Clostridium kluyveri DSM 555 uid58885

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|153952772|ref|YP_001393537.1| Ogt [Clostridium kluyveri DSM 555]
    METPYTCFYSSPIGTMKIDSDDIGINSIVFLNYEPEITTNNNYSIHIKNCITQLDEYFRGTRKNFSIKLHISGTPFREKV
    WKELLKIPYGHTCSYYDIANSINNKNAVRAVGGANHHNKISIIIP
    CHRVIGKDGNLTGYGGGLWRKKWLLEHEQKYN

    >gi|153952947|ref|YP_001393712.1| Trx [Clostridium kluyveri DSM 555]
    MVEEIKDINFSESVKESSTPVVVDFWASWCGPCKMLSPVIEEVASELEGKAKFFKINVDENPVTAAQFKIGSIPTVMVFK
    DGSVVEQFIGFRPKDTIKDVLEKHI

    >gi|153952948|ref|YP_001393713.1| TrxR [Clostridium kluyveri DSM 555]
    MEHRYDIAIIGSGPAGISAAINAKIRNKDIIIFGNEELSDKLIKAPKISNYIGLPDITGLELKSKFQNHLDVMGINITFE
    KINSIYAMGQYFALAVNEKMYEAKAVVLATGVEYTKPLKGEQEFLGRGVGY
    CATCDAPLYKDKTVTVIGYNKEAEKEANY
    VSELASKVYYIPVYRENPNLKDNVEVIQDKVLEIYGTDKVERVVLKYKSISTDGVFVLKSSIAPDQLMPGLILETGHIKV
    DVNMRTNIEGCFAAGDCTGKPYQYMKAVGQGQIAALNAVSYLDK

    >gi|153952980|ref|YP_001393745.1| methionine sulfoxide reductase A [Clostridium kluyveri DSM 555]
    MKKIVLAGGCFWGIQAYFDNKKGILSTKVGYANGNGENPSYEEVCNEDTGFAEACLLEYNAGVITLEELLELYWRIIDPT
    IVNRQGNDMGNQYRTGIYYIDEEDVEIIEKSREKQQKNYNKKIVTEILPLKNFYDAEEYHQKYLEKNPGGYCHIPGELME


    >gi|153952995|ref|YP_001393760.1| methyltransferase [Clostridium kluyveri DSM 555]
    MAKNFFSKVYDLVARIPRGKVTTYGQIAFMLGEPRSARIVGWAMRKAPSHLPCHRVVKKSGELSPDYVFGSSDIQRALLK
    SEGIIFKKDGHIDMKKYLWDGR

    >gi|153952999|ref|YP_001393764.1| AhpF [Clostridium kluyveri DSM 555]
    MILDADIKSQLAQYLNLMEGDILLKVSAGSDNTSNDMLTLINEIAGMSSKIKVEKVTLQRTPSFSINRPHEDTGVIFAGV
    PLGQEFTSLVLALLQTSGRAPKVDSEILEQITNVKGNYNFETYASLS
    CHNCPDVVQALNLMSILNPNITHTMIDGAVFKK
    EVEDKNIMAVPSVYLNGNHFNSGRMTLTDILSKIGSSTKPSEIFNKTPYDVLVVGAGPAGATAAIYAARKGIRTGIIAER
    LGGQVTDTVGIENFTGTKYIEGPKLSANLEEHIKEYNVDIITSQYAIGLKKKELIEIQLKNGTLLKSKTVILSTGASWRN
    VGVPGEKELKNKGVTY
    CPHCDGPLFKGKNTAVIGGGNSGIEAAIDLGGIVNHVTVLEFMPELKADDVLQKRLNSLSNVTV
    IKNVKIKEITGIDKVNGITYADRLTGEKHHIELQGVFVQIGLIPNTDWLDKTITRNSRGEIVVDSHGATDIPGVFASGDC
    TNSPYKQIIISMGSGATAALSAFDYLIRS

