Clostridium kluyveri NBRC 12016 uid59369

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|219853438|ref|YP_002470560.1| hypothetical protein CKR_0095 [Clostridium kluyveri NBRC 12016]
    METPYTCFYSSPIGTMKIDSDDIGINSIVFLNYEPEITTNNNYSIHIKNCITQLDEYFRGTRKNFSIKLHISGTPFREKV
    WKELLKIPYGHTCSYYDIANSINNKNAVRAVGGANHHNKISIIIP
    CHRVIGKDGNLTGYGGGLWRKKWLLEHEQKYN

    >gi|219853604|ref|YP_002470726.1| hypothetical protein CKR_0261 [Clostridium kluyveri NBRC 12016]
    MVEEIKDINFSESVKESSTPVVVDFWASWCGPCKMLSPVIEEVASELEGKAKFFKINVDENPVTAAQFKIGSIPTVMVFK
    DGSVVEQFIGFRPKDTIKDVLEKHI

    >gi|219853605|ref|YP_002470727.1| hypothetical protein CKR_0262 [Clostridium kluyveri NBRC 12016]
    MEHRYDIAIIGSGPAGISAAINAKIRNKDIIIFGNEELSDKLIKAPKISNYIGLPDITGLELKSKFQNHLDVMGINITFE
    KINSIYAMGQYFALAVNEKMYEAKAVVLATGVEYTKPLKGEQEFLGRGVGY
    CATCDAPLYKDKTVTVIGYNKEAEKEANY
    VSELASKVYYIPVYRENPNLKDNVEVIQDKVLEIYGTDKVERVVLKYKSISTDGVFVLKSSIAPDQLMPGLILETGHIKV
    DVNMRTNIEGCFAAGDCTGKPYQYMKAVGQGQIAALNAVSYLDK

    >gi|219853637|ref|YP_002470759.1| hypothetical protein CKR_0294 [Clostridium kluyveri NBRC 12016]
    MKKIVLAGGCFWGIQAYFDNKKGILSTKVGYANGNGENPSYEEVCNEDTGFAEACLLEYNAGVITLEELLELYWRIIDPT
    IVNRQGNDMGNQYRTGIYYIDEEDVEIIEKSREKQQKNYNKKIVTEILPLKNFYDAEEYHQKYLEKNPGGYCHIPGELME


    >gi|219853652|ref|YP_002470774.1| hypothetical protein CKR_0309 [Clostridium kluyveri NBRC 12016]
    MAKNFFSKVYDLVARIPRGKVTTYGQIAFMLGEPRSARIVGWAMRKAPSHLPCHRVVKKSGELSPDYVFGSSDIQRALLK
    SEGIIFKKDGHIDMKKYLWDGR

    >gi|219853656|ref|YP_002470778.1| hypothetical protein CKR_0313 [Clostridium kluyveri NBRC 12016]
    MILDADIKSQLAQYLNLMEGDILLKVSAGSDNTSNDMLTLINEIAGMSSKIKVEKVTLQRTPSFSINRPHEDTGVIFAGV
    PLGQEFTSLVLALLQTSGRAPKVDSEILEQITNVKGNYNFETYASLS
    CHNCPDVVQALNLMSILNPNITHTMIDGAVFKK
    EVEDKNIMAVPSVYLNGNHFNSGRMTLTDILSKIGSSTKPSEIFNKTPYDVLVVGAGPAGATAAIYAARKGIRTGIIAER
    LGGQVTDTVGIENFTGTKYIEGPKLSANLEEHIKEYNVDIITSQYAIGLKKKELIEIQLKNGTLLKSKTVILSTGASWRN
    VGVPGEKELKNKGVTY
    CPHCDGPLFKGKNTAVIGGGNSGIEAAIDLGGIVNHVTVLEFMPELKADDVLQKRLNSLSNVTV
    IKNVKIKEITGIDKVNGITYADRLTGEKHHIELQGVFVQIGLIPNTDWLDKTITRNSRGEIVVDSHGATDIPGVFASGDC
    TNSPYKQIIISMGSGATAALSAFDYLIRS

