Clostridium cellulovorans 743B uid51503

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|302873174|ref|YP_003841807.1| Rhodanese domain-containing protein [Clostridium cellulovorans 743B]
    MLGFLKKNDGKAINVNDIDNLIGKVELIDIREEYEYKGGSIKGSKNIPMGELLGDPDKYLDKNKEYYIMCQSGGRSSKTC
    NVLSKQGYDVVNVSGGMGSYAGTKRE

    >gi|302873334|ref|YP_003841967.1| UBA/THIF-type NAD/FAD binding protein [Clostridium cellulovorans 743B]
    MLNQFSRTELLFGKEAMEKLENSKVAVFGIGGVGGFVVEALVRGGVGEFELIDDDKVCLTNLNRQIIATRQTVGKYKAEV
    MKERILSINPKAKVTIHNSFFLPQNSDEFDFKSYSYIVDAIDTVTAKIELVMKSQELGIPIISCMGTGNKLDPTKLEVAD
    IYKTTMCPLAKVMRHELKKRRVKRLKVVYSTEKPKRPIEDMAISCRANCICPPGAERK
    CTDRRDIPGSTSFVPSVAGLII
    AGEVIKDITGVR

    >gi|302873335|ref|YP_003841968.1| hypothetical protein Clocel_0427 [Clostridium cellulovorans 743B]
    MTETKETIEIGWNLDNSYESLPEIFFTKQGLSPITSPKLIILNAPLATFLGLNVQALQSEEGIANLVGNKIPKGASPLTQ
    AYAGHQFGSFTMLGDGRALLLGEQITPQGEKVDIQLKGSGRTRYSRGGDGRAALGPMLREYIISEAMYGLGIPTTRSLAV
    VTTGEPIIRETEQPGAILTRIAASHIRVGTFQYASQWGEREELKALADYTIQRHFPEGINNENKYLFLLKEVINRQAQLI
    VKWQLVGFIHGVMNTDNMTISGETIDYGPCAFMDTYDPATVFSSIDVYGRYAYGNQPNIAVWNLARLAETLLPLLHSDQE
    QAVEIAQEEVSNFAQLYQNNWFAGMRAKLGIFNEEPEDKILIEELLGMMHKHSADYTNTFRALTLDMCSHTELFTSPEFK
    HWYQKWQERLSRQQESKDSVQQLMKKNNPAIIPRNHRVEAAIEAAVKNGDYSVMEQLLDALSNPFEYSEKQEEYAKLPKP
    SKQKYKTF
    CGT

    >gi|302873418|ref|YP_003842051.1| methylated-DNA/protein-cysteine methyltransferase [Clostridium cellulovorans 743B]
    MRSSVVIETIIGKIVITEENHTITNVDLYRDAVIENFFQKETPLLKKAVKQLEDYFKGTLKEFDLPLAPNGTKFQQSVWR
    ALQDIPYGETKSYGEVARSIGNPKAARAVGMANNRNPIAIFIP
    CHRVIGVNGKLVGYGGGIDIKEILLGLEKSVK

    >gi|302873439|ref|YP_003842072.1| Peroxiredoxin [Clostridium cellulovorans 743B]
    MLMEGSKAPEFKLEDKDGNEVRLSDFLGKKVVVYFYPKDNTPGCTRQACAFKDSYEGFKAKEIVVIGISKDSTKSHEKFA
    EKHGLPFTLLSDPELIVIKAYDVWKEKKLYGKVSMGVVRTTYIINENGIIEKVFEKVKPDTNAKEILDYLEG

    >gi|302873495|ref|YP_003842128.1| peptide methionine sulfoxide reductase [Clostridium cellulovorans 743B]
    MKEIIVAGGCFWGVEEFFSRIPGILDTEVGYANGVTENPTYEDVCKNNTGFAEACYIKYDEAVLPLDALLEQYWSIIEPT
    YLNRQGNDIGSQYRTGLYYKQEEDKEILLKSKEEIQKQYDEKVVTEVDLLKNFYIAEEYHQDYLKKNPNGYCHIKLD

