Clostridium novyi NT uid58643

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|118444071|ref|YP_877241.1| thioredoxin [Clostridium novyi NT]
    MIREIGGSNFIQEVMNSEETVVVDFWAPWCGPCKMLGPVMEELSHDMEGKAKFFKINVDENPEIAQRFQIGSIPNVMVFK
    GGKVVENLIGFRPKQDFEKSIGKHI

    >gi|118443538|ref|YP_877242.1| thioredoxin reductase [Clostridium novyi NT]
    MSERYDIAIVGSGPAGIEAAINAKIRNKNIIVFGNKNFSPKLMKAPKVNNYLGFYNLTGKELKDKFKEHIDSMNIEIVEE
    RIDSVYAMGEYFSLMVNNKMYEARSVIIATGIEYGKPLKGEEEFLGKGVGY
    CATCDAPLYKGKVVTIVGYNKEAEKEANY
    VSELASKVYYVPMNNGELSLNDNIEIVKGVPKEVVGEERVKQLVLNNNTIDTDGIFILKDSISPSQLVPGLQMEDDHIKV
    DRKMRTNIERCYAAGDCVGKPYQYIKSAGEGLIAALTAVEEL

    >gi|118443354|ref|YP_877282.1| cadmium-translocating P-type ATPase [Clostridium novyi NT]
    MSDNAKKEIILEGLCCANCAAKIERSVNKLEDVDNASLDFISKKLTIEAKDSEKLDVVLNKAIKIVNDIEPDVKVLLNYN
    HKIHGHAHSHDHSHGQETSKTDFIKFGFGTVIFIIAMVFKFSFKIELALFLMSYILIGGEVVLRALQNISRGQVFDENFL
    MVIATIGAFAIKEFPEGVAVMLFYQIGEFFQDKAVERSRGSISDLMNIRPDYANIKIGENIKKVSPEEVKINDIIVVKPG
    EKIPLDGVIVDGKSMLDTSALTGESVPREVEAGSEVLGGFLNKNGLITIKVTKEFTESTVSKILDLVQNASSKKASTENF
    ITKFARFYTPVVVITAVMLAIIPPLVIQDAEFSKWLYRALIFLVVSCPCALVVSIPLSFFGGIGAASRNGVLVKGGNYLE
    ALNSVETVIFDKTGTLTKGVFNVTEVCPLNGVTKEELLEYAAYAESYSNHPIAISILNYYNKPINKEEIQDYNEIFGHGI
    SIRFKGKQVFAGNNKLMDKANIKYNKVKAAGTIIYVAVDKQYKGYILISDEVKEDSNKTIKALKNIGVKNTVMLTGDNKE
    VGETVASALGVDEVCTELLPNDKVEKLENIYHNKSSNGKIIFVGDGINDAPVLARADIGIAMGGLGSDAAIEAADVVIMT
    DEPSKIVTAIKIAKRTRRIVLENIIFALGVKLVVLILGATGIANMWEAVFADVGVALIAVLNAMRVLKYND

    >gi|118444484|ref|YP_877663.1| SoxR-reducing system protein RsxE [Clostridium novyi NT]
    MSTLMERLKNGIITENVTFVQVLAMCPTLAVTSSFKNGVGMGLASTVVLMGANFVISLLRNFIPDKVRIPAFIVVIAGFV
    TLLQFLLAGFVPALNKELGIFIPLIVVN
    CVILGRAESYASKNGPIASIFDGLGQGLGFTLSLGVIGFIRELLGSGKILDG
    IHPITVMETPTLIFVLAPGAFITLGILMAIMNQYKMKKK

    >gi|118443088|ref|YP_877664.1| rnfA/nqrE [Clostridium novyi NT]
    MGIFTLIVSALLVNNMVLAKFLGICAFLGVSKKVETAKGMGMAVTFVMALASVISYIVFKFILVPLKIEYMYTIAFILVI
    AALVQFVEMVLKKTMPELYKALGIFLPLITTN
    CAILGAVIINMNEHYNLLYSLIFGVVSGLGWMLAIVLLAGIRERMEAN
    DKMPEAVKGLPASLITAGLMAIAFLGFSGLV