    >gi|219853657|ref|YP_002470779.1| hypothetical protein CKR_0314 [Clostridium kluyveri NBRC 12016]
    MSLIGTEVKPFKASAYHNGKFIDVTEADFKGKWSVVCFYPADFSFVCPTELEDLQNNYETLKSLGTEVYSVSTDTHYTHK
    AWHDSSQTINKITYTMIGDPSQTLTRNFDVLIEEQGLANRGTFIIDPDGIIQAVEINAGSIGRDANTVVSKIKAAQYVRN
    NPGEVCPAKWKEGSSTLKPSLDLVGKI

    >gi|219853720|ref|YP_002470842.1| hypothetical protein CKR_0377 [Clostridium kluyveri NBRC 12016]
    MRKKILIVGGVAGGASTATRLRRLDENAEIIMFEMDEYISFANCGLPYYIGNTIKDRERLLVETPEGMKGKFNIDARINS
    EIIDIDVNKNTVKVKSKDLGTYEESYDYLVLSPGGKAIRPNIEGINSKRILTLRNIPDTDNIKSLVDRENIQSAAIIGGG
    FIGIEMAENLKERGLDVTLIEAAPHILAPFDSDMVTALEKELEDNGVNIILNDGVKSFKDNEEKVEITLDSNTKVTADLV
    ILAIGVAPNTNFIKDSGINLGTKGHILVNNKMQTNIKNIYAVGDAIEVIDFINGNNTAIALAGPANKQGRIAADNICGVD
    STYDGTQGTAIIKVFSLTGASTGNNERTLKKFNIPYKVIYVHPTSHASYYPDALPLSLKLIFNQEGKILGAQSTGYDGVD
    KRIDIIAAVIRLGGTVKDLTKLELSYAPPFSSAKDPVNMAGFVAENILSGKVEVITPEEFLNYNKENTLILDVHAKIEFE
    NQHIEGALNIPLDELRNRLEELDKNKEIIAY
    CKVGLRSYTAARILSQHGYKVKILAGGYKSYKLLNFKPKKFDNTKVFTG
    KKSNSNNQTISLKFDLEEPSYNKSVNACGLSCPGPLMQTKSSIDDLEQGEILKVTASDPGFYEDIKAWCRRTDNDLISLS
    KNNCNVTAFIKKNDELNSKNANAYKISYNDNKTIVVFSGDLDKALASFIIANGAASMGKKVTMFFTFWGLNILRKPEKVP
    VKKQFMDSMFGKMMPRGSKKLKLSNMNMLGMGTKMMRKVMKDKNISSLEDLIKSAMDSGIEIVACQMSMDVMGLKKEELI
    EGVKLGGVGYYLGEAEDSNVNLFI

    >gi|219853731|ref|YP_002470853.1| hypothetical protein CKR_0388 [Clostridium kluyveri NBRC 12016]
    MEVLYVEKYDLVIIGGGPAGLSAAVTAKEEGVDNILILERENQLGGTLNQCIHSGFGFSIFKEELTGPEYVEKSIEKVKD
    IKIPYKLNTTVFNLTRNKIITAVNEEEGIIEIKAKSIILSTGCRERPWGIMNISSSK
    CAGILTAGSAQRFINIEGYMPGK
    EVVILGSGNIALIVARRITLEGGKVKAVIEPLSYYSGLKKNIVQCLYDFKIPLRLNHTIVDIKGKGRVEGVTISKIDRNK
    KIIKGSEEHIPCDTVVLSVGLSPENELLRSAGIKISNITGGPLVNESLAASIDGIFTCGNVLYIHNLVDNIILESINAGK
    NAAAYIQGKKFNGSKIKILALHGVKYTVPQYINIENVDKTINIIFRVTNLFRDKFISVYFDGVREMHIKKKMLTPSEVEE
    VKFTKELLGKYPKCRQITISVQKD