    >gi|153953000|ref|YP_001393765.1| hypothetical protein CKL_0363 [Clostridium kluyveri DSM 555]
    MSLIGTEVKPFKASAYHNGKFIDVTEADFKGKWSVVCFYPADFSFVCPTELEDLQNNYETLKSLGTEVYSVSTDTHYTHK
    AWHDSSQTINKITYTMIGDPSQTLTRNFDVLIEEQGLANRGTFIIDPDGIIQAVEINAGSIGRDANTVVSKIKAAQYVRN
    NPGEVCPAKWKEGSSTLKPSLDLVGKI

    >gi|153953069|ref|YP_001393834.1| CoA-disulfide reductase-related protein [Clostridium kluyveri DSM 555]
    MRKKILIVGGVAGGASTATRLRRLDENAEIIMFEMDEYISFANCGLPYYIGNTIKDRERLLVETPEGMKGKFNIDARINS
    EIIDIDVNKNTVKVKSKDLGTYEESYDYLVLSPGGKAIRPNIEGINSKRILTLRNIPDTDNIKSLVDRENIQSAAIIGGG
    FIGIEMAENLKERGLDVTLIEAAPHILAPFDSDMVTALEKELEDNGVNIILNDGVKSFKDNEEKVEITLDSNTKVTADLV
    ILAIGVAPNTNFIKDSGINLGTKGHILVNNKMQTNIKNIYAVGDAIEVIDFINGNNTAIALAGPANKQGRIAADNICGVD
    STYDGTQGTAIIKVFSLTGASTGNNERTLKKFNIPYKVIYVHPTSHASYYPDALPLSLKLIFNQEGKILGAQSTGYDGVD
    KRIDIIAAVIRLGGTVKDLTKLELSYAPPFSSAKDPVNMAGFVAENILSGKVEVITPEEFLNYNKENTLILDVHAKIEFE
    NQHIEGALNIPLDELRNRLEELDKNKEIIAY
    CKVGLRSYTAARILSQHGYKVKILAGGYKSYKLLNFKPKKFDNTKVFTG
    KKSNSNNQTISLKFDLEEPSYNKSVNACGLSCPGPLMQTKSSIDDLEQGEILKVTASDPGFYEDIKAWCRRTDNDLISLS
    KNNCNVTAFIKKNDELNSKNANAYKISYNDNKTIVVFSGDLDKALASFIIANGAASMGKKVTMFFTFWGLNILRKPEKVP
    VKKQFMDSMFGKMMPRGSKKLKLSNMNMLGMGTKMMRKVMKDKNISSLEDLIKSAMDSGIEIVACQMSMDVMGLKKEELI
    EGVKLGGVGYYLGEAEDSNVNLFI

    >gi|153953080|ref|YP_001393845.1| oxidoreductase [Clostridium kluyveri DSM 555]
    MEKYDLVIIGGGPAGLSAAVTAKEEGVDNILILERENQLGGTLNQCIHSGFGFSIFKEELTGPEYVEKSIEKVKDIKIPY
    KLNTTVFNLTRNKIITAVNEEEGIIEIKAKSIILSTGCRERPWGIMNISSSK
    CAGILTAGSAQRFINIEGYMPGKEVVIL
    GSGNIALIVARRITLEGGKVKAVIEPLSYYSGLKKNIVQCLYDFKIPLRLNHTIVDIKGKGRVEGVTISKIDRNKKIIKG
    SEEHIPCDTVVLSVGLSPENELLRSAGIKISNITGGPLVNESLAASIDGIFTCGNVLYIHNLVDNIILESINAGKNAAAY
    IQGKKFNGSKIKILALHGVKYTVPQYINIENVDKTINIIFRVTNLFRDKFISVYFDGVREMHIKKKMLTPSEVEEVKFTK
    ELLGKYPKCRQITISVQKD

