Clostridium ljungdahlii DSM 13528 uid50583

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|300853949|ref|YP_003778933.1| hypothetical protein CLJU_c07610 [Clostridium ljungdahlii DSM 13528]
    MLTLKCNAKLDGTFKVCAKVGNHEYIMDHSIENGGKDEGAIPGQMLLVALAGCKLMVISSYAQKRRITLEECEAQITGDF
    DEIKNGIGLNIKVDILVKTDADDKEIKKMNDFVDKN
    CSIAAILSQPNIVEGQIKRKK

    >gi|300854055|ref|YP_003779039.1| putative oxidoreductase [Clostridium ljungdahlii DSM 13528]
    MNTVSITIDGYTLQVDSEKSILSASLEADIYIPHLCHHPDLPDIGACRLCVVEIEGCDEIKTACTTKVEDGMIIHTKTEK
    LNAMRRLSMELMLANHVDDCTT
    CPKYLKCELQSLIQYLGVSTSRLRRTLNSVPVNTSNPLIVRDLNRCISCGRCVRMCKE
    VRGVNVLNYEITEDDRIMVDIRKHNSLKEENCRFCGACVEVCPTGALQDKEGVFKENLNRELNLIPCKAECPANIDVPKY
    IRYIREGKYQDAIAVIREKAPFPHSLGYVCMAFCESACRRKEINKALSIRELKRFAAEHDEGLWRDKVTFKPKTNKKIAV
    VGSGPAGLTAAYYLAKCGHEVTVFEKSPVAGGMMSTGIPEYRLPRKAVQDEIAEIERAGVIILTNTEITSLENLKTKGFD
    KILLAIGTGKGVRLPIPGANYKNVYENIEFLQSVSLKRPLTVGEKVVVLGGGNVAFDCARVAKRLGAKDITMACLENRES
    MTASDDEIQQGSEEGIKILNSRTFVSIEGSCNIAAGVKCQEVASFSFDENKRLKLEIAPDSEHIIPADTVIFATGQRAEI
    PEKWNIPTGRGNSIITEDGMKISDSDMYAVGDAVYGTNSVIRAIAAGRKVASAIDIELGGDGVIEDKLTEDIVPNSYIGK
    DENFLSIERAKNECEDVQSRIKNFKEVNHCLNETSACKESNRCLQCDLRTQIRKPKLWAQYKVK

    >gi|300854095|ref|YP_003779079.1| anaerobic-type carbon monoxide dehydrogenase FAD/NAD-dependent oxidoreductase subunit [Clostridium ljungdahlii DSM 13528]
    MSGLTIKIFFHTKYVIIGASAAGINAAKTLRKLDKSSKITIISKDDAVYSRCILHKVLEGSRNLETINFVDPDFFEKNNI
    EWIKDADVSNIDIDKKKVLLQDNSSFKFDKLLIASGASSFIPPVKNLREAKGVYSLRNFEDVTAIQDKLKSTKRVVILGA
    GLVGIDALLGLMVKNIKISVVEMGDRILPLQLDKAASSIYEKLLKEKGIDVFTSVKLEEVVLNKDGFVSKAVLSNSTAID
    CDMIIVAAGVRPNVNFIKDSRIKVEKGIVIDKHCKTTVDNIYAAGDVTFTAPIWPIAVKQGMTAAYNMVGINKELNDTFG
    MKNSMNLFNLPCVSLGNVNIADESYAVDTLEGDGVYQKIVHKDGVIYGALLVGDISYCGVLGYLIKNKVNISNIHKNIFD
    IDYSDFYNVEEDGQYSYQLR