    >gi|219854056|ref|YP_002471178.1| hypothetical protein CKR_0713 [Clostridium kluyveri NBRC 12016]
    MKDEILKIEGMSCAACVRAVERAVKKVDGVESAGVNFATEKLTVSFDQSKTTLSDIKTAVEKAGYKALGEIESLDIHEES
    KQKEIQKLKQRFVISAVFTVPLLVVAMGPMIAQQLNIMLPSIIDPMVHQKIFAIIQLLLVLPVMIIGRSYFIIGFKSLFR
    KNPNMDSLIAIGTSAAFLYSFSSIVSMFYNDNHYHYHLYFESAGVILTLITLGKYLESIAKGKTSEAIKKLMNLTPKTAN
    IVQDGKQIEIAIDEVEVGDVVVVKPGEKIPVDGEVIEGLTSVDESMLTGESIPVEKTVGSKIIGATINKNGSIKYKATKV
    GKDTVLSRIIKLVEEAQGSKAPIAKMADIIAGYFVPVVIILALIASVIWYGSGQSMVFAVTIFISVLVIACPCALGLATP
    TAIMVGTGKGAEYGVLIKSGVALEISHKIQTIVFDKTGTITEGKPRVTDIIVSGDIEESYLLQIAASAEKSSEHPLGEAI
    VREAENKSIQFLKIDSFMAIPGQGIEVSIEDSKVFLGNKKLMIEKNISLESVEDISHTLSNEGKTPMYIALQNKLVGIIA
    VADTVKESSKKAIKRLNSLGIEVAMITGDNKNTAEAIASQVGIHRVLAEVLPQDKADEIKKLQGENKKVAMVGDGINDAP
    ALAQADVGIAIGSGTDVAMESADIVLMKSDLMDVVTAIDLSRKTIKNIKENLFWAFGYNSLGIPVAMGVLFIFGGPLLNP
    MLAALAMSFSSVSVLLNALRLKRFKPSISSD

    >gi|219854057|ref|YP_002471179.1| hypothetical protein CKR_0714 [Clostridium kluyveri NBRC 12016]
    MLFKGKIKKVIHVEGMTCQHCVSHVKSALESIKGVSNVKVNLDSNTAVIKSSTEISDSNIEEVIKEAGYEVKGIEKA

    >gi|219854377|ref|YP_002471499.1| hypothetical protein CKR_1034 [Clostridium kluyveri NBRC 12016]
    MNSYLICTCHWCHVMAKESFQDNEVAEILNKYFISVKVDREERPDVDSIYMKVCQSITGSGGWPLTIIMTPEQKPFFAGT
    YFPKNNVGEALGLIAILEYIQKAWKDNKAQLLKEGDSLLDIINTLNKNSSGELSQDILKKAFLEFKQNFDTLYGGFGGYP
    KFPSAHNLLFLLRYFHKTKDAFALEMVEKTLESMYRGGMYDHIGYGFSRYSVDRKWLIPHFEKMLYDNALIAMAYLETFQ
    VTGNKKYAKVAEEIFEYVLRDMTSKEGGFYSAEDADSEGEEGKFYMWSQEEIKDILGQEQGSKFCCYFNVTSQGNFRGKN
    IPNLIGNSILEEDVQFIKNCREKLFKYREKRVHPHKDDKILTSWNGLMIAAMALAGRVLNNSKYTLAAKKSVDFIYKNLI
    RKDGRLLARYREGDSSFLGYADDYAFLIWGLIELYETTYNPEYLKNALELNQNFLEIFWDSENGGFFLYGKDSEKLIIRP
    KEIYDGPTPCGNSAAALNLLRLSYLATSYEFEDKVKQLFENFADEIESSPISCSFSLVALLFSKYPVRQIIISAGENINE
    ARKVLDMINKKYSPFTVSVLYSHLNKELKNICPSIEQYIAIRGKVTVYVCENFTCKEPITNMDLLKEVLSSDS

    >gi|219854507|ref|YP_002471629.1| hypothetical protein CKR_1164 [Clostridium kluyveri NBRC 12016]
    MSAYLTLFISAVIVNNFVLTRFLGLCIFFGVSKNLDASLGMGMAVTSVITLSSMLAWVVYNFVLVPFNLVFLKTVVFVLL
    IASFVQLLEIIIKKQAPALYNMWGIYLLLIATN
    CVVLGVPLINAESNYGFVESVVNSIGSGLGFALAIVLMASLREKLRL
    ADVPKPLEGLGVAFILAGMLALSFMGFSGMISL