    >gi|118444257|ref|YP_878371.1| arsenate reductase-like protein [Clostridium novyi NT]
    MNIQIFGVKKCFDTKKAERYFKERKIKYQFIDLNMKGLSKGEFQSVKNAVGLTNLINKSSKEYKKSNMEHIRTSSVKEEI
    LLNNPKLYVTPIVRNGKEATVGYKPDVWKTWE

    >gi|118443485|ref|YP_878377.1| thioredoxin [Clostridium novyi NT]
    MKRLTSIEEIKKFISTNELALIYVTSKLETCSVCHMLLPKIQEQLNKFPKLEIGTVDSSEVLEVAGEFYIFSLPLIIFYA
    EGKEVLREGRFIAMDNLKNTVERYYNLIYK

    >gi|118443254|ref|YP_878392.1| copper ion binding protein [Clostridium novyi NT]
    MKRKLNIEGMSCNHCVMHVKNALMEIEGVSNVDVNLEGKFAIVEGEKLDDIKMKAEVEDWGYNVTSIEEA

    >gi|118444416|ref|YP_878393.1| copper-translocating P-type ATPase [Clostridium novyi NT]
    MDKILNVQGMTCAACAKSVERASKKTNGVIYANVNFASEKLYVKYDENVVSDKEIIQAIEKAGYSAKEEKNTKTVTMKIG
    GMT
    CAVCAKAVEKTTRKLEGVEKAEVNFATEKLYLEYEPSKIRISKIKEAIDKAGYIAEDNEVSVDIDKERKENEMKVMW
    NNFIYSAVFAIPLLIISMGHMMGMHLPSIIDPSISPLNFALIQLILVIPCIYNGRKFFKVGFKTLFKGSPNMDSLISIGS
    GAAILYGIFGIFKIATGHNEYTMDLYFESAATIITLISLGKYLEAKSKGKTSEAIKKLMGLSPKTALILQNGEEVIIPIE
    EVEKGDIIIVKPGERIPVDGVLIEGNSSIDESMLTGESIPVEKKVNDKVYGATINKNGYFKFKATKVGKDTALSQIIELV
    EKAQGSKAPIARLADTISSYFVPTVIIIAIVSSLSWYFSGKGLIFSLTIFISVLVIACPCALGLATPTAIMVSSGKGAEN
    GVLIKSGEALETAHKINTIIFDKTGTITEGKPEVTDIMTTEEFHEDYIVKLVASAEKASEHPLGEAIVNYAKNKKIDLID
    VTSFKSLTGRGIEANIDNKQLLIGNKRLMNETNIDINEFYEKAKELAHNGKTPMYIAIDNKAVGIIAVADVIKKNSKLAI
    QKLQEMGIRTVMITGDNEKTANAIAKEVGIDEVLAEVMPEHKADNVKKIQESGDTVAMVGDGINDAPALVQSNVGIAIGS
    GTDIAMESADIVLIKNDILDVVTAIKLSKATIKNIKENLFWAFGYNTLGIPIAAGVLTLFGGPKLNPMIAAAAMSLSSVS
    VITNALRLKRFKKDI

    >gi|118443670|ref|YP_878447.1| thioredoxin reductase [Clostridium novyi NT]
    MEKENKNIDILIIGAGPAGLTAAIYTSRLKLKTLVLEDEIMGGQIRDAYTIENYPGFINISGVDLTKKMEEQAIASGAII
    DEFDKIISIKLSNSTKTVETEDHIYNAKVVIIASGAKRRELPIPEEKKFHGKGIHY
    CELCDGHMYDGKHIAVVGGGNSAL
    LAVNFLSKYAEKITIVHQLDYFQAEKKVQDEVFKNPKVNILWNSEIKHAIGDNHISKISIENIKTKQETELSVDGIFVYI
    GFIPRTDLFKDYITLDEFGNILADETTKTNIDGVFAAGDVRSKSFRQLTTATADGTVAALMAEKFINTKEK

    >gi|118443116|ref|YP_878448.1| glutaredoxin [Clostridium novyi NT]
    MVKVYSIPDCPWCVKVKKYLNSKNIEFEDINVQENVDGREEMISLTNQSSVPVINVDGNVIIGFEKEKLDSLLNL