    >gi|300854270|ref|YP_003779254.1| putative SAM-dependent methyltransferase [Clostridium ljungdahlii DSM 13528]
    MKWNSNLYDNKHSFVAEYGKPMINFVNVGKEQKILDLGCGTGVLTNELAKNGATVIGIDLSKNMIGKAKSNYPNLIFQVE
    DATSLPFKNEFDTVFSNAVFHWISNQEKLLHSVYTCLKDNGTLICEFGAQNNISQIQTAFEKVIEQKGYSY
    CSPFFFPSK
    EEYKLLLDQAGFEVKHIIEYDRPTPLADEEKGLRNWICQFFTSDLLEFSDEQKEQILLETEKLCKNSIWKNNQWVADYRR
    IQIIAVKNKNNRTK

    >gi|300854326|ref|YP_003779310.1| electron transport complex protein RnfA [Clostridium ljungdahlii DSM 13528]
    MASYLTLFISAVVVNNYVLTRFLGLCIFFGVSKNLNASVGMGMAVTSVITMSSILAWVVYHFVLIPFNLTFLKTVVFVLL
    IASFVQLLETIIKKQAPALYNMWGIYLLLIATN
    CIVLAVPILNADSNFNFLQSVVNAIGSGLGFAMAIILMASLREKLRL
    ADVPKPLEGLGVAFILAGMLALAFLGFSGMISI

    >gi|300854560|ref|YP_003779544.1| putative transcriptional regulator [Clostridium ljungdahlii DSM 13528]
    MNIQIFGVKKCFDTKKAERYFKERRIKYQFIDLNIKEISKRELQSLKAAVGIDNLINNRVKEYDKLNIGLIRSGDIKEEI
    LLKNPKLYKTPIVRNGKQATVGYEPSIWSKWE

    >gi|300854657|ref|YP_003779641.1| NADH dehydrogenase [Clostridium ljungdahlii DSM 13528]
    MDKIKSFEDLKALREKYKAKIANRTYDNADKNIKKTLLVCGGTGCRASRSLDIVNILKTEIKNAGLENTVDVISTGCFGF
    CEKGPIVKVVPDNVFYVEVNTERAKLIVYEHMAKNTVVDEALYRDPITKEKISKQTDIPFYKNQERIALRNCGLLNPEDI
    TEYIAMNGYEALGRVLTQMTPDSTIDEIKKSGLRGRGGGGFPTGVKWEMTRKSKSDTKFMICNADEGDPGAFMDRSILEG
    DPNSVLEAMAIAGYCIGANKGYIYIRAEYPLAINRLKIALKQAYNLGLLGDNILGTNFSFHIDLKYGAGAFICGEETALI
    NSIEGGRGEPTVKPPFPSQIGLWKKPTNINNVETLANIPPIILKGSKWFSSIGTEKSKGTKVFALAGKINNVGLVEVPMG
    ITLREIIYNLGGGIRGGKKFKAVQTGGPSGGCIPADHLDTAIDYESLTEIGSMMGSGGMIVMDEDNCMVNIAKFYLQFSV
    DESCGKCTACRIGNKRLLEILEDITKGKGTMEHLEGLKDLSYVIKDSAL
    CGLGQTSPNPIISTMKFFWDEYVAHVKDKRC
    PAGVCTALLKYNINSEKCIGCTACTKVCPKGAISGEIKKSHVIDKSKCINCGACSSTCKFSAITKE

    >gi|300854968|ref|YP_003779952.1| methylated-DNA--protein-cysteinemethyltransferase [Clostridium ljungdahlii DSM 13528]
    MNNGFYYETKIGKIGIVENGKAITHITFGKMNFQDICINETSLLKNAGNQLQEYLEGKRKKFDLPLEPQGTEFQKKVWDA
    LQDIPYGKTFSYKDVAQNIGNIKACRAVGMANNKNPIPICIP
    CHRVIGSNGKLVGYAGGLHIKEKLLEIEKQNADS