    >gi|153953432|ref|YP_001394197.1| ActP [Clostridium kluyveri DSM 555]
    MKDEILKIEGMSCAACVRAVERAVKKVDGVESAGVNFATEKLTVSFDQSKTTLSDIKTAVEKAGYKALGEIESLDIHEES
    KQKEIQKLKQRFVISAVFTVPLLVVAMGPMIAQQLNIMLPSIIDPMVHQKIFAIIQLLLVLPVMIIGRSYFIIGFKSLFR
    KNPNMDSLIAIGTSAAFLYSFSSIVSMFYNDNHYHYHLYFESAGVILTLITLGKYLESIAKGKTSEAIKKLMNLTPKTAN
    IVQDGKQIEIAIDEVEVGDVVVVKPGEKIPVDGEVIEGLTSVDESMLTGESIPVEKTVGSKIIGATINKNGSIKYKATKV
    GKDTVLSRIIKLVEEAQGSKAPIAKMADIIAGYFVPVVIILALIASVIWYGSGQSMVFAVTIFISVLVIACPCALGLATP
    TAIMVGTGKGAEYGVLIKSGVALEISHKIQTIVFDKTGTITEGKPRVTDIIVSGDIEESYLLQIAASAEKSSEHPLGEAI
    VREAENKSIQFLKIDSFMAIPGQGIEVSIEDSKVFLGNKKLMIEKNISLESVEDISHTLSNEGKTPMYIALQNKLVGIIA
    VADTVKESSKKAIKRLNSLGIEVAMITGDNKNTAEAIASQVGIHRVLAEVLPQDKADEIKKLQGENKKVAMVGDGINDAP
    ALAQADVGIAIGSGTDVAMESADIVLMKSDLMDVVTAIDLSRKTIKNIKENLFWAFGYNSLGIPVAMGVLFIFGGPLLNP
    MLAALAMSFSSVSVLLNALRLKRFKPSISSD

    >gi|153953433|ref|YP_001394198.1| copper-binding protein [Clostridium kluyveri DSM 555]
    MLFKGKIKKVIHVEGMTCQHCVSHVKSALESIKGVSNVKVNLDSNTAVIKSSTEISDSNIEEVIKEAGYEVKGIEKA

    >gi|153953760|ref|YP_001394525.1| hypothetical protein CKL_1135 [Clostridium kluyveri DSM 555]
    MNSYLICTCHWCHVMAKESFQDNEVAEILNKYFISVKVDREERPDVDSIYMKVCQSITGSGGWPLTIIMTPEQKPFFAGT
    YFPKNNVGEALGLIAILEYIQKAWKDNKAQLLKEGDSLLDIINTLNKNSSGELSQDILKKAFLEFKQNFDTLYGGFGGYP
    KFPSAHNLLFLLRYFHKTKDAFALEMVEKTLESMYRGGMYDHIGYGFSRYSVDRKWLIPHFEKMLYDNALIAMAYLETFQ
    VTGNKKYAKVAEEIFEYVLRDMTSKEGGFYSAEDADSEGEEGKFYMWSQEEIKDILGQEQGSKFCCYFNVTSQGNFRGKN
    IPNLIGNSILEEDVQFIKNCREKLFKYREKRVHPHKDDKILTSWNGLMIAAMALAGRVLNNSKYTLAAKKSVDFIYKNLI
    RKDGRLLARYREGDSSFLGYADDYAFLIWGLIELYETTYNPEYLKNALELNQNFLEIFWDSENGGFFLYGKDSEKLIIRP
    KEIYDGPTPCGNSAAALNLLRLSYLATSYEFEDKVKQLFENFADEIESSPISCSFSLVALLFSKYPVRQIIISAGENINE
    ARKVLDMINKKYSPFTVSVLYSHLNKELKNICPSIEQYIAIRGKVTVYVCENFTCKEPITNMDLLKEVLSSDS

    >gi|153953893|ref|YP_001394658.1| RnfA [Clostridium kluyveri DSM 555]
    MSAYLTLFISAVIVNNFVLTRFLGLCIFFGVSKNLDASLGMGMAVTSVITLSSMLAWVVYNFVLVPFNLVFLKTVVFVLL
    IASFVQLLEIIIKKQAPALYNMWGIYLLLIATN
    CVVLGVPLINAESNYGFVESVVNSIGSGLGFALAIVLMASLREKLRL
    ADVPKPLEGLGVAFILAGMLALSFMGFSGMISL