    >gi|302873579|ref|YP_003842212.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Clostridium cellulovorans 743B]
    MKKVLIVGGVAVGASVAARLRRLDEEIEIVMFEKGPYISYANCGLPYNIGGVIKDREKLIVTKAELMRDRFKIDVRAESE
    VVAIHSKDKAIKIRSKERGEYVENYDYLVLSPGAKAIKPNIPGVDGPRIMSLRTIPDTDKINEFITKNTVKKATVIGGGF
    IGIETAENLIERGIDVTLVEAAPHILAPFDSDMVTIAEKELEEHGIKLRLNDGVKAFEDTNSGVEITLSSGKKLTSDLVI
    LAIGVTPDTGFLKDSGIEITARGHIVTNTNMETNIEGIYAGGDAVEVVDFVNKTKTAIPLAGPANKQGRIIADNIAGIKS
    NYKDTQGTSVLKIFDLIAASTGNNERTLNRLDIKYNVIYIHPNSHAGYYPGATPFTIKAIFDDQGKLLGAQAIGYKGVEK
    RIDVIATTMRLGGTIYDLTELELSYAPPFNSAKDPVNMVGYVAENILTGKTEVVLPRDVDSRDKDKVVVLDVRTKIEREN
    GSIDDSIHIDVNELRYKLDTLDKNKEYWVH
    CAVGIRAYIAERILKQHGFKAKNITGGYKSYIAQKFVPKDLDDYTSGSDN
    YNKEQIMQSQEATREAAVDSKEVKLDACGLCCPGPLITVKETMDTLNPSDVLNITASDPGFYEDIKAWCKRTNNTLLNIE
    NKNGIITAKIEKNINNVEKTEMQNADITNAQTMVVFSGDLDKAIASFIIANGAAAMGKKVTMFFTFWGLNVLRKHDRIKT
    KKNPIEKAFGFMMPRGSKKLKLSKMNMAGMGGKLIRGIMRSKEILSLEDLIEQAQKSGVNLVACTMSMDVMGIKEEELVS
    GVNYGGVGYYLGEATDSNINLFI

    >gi|302873925|ref|YP_003842558.1| cadmium-translocating P-type ATPase [Clostridium cellulovorans 743B]
    MKGMGKVVNNPSKSNIKLVPKNITPSQSNIKATVKREFILEGLGCANCAAKMEHKLSTLERISSASVNFVTKTLTVELDG
    TNKTDGLVDTITEVVQSIEGHVKVIEKQSNKVLKKEIKLQGLC
    CGNCAAKIERESNNIKGVKSAVVDFVNTKLILEIDNL
    SKQNVIIEKVKEIVKRIEPDVKVIELENNNRGAKDKTHEHNHDESNKSDMIKFGASALIFVVASVLNLSSYIELTLFLIS
    YILVGGEVVLRAIKNIRRGQVFDENFLMSIATIGAFAIGQYPEGVAVMLFYQLGEMFQGFAVNRSRKSITALMDIRPDFA
    NLKIGDELKKVSPEEVGVGDIIVVKPGEKVPLDGKVIEGNSMVDTSALTGESVPREVGAGDSILGGVINRNGLLTIEVEK
    EFGDSTIAKILDLVQNASSKKAPTENFITKFARYYTPIVVFSAVALAIIPPLVIDGATFSQWLYRALAFLVVSCPCALVV
    SIPLGFFGGIGGASRNGILIKGGNYLEALNNVEIIVFDKTGTLTKGVFKVTEVKAQNNFTSDELINYAAYAESYSNHPIA
    TSILKAYGTEIAKDSIENYEEISGYGVKAMVSGREVLAGNFKLMNNEKIIYQQIETIGTVVHVAVDKRYAGYIVISDEIK
    EDSAKAIKDLKAIGVKKTVMLTGDNKIVGNKVAKQLGLDKVYAELLPDQKVEKVELLDKEKSPKGKLIFVGDGINDAPVL
    ARADIGIAMGGVGSDAAIEAADVVIMTDEPSKITAAIKIAKKTRRIVMQNIIFALGIKIILLVLVAMGLGTMWEAVFGDV
    GVTLLAVLNSMRAMKVEKM

    >gi|302873928|ref|YP_003842561.1| Thioredoxin domain-containing protein [Clostridium cellulovorans 743B]
    MLKINSNEDIKKLISDNEIIIIYFSNKVCGACDVIRNKVESILEAYPKVKLIDIDGEEQIELAALNNVFSFPLLILYVDG
    KEVIRVGRNVNLLELENTIKRYYDLVFYNIKKEKSF