    >gi|300855044|ref|YP_003780028.1| hypothetical protein CLJU_c18640 [Clostridium ljungdahlii DSM 13528]
    MNLTSTPNRLINEKSPYLLQHAHNPVNWYPWGDEAFKKAKSEDKPIFLSIGYSTCHWCHVMEKGSFEDTEVAEMLNDSFI
    SIKVDREERPDIDSIYMNVCQSITGSGGWPLTIIMTPDQKPFFAGTYFPKNNRDGLMGLMSILDYIKKAWKNNRSELLNA
    STQILDSLKNSNETSNETINEDIFQKTFLNFKYDFDPTYGGFGDFPKFPSAHNLLFLLRYFYKTKDSSALEMVEKTLDCM
    RKGGIYDHIGFGFSRYSVDRKWLVPHFEKMLYDNALLIIAYIETFQATGNKKYCKTAEEILSYVLRDMTSNEGGFYSAED
    ADSEGEEGKFYVWSEEEIKDILQEEDSGKFCSYFNVTKGGNFEGKNILNLINSSIPEDDMQFIENCREKLFAEREKRIHP
    YKDDKILTSWNGLMIGAMSIAARVLNNSKYTKAAKKAVDFIYKNLVKSDGRLLARYRDGEASFLGYLDDYSFLIWGLIEL
    YETTYSTDYLKKALELNEDLLKLFWDKENGGFFLYGNDGEKLITRPKEIYDSAIPSGNSVATLNLLRLSHLTSSYDFEDK
    AKQLFDAFSREINSFPRACSFSLISLLFSKSPIRQIIVSAGSNIEEGKQVVHMINEKFNPFTISILYCNLNKDLSTISPI
    IKNYIDINNKTTTYICENFTCKKPITDINLLRKIL

    >gi|300855107|ref|YP_003780091.1| putative OsmC-like protein [Clostridium ljungdahlii DSM 13528]
    MPLTTVKAVVEKKDGIAVEAHSGGFKVLLDKTKQSGGTNKGMNPAQLLLCTLGGCQAMSIASCADKYGVNIKYLSIELEG
    DMDSNTSPDSSTSRPGYQDIRFNVNIRTDSPENKVKELVEFVEKT
    CPMGDSIRNGVPIEPAKISIEKQMHYMV

    >gi|300855440|ref|YP_003780424.1| putative methyltransferase [Clostridium ljungdahlii DSM 13528]
    MGEIESYWNNRANTYSEMISEDINSFKREAWSKIIKNKAGDNVKALDIGTGPGFFAIIMSQMGYDVTAVDCSTSMLEEAK
    SNTQLAGVKVKFMKGDVENLDLPVESFDLIVNRNVTWTLKEPVKAYKNWFSLLKKSGKLLIFDANWYLRLAKPELEEEYT
    KDIKLAVDMGYDCKTNEKQRSK
    CKDIARNLPLTYELRPEWDKRALTQCGFEKIIIEEDISNKIYTEEEKVAYRTAPMFSI
    CACKY

    >gi|300855547|ref|YP_003780531.1| putative nitrate reductase NADH oxidase subunit [Clostridium ljungdahlii DSM 13528]
    MIYVVIGASASGINGARTLRKLEPDADIILISKDEYVYSRCILHHYISNKRNIDALNFSEKDYFKKYNIKWMRGIAVDKL
    KDKEHEIELSDGSRLSYDKLLIASGASSFIPPVENLRGANNVVGLRNLEDAQKIKDAAKKVKNVVVLGAGLIGIDAITGL
    LGYGLNISVVEMNDRILAVQLDKYAAGRYEDLFRENGVNLKLGVKAEKLLVDEANNPKELLLNTGEIIPCEFVVVSAGVR
    ANTAFLQGSSVKFDKFGLIIDERGKTNIGDVYGAGDVTGRNPIWPTAVKEGIVAASNMAGKKLLMTDFFGSKNTMNFLGL
    ATMSLGNVSVPDESYKQEIETKDGNYKKVIHKDGIIYGAIIQGDLSYAGILTQLIRRKINISAVKKSIFEIDYSDFFNIK
    ENLEYTF