    >gi|219854798|ref|YP_002471920.1| hypothetical protein CKR_1455 [Clostridium kluyveri NBRC 12016]
    MSKVIVIGGGPSGMMAAITAANRGFDTTLVEKNEKLGKKMFISGKGRCNITNSKDISEFFDHIPVNSHFLYSSLYSFTNK
    NTFEFFDDLGVNLKIERGGRVFPQSDKSSDLIKAMEKELIKKNVMIRFNSKIKKFISKDNFIRAVQLEDNSIIEGDLFIL
    CTGGMSYPQTGSTGEGYKMAESLGHTITKITPALVPIEIEEDWIKILQGLSLKNIELSIVDSNNNILYREFGEMLFTHFG
    ISGPVVLSSSRVVKNNRNLKAVINLKPALEFQELDRRLQREFLNYSNKSFKNSLGGLLPKKLIGIILDLCNIKLDKKCNS
    ITRDERQDLAGLLQNFTMHIKGLRPIEEAIVTSGGVSVKEIDSSTMKSKIVSNLYFAGEIIDVDANTGGFNMQIALSTGF
    LAGSKIKNVLQI

    >gi|219854883|ref|YP_002472005.1| hypothetical protein CKR_1540 [Clostridium kluyveri NBRC 12016]
    MNIQMFGTKKCFDTKKAERYFKERKIKYQFIDLNQKGLSKRELENVKASVSLNNLINMKVKEYKTLNMDKIRSSSVKEEL
    LLNNPKLYKTPIVRNGKQATIGYEPEVWKNWE

    >gi|219854933|ref|YP_002472055.1| hypothetical protein CKR_1590 [Clostridium kluyveri NBRC 12016]
    MIIKILGTGCSNCKRLEENTKNAVKELGLDATIEKVTDIRDIMKYGIMKTPGLVVDEKVKVFGRVPTAEEIKKYL

    >gi|219854985|ref|YP_002472107.1| hypothetical protein CKR_1642 [Clostridium kluyveri NBRC 12016]
    MAYKYDLIVIGTGPGGSAAALEAAKSGMKTAVIEKDKLGGTCLNRGCIPMKALLHSAGIYQEIKESKKFGIQVEKAELNV
    PALLQYKEGVINKLSYGMEMLLQKNKVDVFYASGKIVNAHQVAVSENGEKKIIEAERIIIASGSSAVIPPIPGIQLKNVV
    TSYELLNKEDLFHHLVIIGGGVIGMEFASLYSAFGCRVTVIEAMNRVLPDMDREIGTNLKQILKKQGVDIHTSASVEKLE
    QTQEEKILCTYREKEKLQHIEVDGVLVAIGRKPSTEGLFDENFAVETEKGKILVNKYYKTSCPSIYAIGDVIGGIQLAHA
    ASSEALCAVRHIIGKEESLDVRVIPGCVYTNPEIAVVGITASQAKETGIDVITKKYPMMANGKSVLTMQERGFMKVVAEK
    ETEKILGAQLMCARATDIISQFTSAIVNGMTLSQMAHVIHPHPTFSEGIGELMRE

    >gi|219855021|ref|YP_002472143.1| hypothetical protein CKR_1678 [Clostridium kluyveri NBRC 12016]
    MVGLLDYSEEQIERYSRHIILSEVGVEGQEKLLNSKILIIGTGGLGAPAAMYLAAAGIGTLGLVDGDNVDLSNLQRQIIH
    ETGDVGKSKVQSGKETVNRLNPDVNVITYNELVDSRNILDIIKDQNYDFIIDGTDNFPAKFLINDACVLSKKPFSHAGII
    RFNGQLTTYIPNNGTPCYRCIFQSPPPAGVVPT
    CREAGVLGVMGGIIGTLQATEAIKYLLNLGNNLAGYLLTYNALTMEF
    RKIKLGKNENCGVCGQHPTIKNLIDYEQAACDLKTGELKG