    >gi|153954190|ref|YP_001394955.1| hypothetical protein CKL_1565 [Clostridium kluyveri DSM 555]
    MSKVIVIGGGPSGMMAAITAANRGFDTTLVEKNEKLGKKMFISGKGRCNITNSKDISEFFDHIPVNSHFLYSSLYSFTNK
    NTFEFFDDLGVNLKIERGGRVFPQSDKSSDLIKAMEKELIKKNVMIRFNSKIKKFISKDNFIRAVQLEDNSIIEGDLFIL
    CTGGMSYPQTGSTGEGYKMAESLGHTITKITPALVPIEIEEDWIKILQGLSLKNIELSIVDSNNNILYREFGEMLFTHFG
    ISGPVVLSSSRVVKNNRNLKAVINLKPALEFQELDRRLQREFLNYSNKSFKNSLGGLLPKKLIGIILDLCNIKLDKKCNS
    ITRDERQDLAGLLQNFTMHIKGLRPIEEAIVTSGGVSVKEIDSSTMKSKIVSNLYFAGEIIDVDANTGGFNMQIALSTGF
    LAGSKIKNVLQI

    >gi|153954281|ref|YP_001395046.1| transcriptional regulator [Clostridium kluyveri DSM 555]
    MNIQMFGTKKCFDTKKAERYFKERKIKYQFIDLNQKGLSKRELENVKASVSLNNLINMKVKEYKTLNMDKIRSSSVKEEL
    LLNNPKLYKTPIVRNGKQATIGYEPEVWKNWE

    >gi|153954338|ref|YP_001395103.1| redox-active disulfide protein [Clostridium kluyveri DSM 555]
    MIIKILGTGCSNCKRLEENTKNAVKELGLDATIEKVTDIRDIMKYGIMKTPGLVVDEKVKVFGRVPTAEEIKKYL

    >gi|153954394|ref|YP_001395159.1| BfmBC [Clostridium kluyveri DSM 555]
    MAYKYDLIVIGTGPGGSAAALEAAKSGMKTAVIEKDKLGGTCLNRGCIPMKALLHSAGIYQEIKESKKFGIQVEKAELNV
    PALLQYKEGVINKLSYGMEMLLQKNKVDVFYASGKIVNAHQVAVSENGEKKIIEAERIIIASGSSAVIPPIPGIQLKNVV
    TSYELLNKEDLFHHLVIIGGGVIGMEFASLYSAFGCRVTVIEAMNRVLPDMDREIGTNLKQILKKQGVDIHTSASVEKLE
    QTQEEKILCTYREKEKLQHIEVDGVLVAIGRKPSTEGLFDENFAVETEKGKILVNKYYKTSCPSIYAIGDVIGGIQLAHA
    ASSEALCAVRHIIGKEESLDVRVIPGCVYTNPEIAVVGITASQAKETGIDVITKKYPMMANGKSVLTMQERGFMKVVAEK
    ETEKILGAQLMCARATDIISQFTSAIVNGMTLSQMAHVIHPHPTFSEGIGELMRE

    >gi|153954430|ref|YP_001395195.1| hypothetical protein CKL_1805 [Clostridium kluyveri DSM 555]
    MDYSEEQIERYSRHIILSEVGVEGQEKLLNSKILIIGTGGLGAPAAMYLAAAGIGTLGLVDGDNVDLSNLQRQIIHETGD
    VGKSKVQSGKETVNRLNPDVNVITYNELVDSRNILDIIKDQNYDFIIDGTDNFPAKFLINDACVLSKKPFSHAGIIRFNG
    QLTTYIPNNGTPCYRCIFQSPPPAGVVPT
    CREAGVLGVMGGIIGTLQATEAIKYLLNLGNNLAGYLLTYNALTMEFRKIK
    LGKNENCGVCGQHPTIKNLIDYEQAACDLKTGELKG