    >gi|300855586|ref|YP_003780570.1| putative methyltransferase type 11 [Clostridium ljungdahlii DSM 13528]
    MKCCNAYESDDMKNITGETLRPGGFTLTDKAVKFCKLSSKDSIMDLGCGTGATLNYLCKKYNISAVGLDPSQKLINKGKK
    IYKNLKFICGKGEKIPFYNAEFNGVFAECTLSLMENLNNVIGDVFRILKPGGWFIITDVYARKPEFIHELHEISVNS
    CMR
    GLHNLDELKSIVKNIGFHVELLEDCSDMLKELMVKTIFTYGSMSIFWNKVSSCSIDGCEFQQLLKNCKPGYFIMIAKKED
    ECYE

    >gi|300855665|ref|YP_003780649.1| putative heavy-metal-binding protein [Clostridium ljungdahlii DSM 13528]
    MKKKIIVEGMSCGHCVNHVKTALEELKGASNVSVDLDSKTALVESSGEIKDADIKSAIEDVGYEVVSIEQV

    >gi|300855666|ref|YP_003780650.1| copper-transporting ATPase [Clostridium ljungdahlii DSM 13528]
    MIKRTLKIEGMTCAACVKAVERASKKLDGVLDANVNLATEKLSVSFDESKVNVQDIQCAIDKAGYKALIDTTNKTLKIEG
    MT
    CAACAKAVERVSKKLEGVYEANVNIATEKLSIAFDASKVNVQDIKKAIEKAGYKALEEEISVDTDKGKKEKEAKSLWN
    RFIISAVFAVPLLIIAMVPMISEKLGYMLPQAIDPMNHPQVFSIIQLLLVLPIMIVGRKYFTVGFKSLFRRSPNMDSLIA
    IGSSAAFIYSVFAVYEIFIGNTNYHLYFESAGTILTLITLGKYLESVAKGKTSEAIKKLMGLAPKTATVIKEDKEIEISI
    DEVEVGNIIVVKPGEKIPVDGEVTEGITSVDESMLTGESIPVEKNPSDKVIGASINKNGSIKYRATRVGKDTALAQIIKL
    VEEAQGSKAPIAKLADVISGYFVPVVMALAIIAALAWYIYGETGVFSLTIFISVLVIACPCALGLATPTAIMVGTGKGAE
    YGVLIKSGTALETAHRIQTIVFDKTGTITEGNPKVTDIVTIPDIDENYLLQLAASGEKSSEHPLGEAIVKEAENRKIELK
    KLQSFKAVPGHGIEVNIENSKILLGNRKLMLESNISLEKLEERSQVLADKGKTPMYVALENKAIGVIAVADTVKEHSKKA
    IDKLHSMGIEVAMITGDNKKTAEAIAKQVGIDRILAEVLPQDKANEVKKLQSENKKVAMVGDGINDAPALAQADIGIAIG
    SGTDVAMESADIVLMRSDLMDVVTAIDLSKKTIKNIKENLFWAFGYNSLGIPVAMGVLHIFGGPLLNPMIAALAMSLSSV
    SVLSNALRLKGFKPSI

    >gi|300855906|ref|YP_003780890.1| glycine/sarcosine/betaine reductase complex component A2 [Clostridium ljungdahlii DSM 13528]
    MSLLEGKKIIAIGDRDGIPGPAIEECVKSAKGEVVFASTECFVCTAAGAMDLEIQQRVIDLTEKYGAENVIVLIGGAEAE
    ASGLSAETVAAGDPTFAGPLAGIALGLGVYHVVEPEVKAEFDPAVYDEQCGMMEMVLDVDEIISEVKPIRDEYSKYNK

    >gi|300855907|ref|YP_003780891.1| thioredoxin [Clostridium ljungdahlii DSM 13528]
    MIILDKETFKGEVLESKGYTLVDYYGDGCVPCQALLPDIEELSVKFEGKVKFCKLNTTKARRLAISQRVLGLPTIVLYKD
    GEKIEEVIKDDATKANIEAMIVKNINA