    >gi|302874403|ref|YP_003843036.1| copper-translocating P-type ATPase [Clostridium cellulovorans 743B]
    MDKSFKIEGMTCAACAKAVERVSKKLPGVTEASVNFATEKLNISFEDSKVSVPDIQAAIEKAGYKAIIESKKKTLNIEGM
    T
    CAACAKNIERVTKKLDGVIESEVNFATEKLNISYDSSKVRVSEIKKVIEKAGYKAIEEETSVDTDKERKEKEIKLLWRK
    FVMAAVFTVPLLIITMGHMFGYLIGFNLPQFIDPMINPKTFAIVQIVLCLPVMVAGYKFFTVGFKSLIRRSPNMDSLIAM
    GTSAAFFYGIYATFEIFRGNIDYAYDLYFESAAVIITLISLGKYLEAVTKGKTSEAIKTLMGLAPKTAIVLRDGKEIETA
    IEEVEVGDIIIVKPGERMPVDGEVIEGITSVDESMLTGESIPVEKTIGDKIIGASINKNGTIKYKATKVGKDTALAQIIK
    LVEDAQGSKAPIAKMADIISGYFVPVVMAIALLSALGWYFIGEETGIFALTIFISVLVIACPCALGLATPTAIMVGTGKG
    AEYGVLIKSGIALETSHKINTIVFDKTGTITEGKPVVTDVITAENIDEKYLLQLAASAEKGSEHPLGEAIVKGAEEMGLE
    ILKLDFFKAIPGHGIEVKIDGKDILLGNRKLMVDRNISFDNLEEKSHSLANEGKTPMYVAIDNKIAGIVAVADTVKENSK
    KAIEKLHKMGIEVAMLTGDNKKTAEAIAKQVGIDRILAEVLPQDKANEVKKIQGEGKKVAMVGDGINDAPALAQADIGIA
    IGSGTDVAMESADIVLMRSDLMDVPTAIELSKKTILNIKENLAWAFGYNILGIPVAMGILYIFGGPLLNPIIAAAAMSFS
    SVSVLLNALRLKGFKPAK

    >gi|302874405|ref|YP_003843038.1| Heavy metal transport/detoxification protein [Clostridium cellulovorans 743B]
    MSIQKKRFNVYNMTCTSCENRVEKSIKKLTGVENAKADYSKQIVEVLYDDSYCNGEKICEAIEKAGYTVQKPKSFTFIGI
    LIIVAAIVILGFNTSGFDMEEKLNAGSYAVIFMVGVLTSIHCVGMCGGIMLSQSLGKESQSKFDAIKPALLYNLGRVISY
    TLLGGIVGALGSVFSLSLTAQAVMQILAGVFMLIMGLNMTGFSLFRKINLKLPYSACKFKHKFKSSFVVGILNGLMPCGP
    LQTMQLFALASGSASKGALSMFLFSIGTVPLMLTFGALSGLLSKNYTKNILKFSGVLVMALGLIMGSRGLILAGVNIHPM
    KSTTSSVASSKENSTDSSKKSGSNNNSNTNKNNSAVVENGVQTITMTANNRGYSPNVLYIQKGIPVKWIIKGEQLNSCNN
    AVVSKALNLQKKLQKGENVIEFTPGNEDINFSCWMGMISGVIKVVDNLDTTAESNTSSTSTTSTTVAGNKTPSCCQVE

    >gi|302874498|ref|YP_003843131.1| hypothetical protein Clocel_1620 [Clostridium cellulovorans 743B]
    MRDTRFEISDRAYIELQTLLNEHIEYSYVNFRSISSCCKPKVDIMLNDTKSEDDIVITYKDLQITFSPNDFKDIKSITLI
    YVDNFEIKIDKFDDIKKDCANCSSKGSCGSKTTNGCGGCKSC

    >gi|302874557|ref|YP_003843190.1| Thioredoxin-disulfide reductase [Clostridium cellulovorans 743B]
    MDEQNKLLREIDVFIIGSGPAGLTAGIYAARANLDVVVFEDMVSGGQIRQTYTVENYPGHLSIDGNDLADKMLEQAKGLG
    AKIEEYDSIISIKITDIDKVIETYKYIYKPKVVIIATGAEPKKLPVEEEEKYAGRGIHY
    CAVCDGGFYRNKSIAVVGGGN
    TALEEAIYLSRFGNVKIIRRKDYFNGERVNLNEVNRNPNIEIIWNSDVKKVCGEDFVEYVVLEDTVTKKNRKISIDGIFV
    AIGVTPKTEIFRDFVNVNESGYIIANEATMETNIKGVYAAGDVREKLFRQITTAVSDGTIAALMAEKYIQGLKKA