    >gi|153954858|ref|YP_001395623.1| PacS [Clostridium kluyveri DSM 555]
    MIKNASLKVYGMTCTLCSTTIECAVSEIEGIDKINVSYAAEKAKFQYDNDKTNLEDIKQKIELLGFSVGEENEKNTDKGL
    TRQEIERNKLRNLFIISAILSTPLIIGMILGTTGFCHNTFDPNSANKWGNTIEILRLKSSQLHNWKFQLTLATIVQFIIG
    FRFYKSSFYALKAKAFTMDLLVVIGTTAAYFYSLYIALFETVTYTLGMVNLYFESSVTIITLVLLGRYLESIAKSKTAAS
    IKALNKLQPKTARILKNNIEHAVPIEKVSIGDILMVKPGEKIPVDGIVLTGYSSVDESMLTGESVPVEKKKDDLVTGASI
    NKNGTFTFKATKVGNDTVFSNIIKLVEEAQESKAPIQKIADKVSGLFIPAVLTVSALTFIIWYFVIFNQQIFIIDIAIIH
    AVSVLVVSCPCALGLATPAALMVGMGKGAENGILIKNGEKLEQCCKINTVVFDKTGTLTTGKLHITDIILFNKKQISSLN
    IIKEKDLMILAAAAEKPSEHPLGEAIYKYGKYNYEDEISTLDYFKYFPGRGITALVDDKKVLIGKETFLTENSVDLLELE
    DNLSKLQKQGKTSVLIAVNNILAGVIAMQDKIKDTSADAIKSLNKKNIEVYMITGDNKNTALSVANKLGIKNIIADVQPQ
    NKAQEISKLKDKGKVVAMVGDGINDSPALATADIGFALGSGTDAAIESGDIVLLKEDLRALPEAIELSRITMRKIRQNLF
    WAFIYNIIAIPIAVTGHLNPVIGAAAMSFSSISVLLNSLSLKRFKF

    >gi|153954886|ref|YP_001395651.1| LpdA [Clostridium kluyveri DSM 555]
    MGCIEVMPKLGLTMTEGQIESWHKSEGEEVKKGEVLFDVTTDKLTNEVEARESGILRKILVKEGETAKCLEAVAIIAGAD
    EDISDLLKESGAEDSEQKKEKQNPEKQENQQKNLSKKVVVIGGGPGGYIAAIRSAQLGHKVILVEKEELGGT
    CLNVGCIP
    TKVLLHSAEVFTEIKNSSDIGIDVGDVSINWGNVQKRKGKITKKLVSGVKGLLSANKVKVIKGIAGFKSKSSIEVVKKDS
    GVEKVDFDDIIISTGSLPFIPPIPGVDLDGVVDSTGALNFESIPDSIAIIGGGVIGIEFATLFSELGSKVTVVEMLPFIL
    PPIDRQISDLVSNKLAGQGVAINTGCRVTEIKRSGNNLKVNFSKENENSSVEAEKVLVAIGRRPNIKDLDVDKIGVKVEK
    GHICVDDKMKTNVDNIYAIGDCTGKNMLAHVASEQGVIAAENISGKNVFIDYKTIPACVYTKPEIASVGITEEQAREKNI
    DYKVGIFPMAANGKSMISGETEGIIKIISHKKTEEILGVHILALRATDLITEGALALRLEATVDEIITTVHAHPTIGEAF
    KEAALAVQKRALNMVN