    >gi|300855908|ref|YP_003780892.1| thioredoxin reductase [Clostridium ljungdahlii DSM 13528]
    MNNIYDVIIIGSGPAGLSAAIYSARARLKTLILERSKVGGQIVITDEVANYPGSIKDATGPSLIGRMEEQVESFGAERKK
    DNIKQVDFTGKIKKLKGEKEEYYAKSIIIATGANPRKIGCPGENELIGKGVSY
    CATCDAEFFEDLEVFVVGGGDSAIEEA
    IYLTKFAKKVTIVHRRDELRAAKSIQEKAFKNPKIEIKWNSVITEIKGDGIVQSAVFKDTKTGELSEYFADEEDGTFGIF
    VFVGYLPTNQLVKELVDIDEAGYIITNDKMETNIEGVFAAGDIREKPLRQVVTAAADGAIAAVQAEKYIENNFEE

    >gi|300855910|ref|YP_003780894.1| glycine reductase complex component B subunit gamma [Clostridium ljungdahlii DSM 13528]
    MKKAILYLNQFFGQIGGEDKADFQPEIREGLVGPALELNKQLKGAEVTHTIICGDNFMGSNEKEAVEKILGFLDGKEFDI
    FFAGPAFQAGRYGNACGVICKAVKEKFNVPVISSMHIENPGVEMFKKDVYIFKGGNNASRMRKDVKAMADFGNKILNGEK
    LLSAEEEGYYGRGKRHQVWLESGKPAADRVVEMMIKKLNGEKFETELPIPKMDRVPIAPAIKDLSKATIACVTTGGIVPV
    DNPDRIQSASATRWGRYDISNLDDLEGGVFKTIHAGFDPAAADADPDVIVPLDALRAYEKEGKIGKLHEYFYSTVGTGTT
    QGEAARMAKEIIVHLKEADVNAVVLTST
    CGTCTRCGATMVKEIERAGFPVVQMCNLIPVATTVGSNRIVPTISIPYPLGN
    PADSKEHQWKLRYHRVGVALDALATDIEEQTVFKVKI

    >gi|300855951|ref|YP_003780935.1| glycine/sarcosine/betaine reductase complex component A2 [Clostridium ljungdahlii DSM 13528]
    MSLLEGKKVIAIGDRDGIPGPAIEECVKSAKGEAIFVSTECFVCTAAGAMDLEIQQRVKDLTEKYGAENVIVILGGAEAE
    ASGLSAETVCAGDPTFAGPLAGIALGLGVYHAVEPEVKAEFDPAVYDEQCGMMEMVLDVDEIISEVKTVRDSYSKYNK

    >gi|300855952|ref|YP_003780936.1| thioredoxin [Clostridium ljungdahlii DSM 13528]
    MVILDKNTFKDEVLETKGYVLVDYFGDGCVPCQALMPDVEELSKQYGNQVKFCKLNTTKARRLAISQRVLGLPTIVLYKD
    GEKIEEVVKDDANKENIEAMIKKHINI

    >gi|300855953|ref|YP_003780937.1| thioredoxin reductase [Clostridium ljungdahlii DSM 13528]
    MNNIYDVIIIGSGPAGLSAALYSARAKMKTLLLERSKAGGQIVITDEVANYPGSIKEATGPSLIARMEEQVESFGAERKK
    DEIKEVDFTGKIKRLKGIKEEYQAKAVIIATGATPRHIGCPGENQLIGKGVSY
    CATCDAEFFEDLEVFVVGGGDAAIEEA
    LYLTKFAKKVTIVHRRDELRAAKSIQEKAFKNPKVEIMWNKVITELKGDGLLESAVFKDTKTGEINEYFADEEDGTFGVF
    VFVGYLPINGLFKDKITMNKAGYIITNDKMETNISGVFAAGDIREKPLRQVVTAAADGAIAAVEAGKYIENNFEE