    >gi|302875114|ref|YP_003843747.1| NADH dehydrogenase (quinone) [Clostridium cellulovorans 743B]
    MEKIKSYSELNLFHKECRKLLSLRYSEDVEKSKDNKKDKIEVLVCGGTGCKSSNSDEIIKNFKLEIENINLSSKVSVKMT
    GCFGFCEKGPIVKIIPDNTFYIHVSPKDVAEIVEEHIINGNIVDRLLYEEPTLKEKITKQEEMSFYKKQRRIALKNCGVI
    DPEDIKEYIGAKGYLALGKVINEMTPEDVIKEITDSGLRGRGGGGFPTGKKWSLAKDSKDDIKYIICNADEGDPGAFMDR
    AILEGDPNSIIEAMAIAGYAIGASKGLIYIRAEYPLAVQRLMIAIEQAKEIGVIGEGILGSSFNFDVEIKYGAGAFVCGE
    ETALVHSIEGCRGEPTTKPPFPAEKGLFNKPTSVNNVETFANITAIINNGSQWFSSIGTNTSKGTKVFALAGKIKNVGLV
    EVPMGIKLEEIIYEIGGGIKDNKEFKAVQTGGPSGGCIPSMLLDLPIDYESLNAVGSMMGSGGMIVMDEDDCMVDIAKFY
    LEFIVDESCGKCTPCRVGNKRLLEILNKIVEGKGTEDDIKKLKDLSKVIKDTAL
    CGLGQTAPNPILSTMTYFMDEYNAHV
    DEKKCVAGKCKKLVRYEITDECIGCTKCSRACPVRCISGKIKGKHIIDQEKCIKCGTCFEGCPVKAIKLG

    >gi|302875358|ref|YP_003843991.1| arsenate reductase and related [Clostridium cellulovorans 743B]
    MNIQIFGTKKCFDTKKAERYFKERKISYQFIDLNEKALSKRELESVKASISINELINAKSKEYKTLKLENIRSSSVKEEL
    LLKNPKLYNTPIVRNGKEATLGYKPEVWGNWE

    >gi|302876174|ref|YP_003844807.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Clostridium cellulovorans 743B]
    MSKNDVTKNDISKKNSKVVVVFFVILGIFSAVINIGKLEYFSDKKPDVDKIAGITDGETGKMKKFSDIDLNGFNARTITG
    ETLTSDYFKENDITMINIWATY
    CGGCVTEMPGISKLYSERPKNSNIISICEDSEKENQLATEIMTDAGAEFLTLIPDEKL
    TNVLLSHVSTLPTTIFVDKAGKMVGEPIFGARTPGEYKEIITDMMELAKNV

    >gi|302876176|ref|YP_003844809.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Clostridium cellulovorans 743B]
    MSRFSEKTPAIIVLIIAIVVLVLVGIKEVGVPKKESNSNVSQKDTKEKAEETKEFSEIDLTGFSTKTISGETVTSDYFKE
    YDITMINLWATY
    CNPCIKEMPEIAKLYKNKPEKSNIISICIGTEKDAEDVKLASQIMKDANAEFLTLIPDEKLSKTLISH
    VSVVPTTVFVDRYGKIVGEPILGSQSAEEYEKAIIDRLK

    >gi|302876266|ref|YP_003844899.1| Heavy metal transport/detoxification protein [Clostridium cellulovorans 743B]
    MKKKIVIEGMSCNHCVNHVTNALEEIKGIKDIVVMLDTKTAIVDAEESVKDEEIKFAIDDAGYDVVSIEEVL

    >gi|302876271|ref|YP_003844904.1| Rhodanese domain-containing protein [Clostridium cellulovorans 743B]
    MDYNILSVHDLNGRLGEIDLIDIRDEYEYKTGHIPTAKNIPMSEILNNTEDYLEEDKEYYIVCQSGGRSSIACATLSSKG
    YKVINVSGGTSSYFHPLEK

    >gi|302876421|ref|YP_003845054.1| UbiE/COQ5 methyltransferase [Clostridium cellulovorans 743B]
    MNKVYKNRDEFLCSVFDRAASAFGSKGPKYFQYFGKRLVELSNLQPKMKVLDVATGRGASLFPVVEIIGQLGFVTGIDFS
    KEMIVETKKEIRYEGYNNVQLLQMDAESLEFDDNSFDYVLCGLSIQFFTKYTDALREMNRVLKPNGRLGLSTWKRKDTTP
    FFMNIVAKYLRDV
    CVPYNMNKERGEFGTDESLRKMLSDVGFRKIQVIEEHKTFYYKNEDEWWQEQWSHAGRAAFELIKNL
    GDEVYNQFKEEVSKKLVENTDSKGIPFEASILYAFGDK

