRPEFMPTFEPATINLVYDTDTRRILGGQIISKIDLTQY
    MNTLSVVIQNNMTVEELAMTDFFFQPHFNKPWSLLNTVALKAL

    >gi|160880317|ref|YP_001559285.1| ArsR family transcriptional regulator [Clostridium phytofermentans ISDg]
    MDQESRQFKDNTYTQLAKIGKAIASPKRLEILDILAQGSKTVDSIARETEMSVANTSQHLQVLLEARLVDYQKQGLYSYY
    KLADKTVVNFILSLQMLAEKRIAEITRLREEIYSNKDNMEQIKMPDLLEKMKNGNVTLIDVRPKDEYEIMHIPGANSIPI
    EDLEKHISNLPSDQEIVAY
    CRGRYCLLSVEAVELLRSYGYKAVRLEESVQEWYSYNND

    >gi|160880362|ref|YP_001559330.1| thiol-disulfide isomerase and thioredoxin [Clostridium phytofermentans ISDg]
    MENYDSLELIKQSLDSNNMVLIYFGNKTCGVCTDLKPKVEKILEEYPKIKSIYVDVEKSHNIAVSYNFFTIPAILVFVEG
    KVTIREARYISVRDLSDKIERYYNLLNE

    >gi|160880794|ref|YP_001559762.1| glutathione peroxidase [Clostridium phytofermentans ISDg]
    MSIYDFEVRTVEGNKISLGEFKGKVLLIVNSATQCGFTPQYDKLQDMYEKYAKEGFVILDFPCNQFGNQAPGSDEEIVSF
    CDARFGITFPQFSKIDVNGENAIPLYQYLVKEKGFQGFDPEEEMTSVLNGVIRKTNPNYANEPDIKWNFTKFLVDRDGNV
    VERFEPMEHMDVVEDKMRELL

    >gi|160880795|ref|YP_001559763.1| glutathione peroxidase [Clostridium phytofermentans ISDg]
    MSIYQYNVKDGKGNLVSLEEYRGKVLLIVNTATQCGFTPQYKSLQTLYEKYQQLGFEILDFPCNQFGNQAPGSNEEIASF
    CELKYNTTFRQFAKIDVNGIKEEPLFTYLKSQQSGLLGEKIKWNFTKFLVDRNGNVVERFAPKTTPEKMEAKIKALL

    >gi|160881592|ref|YP_001560560.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Clostridium phytofermentans ISDg]
    MMSKKTVIIGGVAGGATAAARLRRRDEEMEIVVFEKGGEISYANCGLPYYIGDVIKSRDALLLQTPAGMKAKFDIDVRVQ
    SEVVKINPEEKTVTVKKVGEEDSYEESYDTLIIATGSSPIRPSITGIDAPNVFALWNVPDTDAIKDYLNKEKPKSVAVIG
    GGFIGIEMAENLHAAGLSVTMIEMQNQVMPTLDYEMAQLLHEQIRSQGVELILSDGVKALEHGEKTKILLNSGKSCTVDM
    VILSIGIKPNSKLAKEANLVLNERGGIVVNEYLQTSDPSIYAVGDVIEVENPILSNKTMIPLAGPANKQARIAADNIAGD
    NLKYQGTMGTSVAKVFDLTSASVGVNERMLTQLGKKKDIDYHTALIYQKSHAGYYPGATTLALKLIFDAKGQIYGGQIVG
    VEGADKRIDTLATVMKLGGKVHDLTELELAYAPPFSSAKDPVNMLGFTAENIINGLVSFIEPKEIDQIIADVEQSKDYII
    LDVTEEVERMVYQLPKSYHIPLGKLRQRLNELDKNKTIVPY
    CSIGVRSYNAARILKQHGFDKVRVLSGGTSFYKSVHHEE
    YSKGYDINEVDMKSEDSLLKGDEKVMAAETNIAKMQVKESATEVPVEESIKESAAELPVKEIAILDCCGMQCPGPIIKVS
    ETLSKCKDGDVIKVTATDMGFARDAEAWCKRTGNTLVKTERGKKENTVYIKKGNDSCSILNSVIPTTLPQGKTIIVFSGD
    LDKVLASFIIANGARALGRPVTMFFTFWGLNALRKPEKVKVKKPFMDRMFGAMMPRGSKRLKLSKLNMGGVGTKMMQKVM
    KDKNVNSVEELMMQAMKSGIKLVACTMSMDVMGITKEELLDGVEFAGVATYLGDAEESNVNLFV

    >gi|160881608|ref|YP_001560576.1| UBA/THIF-type NAD/FAD binding protein [Clostridium phytofermentans ISDg]
    MLNQFSRSELLLGTEGMEKLSKARVAVFGIGGVGSYTVEALARSGVGTFDIFDDDKVCLTNINRQLIATRKTVGKYKVDV
    MKERILEINPNAIVNTHQCFFMPENAGNFDFSEYTYVVDAVDTVTAKIELVLRANQANTRIISCMGAGNKLDPTRFEVTD
    IYKTSVCPLAKVMRKELKTRGIKKLKVVYSKEPVRQPLSDMALSCKTGCICPPGAERK
    CTQRRAIPGSTSFVPSVAGLII
    AGEVVKDIIGITE

    >gi|160881995|ref|YP_001560963.1| copper-translocating P-type ATPase [Clostridium phytofermentans ISDg]
    MKEIYNIEGMTCASCSSAVERVTGRLPGVSSSSVNLTTAKLTIEYEEDKVTPDLIMEKVKKAGFGISPYHKEKQIDEKAV
    RQKEEEETEKKFKASRTRLVIAIAFAIPLLYISMGHMVPWKMPLPAFLDMHHMPFNFAVAQLLLTIPVLICGSKFYTNGF
    HTLFKGNPNMDTLVAVGTSAAFIYSVVMTIRIPYNSNAVDNLYYESAAVVVTLVMLGKYLESRSKRKTTQAIRKMMELAP
    DTAVLVENGVEREVPVSELRKNDIVIIKAGSKVPIDGVVIEGSSSVDESMLTGESIPVEKQVEDMVIGGSQNFNGMLLVR
    VTSVGEDTTLAKIVKLMEDAQGKKAPISKIADKVAGYFVPVVMIIAVVAAVIWFLLGHDIAFVLTIFVSVLVIACPCALG
    LATPTAIMVGTGLGASHGILIKSGEALETAHHIDTVVLDKTGTITEGKPKVVEIFTKNYSREQILSFTAAVEAGSEHPLA
    RAIVEEYHSSVKEKEPAIEQFENKTGLGVEAILSESGKKIAVGNEKLMLSYGKDAVSKEFHMAAEQMAMQGQTPIYVMIE
    GKLEGIIGVADTIKSTSREAVEALKSLGLTVYMLTGDHKVTAEAIAKKAMVDHIIAEVLPGDKAEVVKKLQSEGKKVMMV
    GDGINDAPALIQADVGVAIGSGSDIAIDSADLVLMRSDLMDVYRAVHLSKLTIRNIKQNLFWAFIYNIIGIPIAAGLLYP
    FTDILLSPMLGGFAMSLSSVCVVTNALSLRYKRLEVKRRA

    >gi|160882037|ref|YP_001561005.1| thioredoxin [Clostridium phytofermentans ISDg]
    MALIFTDENFEKEVIQSDLPVLVDFYADWCGPCKMMAPIIEELHDQYEGKIKIGKLNVDNSPETAAAFRVMSIPTLIFFK
    NGKAIETMVGVVAKQKLEDMLNA