    >gi|300855955|ref|YP_003780939.1| betaine reductase complex component B subunit gamma [Clostridium ljungdahlii DSM 13528]
    MKKAILYINQFFGQIGGEEKADFEPEIREGQVGPALALNALLKDAEVTHTIICGDNFMGSNEKEAVSRILGFLEGKEFDI
    FFAGPAFQAGRYGNACGVICKAVKERFNVPVISSMHVENPGVEMFKKDVYIFKGGNNAGRMKKDMKAMADFGNKILNGEE
    LLWADAEGYYGRGKRHQIWLESKEPAAKRVVKMLIKKLNGEEFETELPIPKKDTVAIAPAIKDLSKANIAVVTSGGIVPV
    DNPDRIQSASATRWGRYDYSKMDRLESGVFKTIHAGFDPAAANADPNVIVPLDALRAYEKEGKIGKIHEYFYSTVGTGTT
    QGEAARMAKEIVEYLKGDKVDGVILTST
    CGTCTRCGATMVKEIERAGFPVVQMCNLIPVATTVGSNRIVPTISIPYPLGN
    PADSKEQQWKLRYHRVGVALDALATDIQEQTVFKVKI

    >gi|300856003|ref|YP_003780987.1| hypothetical protein CLJU_c28340 [Clostridium ljungdahlii DSM 13528]
    MDFLKISDIAYQEFKKFLDENNATSGAIRIYLAGMTCHGPSFNISVDEKKDHDLIQKVKDITFIVDSDLFVQFSGFILLC
    GSENGLGGFTLEPVFKPQTSNCSSCDSCHGCEE

    >gi|300856073|ref|YP_003781057.1| putative cation-transporting ATPase [Clostridium ljungdahlii DSM 13528]
    MNNTMEVKLQDNRKSKNKYIKKEFILEGLDCAHCAAKIENKINEIPEIKNASVDFLSKKLKFELYDEKKFNNTVENIKSI
    VKRLEPDVKVIYEVNEKSRKVEKPKEKSKKIGDIISIVGILIYITGIIFKFSFQVELTLFLLSYIAIGKDVLWKAVKNIS
    HGQLFDENFLMCIASIGAFTIGQFPEAVAVMLFYKIGEYFQDRAVNNSRKSIADLMDIKPEFANVKTKSGLKKMKPEDVN
    IGELILVKPGEKIPLDGEIIEGKSMVDTSALTGESLPKEVGREDVVLGGYINENGVLTLKVTKSFKESTVSKILDLVENA
    SSKKAPTENFITKFARYYTPAVVAFAIGLALLPPLMGGESFSKWIYRALVFLVVSCPCALVISVPLGFFGGIGAASKNGI
    LVKGGNYLEALNSIDTVVFDKTGTLTKGIFKVTQVKAFNGFTDEDVLKYAAFVESYSNHPIALSIVKQYNQDIDRNLIKD
    YAEISGEGIKAAIDGREIIAGNTRLMEKEKINYDISEVIGTVIHVALDKIYMGYIVISDEVKEDSKDTIRMLKDIGIKKT
    VMLTGDNKKIGEAIGYKLGLDEVHAQLLPDQKVEKLNDIITEKSSNRKMIFVGDGINDAPVLARADVGIAMGGIGSDAAI
    EAADVVIMTDEPSKIVTAIKIAKRTKKIVFQNIVFALGVKLVILVLGAVGIANMWEAVFGDVGVALIAVLNSMRAMKVEK
    A

