Clostridium cellulolyticum H10 uid58709

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|220927673|ref|YP_002504582.1| protein of unknown function DUF255 [Clostridium cellulolyticum H10]
    MTTNNRMPNKLINEKSPYLLQHAHNPVDWYPWGPEAFSRAVSEDKPIFLSIGYSTCHWCHVMERESFEDEEVAHILNRDF
    ICIKVDREERPDIDSIYMSVCQALTGHGGWPLTVFLTPDKQPFYAGTYFPKEDSKGLMGLISLLGSVKEAWDNKREHLLV
    SAENIINHVSKESISKDSKISSDIIQEAFAHFKYNFDSKYGGFGTSPKFPSPHTLLFLLRYWYTKKEPYALEMVEKTLES
    MKNGGIFDHIGFGFSRYSTDKKWLVPHFEKMLYDNALLAIAYGEAYSATGNKNYEETARQILDYVQRDMSSQLGAFYSAE
    DADSEGVEGKFYIWSKEEVINVLGSKDGEEYCRIFDISPSGNFEGLNIPNLIETGTLPEQQKSFAEDCRKKLFTHREKRI
    HPYKDDKILTAWNGLMTAAMAYCGRVLGEDKYIESAKRCIDFISKKLVRTDGRLLARYREGEAVFPAYLEDYAFLVWGLL
    ELYEATFTTLYLKRALKLTDAMLNLFGENNSTGLFLYGHDSEQLIARPRESYDGAIPSGNSVAAMNLLRLARITGRHEYE
    NRAKAIMDFFGTQINAAPTGHSYMLCSYMYSVSDISSEVVIAGVDGKGLIDTFNNKYLPFAVAISNISPELTEIAPFIGD
    YKAQNGKTMAYVCRNFSCMEPITEPKKLGEVLS

    >gi|220927693|ref|YP_002504602.1| Heavy metal transport/detoxification protein [Clostridium cellulolyticum H10]
    MKKIYRLNDLGCANCASKMEREINKLEGVNSATVNFISQKLIIDVVDESFEDIMTSVQKIIKKIEPDCTVKL

    >gi|220927816|ref|YP_002504725.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Clostridium cellulolyticum H10]
    MVDVIIIGKGPAGISASLYTVRAGLRTLVIGLDNSVLNKADRIENYYGFAEPVSGKYLLEQGEKQARRLGVKFIQSEVIA
    LEKAEYFEVYTTQDNYSAKAVLMATGQQTKKVNIDGLEKFEGRGVSY
    CTTCDGFFYRGLKVGLVGFKDYAIHEVMELEPL
    TKDITIYTNGNELQLTDKYKFHASRFTINDKKITSVVGKEVVEGIVFEDGSVANLDGLFVAFESASSIDFARKLGVITKN
    NSIVVDENQSTNLKGLFAAGDCIGGFKQISTAVGQGAMAGKRIIEFVRNNS

    >gi|220928003|ref|YP_002504912.1| UBA/THIF-type NAD/FAD binding protein [Clostridium cellulolyticum H10]
    MLHEFSRSELIIGTEGLEKLKNSKVAVFGVGGVGSFTVEALTRTGVGHLVLIDDDCVCLTNLNRQLHATRKTVGKPKVEV
    MRDRVLEINPKCDVTIIQKFYMPDVAEEILDSSFDYIVDAIDTVTAKIDLVVRANQFGIPIISAMGAGNKTDPTRFQVSD
    IFKTTVDPLAKVVRKELRNRGIKKLKVVYSTEEPIKPVETDTSSCSAGCICPKGTARK
    CTVKHQIPGSLSFVPSVMGLII
    GGEVIKDLIGFIKD