    >gi|118443923|ref|YP_878449.1| glutathione peroxidase [Clostridium novyi NT]
    MSIYDFKVKTIEGQEIPLEKYKGKVLLIVNTASKCGFTPQYKDLEELYKKFNSKGFEILGFPCNQFAEQEPGSNSEVKKF
    CELNYGVTFPLFAKIDVRGDSAHPLFKHLSESLPFKGFNLNHPNGNTLNNFLKENFPKYLEGNSIKWNFTKFLIDKEGNV
    VGRFEPTTEPSEIIPEIEKLL

    >gi|118443135|ref|YP_878469.1| thymidylate kinase [Clostridium novyi NT]
    MNVLEKEKDKHNNPNKLINEKSPYLLQHAYNPVQWYPWCEEAFIKAKEEDKPIFLSIGYSSCHWCHVMENESFEDEEVAE
    ILNDNYISIKVDREERPDVDNIYMTFCQAVTGSGGWPLTIIMTPDQRPFFAGTYFPKKRMYGRPGLIQILNQIADEWEIN
    KNNIINSSDELLKTLKEHEAQDKSGEINEEVLQDAIEEMKYYYDDVYGGFGIAPKFPTPHKLMLLLTYYKEYNDKNVLHI
    VEHTLKCMYKGGIFDHIGFGFSRYSTDEKWLVPHFEKMLYDNALLAYVYTEAYQLTGKSFYKEVAEKIFTYILRDMTSPE
    GGFYSAEDADSEGVEGKFYLWKLNEIENILKEDYKKFCNTYDITRVGNFEGSNIPNLIGKDIENIDKLEYIREKLFQIRE
    KRIHPFKDDKILTAWNALMISALAYGGRVFENKEYIKRAKDAYDFIKNNLIRKDGRLLARFRYGEAAYIAYLEDYSFLVW
    ALIELYEATFESKFLKEALYFQDEMIKLFWDEKSYGFFHSGKDGEKLILNLKDSYDTAIPSGNSVAAMNLIKLSKITGYN
    SLVEKAYKMIKGFGGNIKESLQSHSVFLMAYMNYIRPSRQIIIASNKEDKVLNDMIREVNKKFMPFTTVLLNDGTLEDII
    PSIKNEKIIDNKTTAYVCENFSCNRPVNNVEDFRKLLN

    >gi|118444887|ref|YP_878805.1| putative transporter [Clostridium novyi NT]
    MKKKQIFIGFALLALLILFAGIQYTKDYKLALHLIIGLTIGYVMQRSRFGFAGGIRKLYLTGDGTLTKALMFLFSITLIV
    TAAIHYGAYVNGAEVFYKVAGTNAPVIPGSDYVEPANLATILGGILFGIGMMFGGG
    CASGTLTDAGEGQGRGLIVLFFFC
    TGALWGAHDMPWWKESIFFRIHKQLYLPDVFGYMGTIAISLLGFLIIYIIASKYQDKRRRENTLALEQYEKWEEEMPESK
    EYKFFSKETYHKFFVKRWSFYTGAVCIMLMFVTILVTTGTSWGVTAVFADWAAWFYQGLGIIDVSNWPWFASRMDGIRGG
    FFNDPGSMRNAGILIGALLCPLLAGHYKFNRHFKLRDVIYYALGGLLMGYGARIALG
    CNVGALYSGICNMSLSGWVFLPS
    LTLGGILGVRLVKKLKVTI

