Clostridium beijerinckii NCIMB 8052 uid58137

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|150015016|ref|YP_001307270.1| thioredoxin reductase [Clostridium beijerinckii NCIMB 8052]
    MSKEKKELDLIIIGGGPAGLTAAMYAGRAKLDTLLLENELVGGQVRNSYTIENYPGFKSIGGGDLADIFQEQARDLGANI
    DEFDSIEKIYISDDEKIIETESYVYQPKAVIIATGAAPRKLPIPQEEQFSGRGIHY
    CAICDGALYQGKKVAVVGGGNSAL
    EESIFLTRFAEKVYLIRRYDYFKGEQSLIDEVFNNPKIEVLLNKDLIQANGKEFLESVIIKDTKTQESSSLDVNAVFGYI
    GTEPRTKEVKDYIKLNEQGYIITDEDLQTNIQGVYAAGDVRQKKYRQITTAVSDGTIALLNAEKYILRKRK

    >gi|150015017|ref|YP_001307271.1| YruB family glutaredoxin-like protein [Clostridium beijerinckii NCIMB 8052]
    MVKVYTTNTCPWCVKAKTFLKSENIEFQELNVQDDMEAREEMIKKSNQMGVPVLDINDNIIIGFDKPAILKALGK

    >gi|150015279|ref|YP_001307533.1| glutathione peroxidase [Clostridium beijerinckii NCIMB 8052]
    MIYDYLVKDINGNSVSMETYKGKVLLIVNTATGCGFTPQYEGLQKLYDKYKDSGFEILDFPSNQFFEQAPGTNEEISNFC
    KLTYGTTFKTFAKIDVNGENSDPLYVFLKKEAPIASEDDASKGLYNLLSEKGFNTSGDDIKWNFTKFLVSKEGKVIARFA
    PTYEPEKIADQIEKLINEK

    >gi|150015346|ref|YP_001307600.1| methylated-DNA--protein-cysteine methyltransferase [Clostridium beijerinckii NCIMB 8052]
    MENVYYYNTKIGKISIVENGTAIIKICFINKDELNIEGNETELLRKAIKQLEEFFEGERNCFDLPLAPKGTEFQRKVWSA
    LQEIPFGETRSYGEIAKIVGNEKAARAVGLANNKNPIPIIIP
    CHRVIGANGKLVGYAGGLNIKEKLLKIEKDYKI

    >gi|150015651|ref|YP_001307905.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Clostridium beijerinckii NCIMB 8052]
    MESLTLEEGMKAPDFTLVGSDKKEHKLSDYLNKKVILYFYPKDNTPGCSQEAQDFKNALDDFEIKNAVILGISRDSLASH
    DKFIAKYELPFILLSDEKEEVCNLYGVLKEKNMFGKKSIGIERSTFVIDENGIISKIYRKVKVTGHIEHLKCSIQ

    >gi|150015662|ref|YP_001307916.1| thioredoxin [Clostridium beijerinckii NCIMB 8052]
    MKIVDTNEFKNEIESGVTVVDFFATWCGPCKMLSPVLEGLSGEMEGKAKFIKVDIDQSLDLANEFQISSVPTMIIFKDGQ
    KAEQLIGFLPKEKIQQAIESNL

    >gi|150015663|ref|YP_001307917.1| glutathione peroxidase [Clostridium beijerinckii NCIMB 8052]
    MNFYSFSANKMNGQEVKMEEYKGKVVLIVNTASKCGFTPQFEELEDIYKEYKDQGLEILGFPCNQFAKQDPSSNEEINSF
    CKLNYGVTFTMFEKIDVNGTSAHPLYEFLKNKKRGLFNKDIKWNFTKFLVNKDGEVIGRYSPTTKPSKIKEDIINLLNA

    >gi|150015664|ref|YP_001307918.1| thioredoxin-disulfide reductase [Clostridium beijerinckii NCIMB 8052]
    MSERYDIAIIGSGPAGLSAALNARIRKKNFIIFGNKELTSKLAKAHEINNYLGFYKKSGKELQEEFNKHLEEMDINITEE
    RINNVYAMGDYFALMVNEKIYEATSVILATGVEYGKLFDGEERLLGKGVGY
    CATCDAPLYRGKVVTIVSYNKHEEEEANF
    IASIASKVNYIPMYKEKVEVDPSIEIINDTPVGIIGGDKVSKLKLKNSEIETDGIFILRDSISPGQLVPGLKIVDNHIEV
    DRLMRTSIKGCFAAGDIVGKPYQYIKSAGEGNIAALSAVSYVDSVSKK