    >gi|220928195|ref|YP_002505104.1| copper-translocating P-type ATPase [Clostridium cellulolyticum H10]
    MDRKESLKITGMSCAACAARIEKGLNKLEGVKQANVNFAVEKATVEYDDNLTDLGKFQETIKKLGYGVIKESSKSGNKVE
    LKLTGMS
    CAACSSKIERKLNKTEGIAKAAVNLATEKANIEYDLSTVKVSDIIKTIERLGYGAEKAEEVNRDTEKEQREKE
    IRSLKLSLIVSAVLSAPLVLAMILGMLKLDSPVLSLLHNEYFQLIITTPVQFIIGFRFYKHAYYALKSKSANMDVLIAMG
    TSAAYFFSLYNVFFEEVQKGMMKNLYFEAAAVIITLILLGKYLEAVAKGKTSEAIKKLMGLQAKTARVLRNGTEEDIPIE
    DVLPGDIVVVRPGEKIPVDGKILEGNSSIDESMLTGESLPVEKKAGDFVIGATINKFGTFRFEATKVGKDTALSQIIRMV
    EDAQGSKAPIQKIADKVSGIFVPIVVAIALLTFVIWLFVTGDVTKAIVSAVAVLVIACPCSLGLATPTAIMVGTGKGAEN
    GILIKGGEHLEMAYKLNAVVLDKTGTITKGEPEVTDIVVLDNTYEKMEILRLASITEKSSEHPLGVAIYEYGKKELGKIN
    DPDKFEAIPGRGVLSVIDGKTIYIGTRKLMREQGIDIASVGAGIERLEDEGKTAMLMSIDNRLTALIAVADTLKESSKEA
    IQELKSIGIEVYMITGDNKRTANAIAKLVGITNVLAEVLPENKAEEVEKLKASGKIVAMVGDGINDAPALATADIGMAVG
    TGTDVAIEAADITLMRGDLRTIPAAIRLSRKTMNKIKQNLFWAFFYNIIGIPFAALGLLNPMIAGGAMAFSSVSVVANSL
    SLKGFKPMETRKKNN

    >gi|220928497|ref|YP_002505406.1| redox-active disulfide protein 2 [Clostridium cellulolyticum H10]
    MSLFKKKKEDLSETVGKGEAYVKVLGSGCAKCNQLEAAVKEALATLRMDTSIEHVKDFAQIASYGVMTTPALVVDGKVVS
    YGKVLKTEEVIKILEKVKEQ

    >gi|220928568|ref|YP_002505477.1| methylated-DNA/protein-cysteine methyltransferase [Clostridium cellulolyticum H10]
    MKNINFFQTQIGRIGITEEDNRITNVFFETDYCMETVLDGKKSLQQSAFNINETSLLMEAGMQLNEYLEGKRIAFDLPLA
    PKGTDFMKSVWNCLLRIPYGKTRSYKEIAEAAGNPRACRAVGMANNRNPIPIFIP
    CHRVVGANGSLTGYRGGLEIKKKLL
    EIEKSKN

    >gi|220928572|ref|YP_002505481.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Clostridium cellulolyticum H10]
    MSIKVVIVGGVAGGASAAARLRRLDENAEIILFEKGQHISFANCGLPYYIGEVITEKENLFVTTPEKMKQRFAIDVRVNS
    EVLRVDPVSKIVEIKDHEKNRIYTESYDKLVLSPGAEPIRPQLPGINSSRIFTLRNIPDTYSIKDYVDKMNPQRAVVVGA
    GFIGLEMAENLHLRGINVSVVELADHVIGPMDFDMAAIVHNHLRTKNVELILKDAVSAFDETETHINVTLSSGKVIKADM
    VIMGIGVRPDVRLAADAGLTIGSSGGIRVNEYLQTSDPDIYAVGDAIQVKDYISQNPALIPLAGPANKQGRIAADNICGG
    KEKYEGTQGTSIVKVFDLTVAVTGNGERLLQRNNIQYEKSFTHSASHASYYPGGIPMSIKLLFEKSNGKLLGAQIVGYDG
    VDKRIDILSTAIRAGMTVYDLEKLELAYAPPFSSAKDPVNIAGFTASNILQNNCKIFHWNEVDNINKGIGVLLDVREQVE
    FQLGTINGAVNIPLDGLRGRLHELPKDKTIFVF
    CQVGLRGYLASRILTQNGFEARNLSGGLKTYGMAVEKQTNEGIFDTH
    LPELHTLEETPSPITELDACGLQCPGPIMKVFDTMKSINENDIIQVKATDPAFQEDIKTWCNSTGNQLLDVKFENKTFIA
    KIKKGIKEDSPRDMKDRNANKNNKSMIVFSNDLDKAIASFIIANGAASMGRKVTMFFTFWGLNILRKPKNTTSIKKDFIS
    RMFGVMMPKGSRKLSLSKMNMAGIGPKMIRNLMNKKNIYSLEELLTQAQKNGVEFVACNMSMDIMGIKKEELIDGVTIGG
    VASFLGSAEESDMSLFI