    >gi|300856115|ref|YP_003781099.1| putative FAD-dependent pyridine nucleotide-disulfide oxidoreductase [Clostridium ljungdahlii DSM 13528]
    MKKIVIVGGVAGGASAAARLRRLDENAEIILFEKGEYISFANCGLPYYIGETIKEREKLLVQTPEAMKASFNIDIRVNSE
    VITVDTKSKKVRVSSKDKGEYEENYDYLILSPGATPIKPPIPGIQSDKIFTLRNVPDTDKIKAYVDKENVKNAIVIGGGY
    IGVEMAENLKERALNTALVEAAPHILAPFDSEMVTFAEKELEDNGVGIVLNDGVKEFKEDGTGVNVILNSGKILYADMII
    LAIGVKPDTAFLKDSGIEFGTKGHIIVNNKMETKVEGVYAVGDAIEVVDFVNESKTAIALAGPANKQGRIAADNICGLNS
    IYKGTMGTAIIKVFGLTGSSTGNNERTLKSKNIQYKAIYLHPNSSAGYYPGAAPMTIKLIFNDEGKILGAQAFGYAGVDK
    RIDDIAITMRLGGTVYDLTELELAYAPPYSSAKDPVNMAGFIAENVLTGKDEIILTEDIDNRDKDKTQLVDVRTELECSN
    GIIEGAINIPSEDIRARMNELDKSKEILIY
    CQVGLRGYIVARILRSNGFKVKNLTGGYKTYTMGKFKPRDVVMNNSGEGG
    SMDLRGKKSNVSLESNLNEYKEADEAYKKGDFDKNLDACGICCPGPLMRVNSNIQDMKEGEVLKVTASDQGFYEDIKSWC
    ERTNNELLDRKKEKGNIIAFIKKGNKKQAVSNSNSVNNGTIAQKDNKTLVVFSGDLDKALASFIIANGAAAMGKKVTMFF
    TFWGLNILRKHEKVSVSKGFMDKMFGFMMPRGAKRLKLSKMNMLGMGTKMMKMVMRNKNVSSLDELIKAAIDSGIEIVAC
    QMSMDVMGLKQEELIDGVKVGGVGYYLGEAEDSNVNLFI

    >gi|300856121|ref|YP_003781105.1| putative redox-active disulfide protein [Clostridium ljungdahlii DSM 13528]
    MEIKILGTGCSNCKKLEANAREAAKEFNGDVKITKVEDIKDIMKYGVMRTPAIVINEKVKMVGKVSGVDEIKKYINDEK

    >gi|300856192|ref|YP_003781176.1| putative oxidoreductase [Clostridium ljungdahlii DSM 13528]
    MVNIIIDGKEITVPQGVSVLEAALQNGIYIPHLCHHPDLPELESCRLCIVEVQGREGVFTSCTLKVEDGLNICTKSEKID
    HLRKLAMELLLAAHPEDCST
    CPKYGRCEFQTLIQYMEVSATRMRTRVKGFQSNEKNPLLIHDMNRCVLCGRCVRACNDLR
    GVKVLQYNKKDMETYVGTLQDKLLKDSDCCFCGACAEVCPTGTIRDMLNYSPIEKRDTLIPCEATCPVRTNIPKYLRFAK
    EGKFAEATAVIHEKLPFPECLGRVCAHSCESKCRRGEVNEAVSIRDIKRFAAEHDNNKLWKKNSKHLPSTGKTVCVVGGG
    PAGLAAAFYLAKQGHEVVLKEAYPRLGGQMQYGIPSYRLPREIVDKEANYVKEVGVKVELNTRVEKPKELLEKFDVVLMA
    IGTHNGVRLPMEGNELNGITVNTEFLRKASMGEDTGIGKHVIVLGGGNVAFDCARTAKRLGAEEVHLACLEKREVMLADD
    EEILQAGEEGIFVHPGQTFERIVGDDKVTGAAFCNVKNFYFDENRKAIIEKEPNSEHIINADTVIFAVGQRTAINEDAGL
    KLGRGNSIAVEIGKSAKTSVEGIFACGDAVYGTKTVIEAVASGRAAASEIDRFLGGDGDISEVLAPEEQKLSNIGRIEGF
    GYLRRAKEDIVQADKRKNNFNDVNKGLCNDDICSEAGRCLQCDLRFDITKHRVWSDYSISNEVEVNKNAN