    >gi|150016188|ref|YP_001308442.1| methionine sulfoxide reductase A [Clostridium beijerinckii NCIMB 8052]
    MLLKDVLNMKKIVFGGGCFWGVEKFFSMIPGVLETEVGYANGKTENPTYEEVCKNDTDFVEVCYITYDEKKVSLDELLDK
    FWSIIDPTTLNKQAGDVGTQYRSGIYYIDESDADTINISKAKIQEQCYAQVVTEVKPLKKYYTAEEYHQDYLEKNPTGYC
    HIKFN

    >gi|150016315|ref|YP_001308569.1| heavy metal transport/detoxification protein [Clostridium beijerinckii NCIMB 8052]
    MGIKRENIKVYDMTCTSCENRVERALMKIDGVLNAMASYSAQQVTVEYDSNRCSMEQLKEAINKAGYSTKNSVGLKFAGF
    LVIAAAVLLLGNSTAGFDMSAKLNNASYVVLFIVGMLTSIHCVGMCGGIMLTQSLSKNSIIDEKENKFKALKPSILYNAG
    RVTSYTIIGGIVGALGSVLSLSLNVKAGLQIFAGLFMVIMGLNMTGFSLFRKLNIKLPWSSCKIKNKPKAPFLVGMLNGL
    MPCGPLQTMQLYALGTGSAMNGAISMFLFSLGTVPLMLIFGAVSGLLSKGYTKQLLKFSGILVVVLGLIMGNRGLALAGV
    GIPNASTLAQNLSGDGAQAAQANIGKATIENGVQVIRMTADNNGYTPNAFYVQKDMPVKWIITGNQINSCNNAVVVPSLN
    IQKTLKSGENVIEFTPKDGDINFSCWMGMIRGIIKVTDNLDSVDTSKADSSIPAPSSGMSCCTGTSASNTPQAPSIYGND
    LSKVSTDRLIKKASISGDTQNLSIKGTGYEFEPLVAVLQKGIKTKLSVDLNSFDKADGVFIIYNADSGDEVTTFTGRKDV
    VNVEFNIDKSGTYLIVKDNVVAMGIEVTDSLKTVNLDEVRKKLINE

    >gi|150016329|ref|YP_001308583.1| heavy metal translocating P-type ATPase [Clostridium beijerinckii NCIMB 8052]
    MASNIKIASGPVNAKLSKKDSIKKVKKEFILEGLGCANCAAKIEQKINELDGVNFANVNFLTKTLILETNEVNKLEELIG
    AVTNIVTNIESHVKVVEKVTEKILKKEILLEGLC
    CGNCAAKIERESNNIDGVKSALVDFISTKLIIEMEDPAKENAIIDN
    VKRIVKRIEPDVNVVEIDGIDRRAMSKNEKVEEDNDKLEIIRLAIGAIIFGAATIFKFSNYIELLLYLISYILIGGEVVL
    RALKNIAKGQVFDENFLMTIATIGAFAIGEYPEGVAVMLFYQIGEMFQDMAVNRSRKSITSLMDIRPDFANLKINNDFKK
    VDPEEVKLGDIILVKPGEKVPLDGEIIEGNSMVDTAALTGESVPREVGVGDSILSGVINKNGLLTIKVEKEFGDSTVAKI
    LDLVQNASGKKAPTENFITKFARYYTPAVVFAALALAVIPPIVIEGATFSQWIYRALAFLVVSCPCALVVSIPLGFFGGI
    GGASKNGILVKGGNYLEALNNVETVVFDKTGTLTKGIFKVTEIRPENNISKDELIACAAYAENYSNHPIATSILRAYDKE
    IITDKITGYEEISGHGVKVVLDGKEVFAGNYKLMDKENISYNKVDEIGTVVHIAIEKKYAGYIVISDEVKEDSLKAIKAL
    KEIGIKKTVMLTGDNKTVGSKIAKELGLDEVHAELLPDQKVEELELLFKEKSPRGKIVFVGDGINDAPVLARADIGIAMG
    GVGSDAAIEAADVVIMTDEPSKIASAIKIAKKTRTIVMQNIVFALGIKLIILALVAVGMGTMWEAVFGDVGVALLAVLNA
    MRAMKVDNI

    >gi|150016331|ref|YP_001308585.1| rhodanese domain-containing protein [Clostridium beijerinckii NCIMB 8052]
    MFEFLKKDDGRVINVNEIDDLIGKVELIDIREEYEYKGGSIKSAQNIPMGELLDEPEKYLNKSKEYYIMCQSGGRSARTC
    NNLRNQGFKVINVAGGMGSYIGNKRK