    >gi|153954921|ref|YP_001395686.1| cation-transporting ATPase [Clostridium kluyveri DSM 555]
    MDKVVKNANRNNIKLVTKNIIKSSASVTAKEFNSNMKREFVLEGLDCVNCAAKIEEKVSKIEGINFANVNFPTKMLTLEI
    GEINRTKELIEAAKDVVKKLEPDVKIIEKSLHKQLRKELLLQGLC
    CGNCAAKIETESNNIKGVKSAMVDFVNTKLILDIE
    NPSKQNDIILKVKEIVKRIEPDANVVEIENKIYERKEEHGENSKKKMFILVVGAAIFGIATAFKFSNVIELIMYLITYIL
    VGGEVVLRALKNISRGQIFDENFLMSTATIGAFAIGQYPEGVAVMLFYQLGELFQGIAVNRSRKSITDLMDIRPDFANLK
    IGDDIKRVSPEEVSVGNIILVKPGEKVPLDGKVVEGNSMVDTSALTGESVPREVRAGDSILGGVINKNGLLSIKVEKEFG
    DSTIAKILDLVQNASSKKAPTENFITKFARYYTPIVVFSAVALAVLPPLFIESATFSQWIYRALAFLVVSCPCALVVSIP
    LGFFGGIGGASKYGILVKGGNYLEALNSVEGVIFDKTGTLTKGVFRVTEVKSQNNISRDELIAYAAHAESYSNHPIATSI
    LNAYGEEIVKDSIENYEEISGHGVKVMIQGKEVLVGNYKLMNKENIIYEQVETVGTVVHVAVDKVYAGYIIISDEVKEDS
    AKAVKALKDIGIKRIVMLTGDNKTVGTKVAKQLGLDEVYTELLPDEKVEKMELFDKEKSSKGKLIFVGDGINDAPVLARA
    DIGIAMGGVGSDAAIEAADVVIMTDEPSKIASAIKIARKTRHIVMQNIIFALGIKVILLVLIALGLGTMWEAVFGDVGVT
    LLAVLNSMRAMKTVNI

    >gi|153954925|ref|YP_001395690.1| methyltransferase [Clostridium kluyveri DSM 555]
    MNNKNTFKENSRMNFDKQAENYDDGFDGRFVRVMYDEIIKRIDKFQNGILLDVGCGTGNILSRLYENKKLHLCGLDISNK
    MIEVARRNLNDDILLKVGDAEFIPWPDNTFDIILCNASFHHYPNPQKVLLEMKRVVKADGKLIIGDPTAPPLIRQVLNFI
    FGI
    CHNGDYKIYSLKEMKKLLRRCGFRPFEFKKINYKSFVISASA

    >gi|153955001|ref|YP_001395766.1| hypothetical protein CKL_2383 [Clostridium kluyveri DSM 555]
    MAKVINSSEFEGNVLNSSETVLVDFFATWCGPCKMIAPVLEELSEEMKGKVEMFKVDVDRSAELAQKYGIQGVPTLMIFK
    DGKSVDRIVGFQPKEILKSRLQQY

    >gi|153955052|ref|YP_001395817.1| methionine sulfoxide reductase B [Clostridium kluyveri DSM 555]
    MSNTYNKECLKKKLSSIQYKVTQENETEPPFENEYWDFNGEGIYVDICSGEPLFTSLDKFDSGCGWPSFSKPLVPENINE
    SKDNSHGMIRTEVRSKNGNSHLGHVFDDGPKALGGLRY
    CINSASIKFIPLDDLDRKGYGEYKKLFKTYK

    >gi|153955123|ref|YP_001395888.1| ABC transporter solute-binding protein [Clostridium kluyveri DSM 555]
    MKIKKMMLGLLLIATIIVSLAGCGTTAVKNETSKDTAKTKTYTDMAGRKVTLSTNINKIVLIRSMDVYYMSAILGQEFDK
    KVVALGLNFKDSDIDGYKKYSEVFNMDKIKSLGSIYDDAISLESVVNLEPDLIIVDTQFKSKS
    CVNKMIEAGLPVVFTDM
    NSDPFHGVQKSMLMLGEMLGKEDKVEKMVEDANKKTDSVLTRVDKLLKAGTKRPTLYFECGNVTPTEIGGTRGDTSDGWG
    YLWNRLGADNIGVGQGSNPVNPEKVLTADPDVIVIGGANWDQTANIMRMGYYVTKEEASVHLDEYVQKRAGWSDLSAVKN
    GRLYAVHFNYTVYPYNFCGVEAMAKFLFPSEFKDLNPEKDRKEFFDKYMPVKYSGLFSADWK

    >gi|153956230|ref|YP_001396995.1| redox-active disulfide protein [Clostridium kluyveri DSM 555]
    MEIKILGTGCSNCKKLEANAKEAVKELDVEAKITKVEDIKDIMKYGIMRTPAIVINEKVKMFGKICNVDEIKKYINDEK