    >gi|302876482|ref|YP_003845115.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Clostridium cellulovorans 743B]
    MDELYDIAIVGSGPAGISAAVNAKIRNKKIILFGNKELSSKLTLAPKIDNYLGYYNITGKELADKFLEHLNTMDIVISKE
    RINNIYAMGSYFSLMVNDKEYKASTVILATGVLFGKPFKGEVELLGRGVGY
    CATCDAPLYKGKPVAIIGYNKEAEEEANY
    VSELASIVYYIPTYKGEYELRNNIEIIKDKPLEIIGDSQVQKLLLANGEIQVDGIFILRDNVAPEQLVPGLEVDENHIKV
    DREMKTNIEGCYAAGDVVGKPYQYMKAMGEGQVAALNAVRYLDNKAMNK

    >gi|302876483|ref|YP_003845116.1| thioredoxin [Clostridium cellulovorans 743B]
    MVRQITDATFNEETNSNVPVVVDFWAPWCGPCKMLGPVIEELASEMGDKVKFAKINVDENPVTANTFRVASIPTLIIVKD
    GKVVDQSLGFKPKPALAAWIQKHL

    >gi|302877005|ref|YP_003845638.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Clostridium cellulovorans 743B]
    MSKEIKDLDLLIIGGGPAGLTAAIYGARAKLSLLLLENQMVGGQVRSSYTIENYPGFKTIEGGALADLMKEQAVELGAEI
    DEFDSVVSVNLKDEEKLIETKKYIYRTKTLIISTGATPKKIPVPNESKFSSKGIHY
    CAVCDGAMYEGSTMAVVGGGNSAL
    EEALFLTKFASKVIMIRRYDYFKGEKATLEELEKNPKVEIMYNWDLVNVEGEKFVNKAIIRNTKTNEEKELELEAVFGYI
    GTEPKTDLFKEFINLDSSGYVITDDRMTTNIKGVYAAGDVRQKPFRQITTAVSDGTIAALAAEKYIEELSRK

    >gi|302877006|ref|YP_003845639.1| glutaredoxin-like protein, YruB-family [Clostridium cellulovorans 743B]
    MSVTVYTSNTCPWCVKTKEYLASNGVDYKEINVTQDKEAAKEIVEKTGQRGVPIIDIDGQYILGFDKEEIDRLLNL

    >gi|302877007|ref|YP_003845640.1| Peroxiredoxin [Clostridium cellulovorans 743B]
    MAIYEFKAKTIDGEEISLDRYKGKVVLVVNTASKCGFTPQYEGLEKLYDEYKEQGLEILGFPCNQFAEQEPGDNQEVKNF
    CQANYGVDFQIFEKTDVRGETAHPLFNYLTNEKPFEGFDMKHPIGETLYNVLKEKMPSYLEGDSVKWNFTKFLVDRNGNV
    VKRFEPTSEPSEMEEAIKSLL

    >gi|302877008|ref|YP_003845641.1| Peroxiredoxin [Clostridium cellulovorans 743B]
    MNIYDFNVKDINGKEVSLSNYRGKVLLIVNTASKCGFTPQYEDLENLYKKFGNDKLEILAFPCNQFGNQEPGDNAAIKNF
    CQSTYDVTFPMFAKVNVNGDDADPLYKYLTTAKKGLLGGGVKWNFTKFLVDAEGNVVDRFAPTTKPSKIEETIESLIKKA


    >gi|302875794|ref|YP_003844427.1| glutamate synthase (NADPH), homotetrameric [Clostridium cellulovorans 743B]
    MDRFKRTPAREEKLEDRITNFNEVCTGYDEDSALTEASRCLNCKNPKCKANCPVNMSIPDFIASIKEKNYEEAARIIDKH
    SALSAICSRVCPQEKQCEGNCVLGIKGESISIGNLERFVSDWARENN
    CEFLDKEEANGKKVAVIGSGPAGLTCARDLAKL
    GYEVTIFESMDVPGGILMHGIPEFRLPKKTIVKHEIEKVQRVGVKIETGVTIGRDFTLDSLLNEKGFDAIFIGAGAGISK
    EMRIPGENANGVYPGIDLLSSVNTNGGHSPLLKAGERLAVIGGGNVAMDVARVAIRLGAKVQVVYRRSEEELPAREVEIE
    HTKAEGAEFNFLTNPIEVLTDEEGKVTGMRCVKMALGEPDESGRRRPVVVEGSEFVMEVDKVAMALGSDPSTEVMEATNG
    VERTKWNSIIIDEETGRTSNEKIFAGGDIVTGAETVIKAMSAGRKAAKAIDEYLKTI