    >gi|150016393|ref|YP_001308647.1| hypothetical protein Cbei_1515 [Clostridium beijerinckii NCIMB 8052]
    MLSTIKANNLINEKSPYLLQHANNPINWYSWGDEAFAKAKEEDKPIFLSIGYSTCHWCHVMAHESFEDEEIAGIMNDSFI
    AIKVDREERPDIDSVYMTVCQALTGHGGWPLTVIMTPDQKPFFAGTYFPKKAKYNMPGLMDILNSINKQWKDNKDKLISS
    GDSILSELGGYFDGETSKLKLTSKTLKNGYNQILHAFEEKYGGFGDAPKFPTPHITMFLLRYYKSHKEIKALEMAEKTLI
    SMYRGGIFDHIGFGFSRYSTDNKWLVPHFEKMLYDNALLVISYLEGYEVTKNEIYKEVATKVLEYVFRELTSKNGGFYCA
    EDADSEGEEGKYYVFEPLEILSVLGEEDGTYFNDYFDITSDGNFEGKSIPNLIKNKNFHKSDDRIKLLSEQILQYRSDRT
    ELHKDDKILTSWNGLMIAALGKAYKVIEDERYFEYAKKAVEFIFNNLMDENKRLLARYRDKDSRHKAYLDDYAFLCFGLI
    ELYESSYDIEFLNKAIEINKDMINLFWDNEKDGFFLYGEDSEKLIARPKELFDGAMPSGNSVAAYNLIKLARLTGDLTLE
    EMAEKQFDFICGSVFNEEINHSFFLMAASFALNESQELVCVTNDKGEEEKIKDLLSERPIFNLTTIIKNDENRNEIEDLA
    PFLKEYDLINEKSTYYLCKGKSCMAPVNDIDELRKMLSKL

    >gi|150016667|ref|YP_001308921.1| methylated-DNA-(protein)-cysteine S-methyltransferase, DNA binding [Clostridium beijerinckii NCIMB 8052]
    MKKIMNEQLIYEVLSVVEEIPEGKVATYGQIASLIGRDKNARLIGRVLSQAEAYGQYPCHRVVNHAGRLVPGWEEQRFLL
    LEEGVSFKDSNHVDMKKNKWEC

    >gi|150016892|ref|YP_001309146.1| hypothetical protein Cbei_2020 [Clostridium beijerinckii NCIMB 8052]
    MKLTMYGAAICPDCVEAKVILEKHKDIELDYKNITESTKILKEFLSYRDNDKMFTNVVKEGKIGIPFFILEDGTKTLDIF
    DHLDIEKPKKVVNSCSIDGSGKC

    >gi|150016928|ref|YP_001309182.1| DSBA oxidoreductase [Clostridium beijerinckii NCIMB 8052]
    MLEMKIEVWSDFMCPFCYMGKRRLEIALNKFEHKNEVELVFRSFELDLAAKKKFDGNIHEIIAKKYGISVEQAKASNNQI
    VEQAKAIGLDYNFDNLIPTNTFDAHRITHYAKTEGKMNELAERILKAYFIDSLNISDYKVLAGLAGEVGLNIDKALQVLE
    SDKYGAEVRKDEESASKLNINSVPYFVFNNKYAISGAQQPELFLEILEKVREEELSLLQ

    >gi|150017003|ref|YP_001309257.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Clostridium beijerinckii NCIMB 8052]
    MILDKDIKQQLAQYLELMEGTVLIKVSADSDDISNTMVSLVDELVSMSPKIKAEKSKLLRTPSFSINRTDEETGVAFAGI
    PLGHEFNSLVLALLQVSGRAPKIDQKTIDSIKNIKGEYHFETYISLS
    CHNCPEVVQSLNLISILNPKVTHTMIDGAVFKE
    EIESKNILAVPSVYLNGEFFASGRMTIEEILAKIGEAPVSENFADKDPYDMLVVGGGPAGASAAIYAARKGIRTGIIVER
    FGGQVLDTIGIENFISIKYTEGPKLAASLEEHVKDYNVDIVNLQRAKTIEKKDLIEIELENGARLKSKTVIISTGARWRN
    VGVPGEEEFKNKGVTY
    CPHCDGPLFKGKHVAVIGGGNSGIEAAIDLAGVASHVTVFEFMPELKADSVLQDRLYSLNNITV
    LKNVQTKEITGTDKVNGITYIERDTGEIKHVELDGVFVQIGLVPNTDWLGETVDRNKSGEIIIDNHGATNVPGVFAAGDC
    TNTPYKQIIISMGSGATAALGAFEYLIRN