    >gi|219855315|ref|YP_002472437.1| hypothetical protein CKR_1972 [Clostridium kluyveri NBRC 12016]
    MIKNASLKVYGMTCTLCSTTIECAVSEIEGIDKINVSYAAEKAKFQYDNDKTNLEDIKQKIELLGFSVGEENEKNTDKGL
    TRQEIERNKLRNLFIISAILSTPLIIGMILGTTGFCHNTFDPNSANKWGNTIEILRLKSSQLHNWKFQLTLATIVQFIIG
    FRFYKSSFYALKAKAFTMDLLVVIGTTAAYFYSLYIALFETVTYTLGMVNLYFESSVTIITLVLLGRYLESIAKSKTAAS
    IKALNKLQPKTARILKNNIEHAVPIEKVSIGDILMVKPGEKIPVDGIVLTGYSSVDESMLTGESVPVEKKKDDLVTGASI
    NKNGTFTFKATKVGNDTVFSNIIKLVEEAQESKAPIQKIADKVSGLFIPAVLTVSALTFIIWYFVIFNQQIFIIDIAIIH
    AVSVLVVSCPCALGLATPAALMVGMGKGAENGILIKNGEKLEQCCKINTVVFDKTGTLTTGKLHITDIILFNKKQISSLN
    IIKEKDLMILAAAAEKPSEHPLGEAIYKYGKYNYEDEISTLDYFKYFPGRGITALVDDKKVLIGKETFLTENSVDLLELE
    DNLSKLQKQGKTSVLIAVNNILAGVIAMQDKIKDTSADAIKSLNKKNIEVYMITGDNKNTALSVANKLGIKNIIADVQPQ
    NKAQEISKLKDKGKVVAMVGDGINDSPALATADIGFALGSGTDAAIESGDIVLLKEDLRALPEAIELSRITMRKIRQNLF
    WAFIYNIIAIPIAVTGHLNPVIGAAAMSFSSISVLLNSLSLKRFKF

    >gi|219855340|ref|YP_002472462.1| hypothetical protein CKR_1997 [Clostridium kluyveri NBRC 12016]
    MGCIEVMPKLGLTMTEGQIESWHKSEGEEVKKGEVLFDVTTDKLTNEVEARESGILRKILVKEGETAKCLEAVAIIAGAD
    EDISDLLKESGAEDSEQKKEKQNPEKQENQQKNLSKKVVVIGGGPGGYIAAIRSAQLGHKVILVEKEELGGT
    CLNVGCIP
    TKVLLHSAEVFTEIKNSSDIGIDVGDVSINWGNVQKRKGKITKKLVSGVKGLLSANKVKVIKGIAGFKSKSSIEVVKKDS
    GVEKVDFDDIIISTGSLPFIPPIPGVDLDGVVDSTGALNFESIPDSIAIIGGGVIGIEFATLFSELGSKVTVVEMLPFIL
    PPIDRQISDLVSNKLAGQGVAINTGCRVTEIKRSGNNLKVNFSKENENSSVEAEKVLVAIGRRPNIKDLDVDKIGVKVEK
    GHICVDDKMKTNVDNIYAIGDCTGKNMLAHVASEQGVIAAENISGKNVFIDYKTIPACVYTKPEIASVGITEEQAREKNI
    DYKVGIFPMAANGKSMISGETEGIIKIISHKKTEEILGVHILALRATDLITEGALALRLEATVDEIITTVHAHPTIGEAF
    KEAALAVQKRALNMVN