    >gi|118444548|ref|YP_878806.1| pyridine nucleotide-disulphide oxidoreductase family protein [Clostridium novyi NT]
    MSRKFLIIGGVAGGASTAARLRRLSEEDQIIMFERGPHVSFSNCCLPYHLSGVVEEAQNLVLMSPEKFLAQYNIEARVNN
    EVIAIDKDNKEVTVKNVLTGEEYKESYDKLMLSPGAKPIVPNIKGIEDVNVFTVRNVVDIDKLNNFVKAMETKNVSVIGG
    GFIGIEVAENLKEAGYNVTLIEAMPQVMKIFDYDMVQILHKELYDQGVNLIVGDKVSSFEKDTVVLESGKKVEAGAVVMA
    IGVTPETELAVKAGLELGVTGAIKVDQNYRTSNSDIYAVGDAIEVYNALTGKMMKLPLAGPAQKQAREAADHMHGMLVKN
    TGYIGSSVIKCFDYNGASTGLTEGMIKALNLDINYEVVKVIPGDKVGLMPGCEPLHFKLLFEIPTGKILGAQAIGRGNVD
    KRVDIIATAIKFNAKIDDLRDLELCYAPPFGTAKDVVNFAGYVGSNLLRGAFKQVSESDVRDLVQSGAFIIDVREKDEYE
    LSHIKGALNIPLSELRERVNEIPKDKPVYLH
    CRSAQRSYNAVMALQHLGFTNVYNVSGGFMGISFYEYFNDQTTGREKIV
    TDYNFL

    >gi|118444433|ref|YP_878809.1| YeeE/YedE family protein [Clostridium novyi NT]
    MVSIKKALKRPWPYWIGGILLGILNVVLLALSGISWQITSGFLLWAVGILQWFGFQPLRWQYFSHFRYYYDSIIINNNVF
    FNKYTILNLGVILGALIATLLASQFKWKKIKSKRQLILALIGGIMMGYGTRIAFG
    CTVGSFFSGIPSFSLHAWIFGIFVI
    LGAYVGTKILIKFFT

    >gi|118444890|ref|YP_878811.1| putative transporter [Clostridium novyi NT]
    MIPNEIDKLINKRKVNYKKKKNNQIIYAILLILIAIILGLVLWKNNHEYIACWFIGILIGITIRYSRFCFAGAFRDPFLI
    GNTKLIRSVLLGMMISTPGFAIIQYLYLNKNFMIYERIPGTVDPAGIHVAIGAFLFGVGMILAGG
    CSSGVLMRIGEGHLL
    QWIVLLGFLIGTILGAKDFPFWQTRVMNYGKVIYFPEYMDLKVVTIIQEIVLVVLYKVANLYENRY

    >gi|118444967|ref|YP_878935.1| Fe-hydrogenase large subunit family protein [Clostridium novyi NT]
    MKFETELNRVKYEVLKEVAILAKEDRLDKENVENISYNLIKGDKPQYRCCVYHERAIVKERAKLVAGYIPNGDSPKYIKQ
    DDNDGKIMYVIEAACDRCPINKYTITEACRG
    CVQHKCMEVCPVKAITKINGRAYINQDVCRECGMCKQVCPYNAISEVMR
    PCKKVCPTEAICISPQDRRAEINDEECISCGACMKACPFGAISDKSYIVPVVEAIKNNKKVYALVAPAITGQFGPKVTVG
    QVKDGLKKAGFVDMIEAACGADAVTCHEAEEFVERMEKGDNFMTNSCCPAFVSYIEKKFPDQVEKISGTVSPMIATGRWI
    KKKEEDAIVVFVGPCTAKKSEIGREGLKDAVDYVLTFEEIAAIFGAYNVEVEECEDLEVEDASALGRGFAQGGGLSAAVE
    NYISSKNIEVEFKPVKISGHQNLRKFMMLAKNNKLPGNFFEGMMCEGGCIGGAASTAPQMKTKMALNKFVKESKKQQVID
    NDKLDEYKDIELER

    >gi|118444977|ref|YP_878951.1| sarcosine oxidase alpha subunit [Clostridium novyi NT]
    MEDVTVYQYDVVVIGGGTAGLSAAIKVKESGIDSILILEREDCLGGILNQCIHSGFGINVFNEELTGPEYAERFINKVKE
    LGIEYRLNTCVFDFNDDKIVTAVSKEGIIKIKAKAIILAMGCREKPRGLINIAGRKSAGIFTAGCVQKFINLEGYMPGKD
    IVILGSGDLALRMAKRLKLEGANVKAIVEVLPYAEGKEELVKECMEDFKIPFIFSHTVTYVNGKERIDSIIISEVDNDRN
    IIKGTEKEIQCDTAVLSVGLIPDNEVAKKAGVDISVSTKGIRVNKYMETNIEGIFGCGNVVFNNNGIDDIACEGVKAGEN
    VALYIKKQNEKPKG