    >gi|220929083|ref|YP_002505992.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Clostridium cellulolyticum H10]
    MNKKVSIIIWTLAVFAIIAAAYIFYSKNRPQSFVTPPQETSSQSQSSQSDKVMAPDFALKDMDGKTVKLSDYKGKVVILN
    FWAVW
    CKYCKLEMPDLNELDKELSQENNAVILAIDVEESHDTVKNYLTSNGFDLKVLLDNDGSVSRSYGVSGYPTTFIIN
    KDGSVYTYIPYKTDKATLLQILDQLKAEEQLF

    >gi|220929099|ref|YP_002506008.1| DSBA oxidoreductase [Clostridium cellulolyticum H10]
    MKIEFFHDVICSFCFPMSYQMRKVKKLMPEVSIEHRSFALVKDVEDFNIMFGSREAAKQEIMSHWESANRNDDEHRFNIE
    GMKAASFPFPSSMKVLIAGKAAYFTAGDMGYWDVFDALQQALFVENQNIEEDAIVFNCVRRAGINFDEWYKHYKNKETEK
    AVQEDLILANKYQIHSVPCLVINETYKVSGAQPLSQIISAIEKASKDDGTGVTEQGGACRLDNGKFLCD

    >gi|220929137|ref|YP_002506046.1| copper ion binding protein [Clostridium cellulolyticum H10]
    MAKEITDIIVEGMSCTHCVNSIKNAVGSLNGVQKVDVDLATKKVTVEFDPEVVKGKQIKDAIEDQGYDVTMEHTNFV

    >gi|220929201|ref|YP_002506110.1| thioredoxin reductase [Clostridium cellulolyticum H10]
    MNDVIIIGGGPAGYTAALYSSRAQLDTLVIEKMFSGGQMATTDVMENYPGFEEPIGGPDLALRMEKQARKFGTVVLNDEV
    LELELDSPIKKVKTKNNTFESKTIILSMGASPKMLGLPKEEKFRGSGVSY
    CAVCDGAFFRGKTVAVVGGGDTAAEDALYL
    ARFCPKVYIIHRRDTMRATKILQNELCCNNRIEFFWDSVVEEIEGQFGVEGLKIKNIKTGEKSSIDVDGLFVAIGLNPNN
    SLVKDKLELTKEGYVITDDRMRTNIPGVFAAGDLREKYLRQVITAAADGASAAYNAEKYIIENMKNIT

    >gi|220929624|ref|YP_002506533.1| thioredoxin [Clostridium cellulolyticum H10]
    MSDKINNISKDSFESNVLKSDKPVVVDFWASWCGPCRMVAPIMEELADEFNGKASIAKVNVDEEGELAAQFRIMSIPTVM
    VFKGGEAVEKIVGARSKAEFSELIQKHL

    >gi|220929882|ref|YP_002506791.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Clostridium cellulolyticum H10]
    MKIVVIGCTHAGTAAVNNMVKLYPGSEITVYEKNDNISFLSCGIALYVGGVVKDPESLFYSSPEKLREMGVTTCMRHKVV
    DIDMDKKALSVKNMETGSIFEDSYDKLIISSGSWPIIPNIEGIELENILPAKNYYHSNEIVSKAKSAQSIVVVGAGYIGV
    ELAEAFALGGKNVTLIDTGKRVLNKYFDKEFTDIAEAKMKSKGINLALGETVTKFIGNQNKIQSVRTDKSEYKADMAVLC
    IGFRPSTDLFKNKLDMLPNGAIIVDEYMQTSGKDIFAAGDCCASIYNPAGVRQYIPLATNAVRMGTLAALNLDKPAVRYM
    GTQGTSAIKIYDLNCAVTGLTQCTADFYNIDIESVTIRENYRPEFMPDYEEVLLKVIYDRKSREILGAQIMSKADLTQSV
    NTLSLAIQKKLTIDELAFIDFFFQPNYNKPWNFLNMAGLKAQEK