    >gi|300856866|ref|YP_003781850.1| putative iron-dependent hydrogenase [Clostridium ljungdahlii DSM 13528]
    MKDFETPLKKLKYLVLKEVSSLTRENKLTEKELKKIPYKIICGDKEEYRCCVYKERAVVYERALLASGFVPTYNTTLDLK
    KIVDREYIMYVLSAACDKCPIYKYRVTEACRG
    CIQHKCMEVCPAKAISKVDGRAHINQDICKECGMCKKVCPYNAIAEVM
    RPCKKSCPTGALEINSKNRMAMIEKEKCINCGACMAACPFGAVSDRSYISEVTKALMGENKVYAVVAPAITGQFGCKVTV
    GQVKDAFKKIGFEDILEAACGADAVTVNESNEFVERMKNGDKYMTNSCCPGFMGYIEKEFPGEVVKISGTVSPMIAAARA
    IKNQDKNAVVVFVGPCTAKKSEITRESIKGAVDYAMTFEEIAALFGAFDVDPENCEDVPIDDASVYGRGFAQGGGLTAAI
    ENYIGEEKIDIQFDPVKVSGKDEIKKAMTSAKIGRLPGNFIEGMMCEGGCIGGPATMISSMKARGQLIKFSKQSHKKSVL
    SNEKLEEFKDVDLER

    >gi|300856904|ref|YP_003781888.1| dihydrolipoamide dehydrogenase [Clostridium ljungdahlii DSM 13528]
    MKLVVIGGGPGGYVAALQAAILGADVTVVEKKAVGGTCLNVGCIPTKALLASTDVLSVIKGASKFGINVEGEAKPDFDAI
    MKRKDKVVDQLVKGIEYMFEHRGVKLIRGTGKLISNKEVEVTKQDGSKESITADKIILATGSVPVTPGVFKYDGKKVITS
    DEVLNLEKLPKSMILVGGGPIGCEIGFFLNSMGVEVKVVEALPHLAPLEDEDVAKQLQRIFKQHKIKYFVGDGITSVEVK
    GDTVTATLGSGKVLEAETLLIAVGRRAYAEGLGLDDIGIEKDQKGRIIVNEYLETNVEGVYAIGDLIPTAALAHVAEREG
    IVAVQNAVLDKKKKMSYKAVPGCTFVEPEIASVGMKEKDAEKAGIQYKVGKFDFRGLGKAQAMGKLQGFVKIITDEKDVI
    IGAAIVGDRATDMISELGVACELGLTAERVGEVIHPHPTLSEAMMEALHDVHKQCVHSVD

    >gi|300857167|ref|YP_003782151.1| putative OsmC-like protein [Clostridium ljungdahlii DSM 13528]
    MAITTFKATTRRKKGLAVTAEARGFNVDIDEPESLGGSNTGMNPVELVLCALGGCQTILASSFAEKMKINLEDFWIELEG
    ELDPDGFMGLSDVRPGYQSVRYNMHIKSDASEEKIRKFIELIEKRCPVGDTIGNVVKLEKAKITIEK

    >gi|300857191|ref|YP_003782175.1| thioredoxin reductase [Clostridium ljungdahlii DSM 13528]
    MDTRYDIAIVGSGPAGLSAAINAKIRNKNIIVFGSSELSGKLIKAPKIDNYLGLPGITGIQLKDRFQQHVANMGINITYE
    RINTIYAMGQYFGVAVNEKMYEASAVILATGIEYTKALKGEEEFLGRGVGY
    CATCDAPLYRGKVVTIIGYNKEAEAEANY
    VNELSKKTYYIPMYKESLNLSENIEVVRDKVVEISGGNKVEKVILKSKEIVTDGVFVLKDSIAPDKLVPGLIMENGHIKV
    DMDMKTNIEGCFAAGDCVGRPYQYMKAAGQGQVAALNAVFYIDKN

    >gi|300857192|ref|YP_003782176.1| putative thioredoxin [Clostridium ljungdahlii DSM 13528]
    MVEEIKDQDFSQSIENAPTPVVVDFWASWCGPCKMLSPIIEEVSDELGEKAKFFKLNVDENPVTAAQFKIASIPTVMVFK
    NGNMVDKFVGFRPKDAIKDALKKHI