    >gi|219855368|ref|YP_002472490.1| hypothetical protein CKR_2025 [Clostridium kluyveri NBRC 12016]
    MKREFVLEGLDCVNCAAKIEEKVSKIEGINFANVNFPTKMLTLEIGEINRTKELIEAAKDVVKKLEPDVKIIEKSLHKQL
    RKELLLQGLC
    CGNCAAKIETESNNIKGVKSAMVDFVNTKLILDIENPSKQNDIILKVKEIVKRIEPDANVVEIENKIYER
    KEEHGENSKKKMFILVVGAAIFGIATAFKFSNVIELIMYLITYILVGGEVVLRALKNISRGQIFDENFLMSTATIGAFAI
    GQYPEGVAVMLFYQLGELFQGIAVNRSRKSITDLMDIRPDFANLKIGDDIKRVSPEEVSVGNIILVKPGEKVPLDGKVVE
    GNSMVDTSALTGESVPREVRAGDSILGGVINKNGLLSIKVEKEFGDSTIAKILDLVQNASSKKAPTENFITKFARYYTPI
    VVFSAVALAVLPPLFIESATFSQWIYRALAFLVVSCPCALVVSIPLGFFGGIGGASKYGILVKGGNYLEALNSVEGVIFD
    KTGTLTKGVFRVTEVKSQNNISRDELIAYAAHAESYSNHPIATSILNAYGEEIVKDSIENYEEISGHGVKVMIQGKEVLV
    GNYKLMNKENIIYEQVETVGTVVHVAVDKVYAGYIIISDEVKEDSAKAVKALKDIGIKRIVMLTGDNKTVGTKVAKQLGL
    DEVYTELLPDEKVEKMELFDKEKSSKGKLIFVGDGINDAPVLARADIGIAMGGVGSDAAIEAADVVIMTDEPSKIASAIK
    IARKTRHIVMQNIIFALGIKVILLVLIALGLGTMWEAVFGDVGVTLLAVLNSMRAMKTVNI

    >gi|219855372|ref|YP_002472494.1| hypothetical protein CKR_2029 [Clostridium kluyveri NBRC 12016]
    MMNNKNTFKENSRMNFDKQAENYDDGFDGRFVRVMYDEIIKRIDKFQNGILLDVGCGTGNILSRLYENKKLHLCGLDISN
    KMIEVARRNLNDDILLKVGDAEFIPWPDNTFDIILCNASFHHYPNPQKVLLEMKRVVKADGKLIIGDPTAPPLIRQVLNF
    IFGI
    CHNGDYKIYSLKEMKKLLRRCGFRPFEFKKINYKSFVISASA

    >gi|219855443|ref|YP_002472565.1| hypothetical protein CKR_2100 [Clostridium kluyveri NBRC 12016]
    MVRRLLIMAKVINSSEFEGNVLNSSETVLVDFFATWCGPCKMIAPVLEELSEEMKGKVEMFKVDVDRSAELAQKYGIQGV
    PTLMIFKDGKSVDRIVGFQPKEILKSRLQQY

    >gi|219855491|ref|YP_002472613.1| hypothetical protein CKR_2148 [Clostridium kluyveri NBRC 12016]
    MSNTYNKECLKKKLSSIQYKVTQENETEPPFENEYWDFNGEGIYVDICSGEPLFTSLDKFDSGCGWPSFSKPLVPENINE
    SKDNSHGMIRTEVRSKNGNSHLGHVFDDGPKALGGLRY
    CINSASIKFIPLDDLDRKGYGEYKKLFKTYK

    >gi|219855559|ref|YP_002472681.1| hypothetical protein CKR_2216 [Clostridium kluyveri NBRC 12016]
    MGGIKVKIKKMMLGLLLIATIIVSLAGCGTTAVKNETSKDTAKTKTYTDMAGRKVTLSTNINKIVLIRSMDVYYMSAILG
    QEFDKKVVALGLNFKDSDIDGYKKYSEVFNMDKIKSLGSIYDDAISLESVVNLEPDLIIVDTQFKSKS
    CVNKMIEAGLPV
    VFTDMNSDPFHGVQKSMLMLGEMLGKEDKVEKMVEDANKKTDSVLTRVDKLLKAGTKRPTLYFECGNVTPTEIGGTRGDT
    SDGWGYLWNRLGADNIGVGQGSNPVNPEKVLTADPDVIVIGGANWDQTANIMRMGYYVTKEEASVHLDEYVQKRAGWSDL
    SAVKNGRLYAVHFNYTVYPYNFCGVEAMAKFLFPSEFKDLNPEKDRKEFFDKYMPVKYSGLFSADWK

    >gi|219856553|ref|YP_002473675.1| hypothetical protein CKR_3210 [Clostridium kluyveri NBRC 12016]
    MEIKILGTGCSNCKKLEANAKEAVKELDVEAKITKVEDIKDIMKYGIMRTPAIVINEKVKMFGKICNVDEIKKYINDEK