    >gi|150017004|ref|YP_001309258.1| peroxiredoxin [Clostridium beijerinckii NCIMB 8052]
    MSLIGTEVKQFQASAYKNGEFIDITEENFKGKWSVVCFYPADFTFVCPTELEDLQDNYETLKGLGAEVYSVSTDTHYTHK
    AWHDSSEAIKKITYTMIGDPSHTLSRNFDVLIESDGLADRGTFIIDPDGVIQAIEINAGNIGRDAAVIVNKIKAAQYVRN
    NPGEVCPAKWKEGASTLKPSLDLVGKI

    >gi|150017043|ref|YP_001309297.1| arsenate reductase and related [Clostridium beijerinckii NCIMB 8052]
    MSYLFVEYPKCTTCKRAKKWLDEHQVEYEDRHIVDNNPKIEELQEWIKKSGLPIKKFFNTSGTVYKEMNLSQKLKELSEE
    EQVKLLSTNGMLVKRPIVVGDDFVLVGFRDESLWEESLLKG

    >gi|150017313|ref|YP_001309567.1| RnfA-Nqr electron transport subunit [Clostridium beijerinckii NCIMB 8052]
    MREYFTLFIGALLVNNFVLTKFVGLCIFFGVSKSLDASIGMGMAVTSVITLSSMLAWVVYNFVLLPYHLTFLTTIVFVIL
    IASFVQLLELIIKKQAPTLYSMWGIYLLLIATN
    CIVLSVPLLSVESNYSFVKSVVFSIGSGMGFALALVLMASLREKLVY
    ADVPKPLEGTGVAFILAGMLALAFLGFSGMI

    >gi|150017321|ref|YP_001309575.1| methionine sulfoxide reductase B [Clostridium beijerinckii NCIMB 8052]
    MNQKYVKKSNEELKMSLTDEQYRITQENGTEAPFSNEYDNQFEKGIYVDITTGEPLFVSTDKFNSGCGWPAFSKPIDRKV
    IKEKMDKSHGMVRTEVRSSTGDAHLGHVFTDGPEDMGGLRY
    CINSAALKFIPKDKMKEEGYEEYLDKIL

    >gi|150017366|ref|YP_001309620.1| hypothetical protein Cbei_2508 [Clostridium beijerinckii NCIMB 8052]
    MQDIKIKSETGWKLDNTYADLPKTLFSKQNPTPVKAPKLVVLNQPLAESLGLKAEFLHDSDNVAIFAGNKIEEGSLPIAQ
    AYAGHQFGYFNMLGDGRAILLGEQITPSGEKIDIQLKGSGRTPYSRGGDGRAALGPMLREYIISEAMQGLEIPTTRSLAV
    VTTGEPVIRENVLSGAILTRVASSHIRVATFQYAAKWGTIEELKALADYTIKRHFSDIDNLENPYIFLLQEVIKRQASLI
    SKWQLVGFIHGVMNTDNMAISGETIDYGPCAFMDTYDLETVFSSIDREGRYSYGNQPPIAEWNLARFAETLLPLLHNNHE
    KSVEIAQNELSKFADLYHDNWLRGMISKLGIFNKESQDEALIENLLSIMYKYKADYTNTFSALTLDKYSDMELFKSKEFD
    KWHELWNARLNRQKESKESSNMLMKNSNPYVIPRNYRVEEALAAAEEGDYTVMNKLLHVLCNPYAYSDNQSEYEKLPQKS
    CGSYRTYCGT

    >gi|150017535|ref|YP_001309789.1| redoxin domain-containing protein [Clostridium beijerinckii NCIMB 8052]
    MKVKFQGNEVTLEGREIKVGDTAPDFVVTDNGLNAVNSKDFTGKRAYVSVPSIDTPVCDLEVRKFNEEAGKLNNVKIYVV
    SMDLPFAQGRWCGNQGIDAVQTLSDYKDRSFGKEFGTYIKELGLLTRAVFVVDENNKVTHVEYCEEVTSEPNYEAALNAL
    K

    >gi|150017536|ref|YP_001309790.1| thioredoxin reductase [Clostridium beijerinckii NCIMB 8052]
    MKDIIIIGGGPAAITAALYAGRAGLDALMLEKQYEGGQIVTTNEVENYPGFRSITGSELANTMYEHAKDFGSIMKYEEVI
    DIKVDGDIKKVITGVNTYESKVIILSMGAKPKKLGIDREEELTGKGVSY
    CATCDGGFFRKKVVAVVGGGDTAVEDALHLS
    RIAEKVYVIVRRDSLRANKSAQKKLFETNNVEIIWNSGVTKLNGEEKLSGIEIKNNKDGKIDNLEVNGVFVAIGSDPSSE
    LVKDLVDLDKNDYIIADESCKTNVDGIFAIGDIRAKEVRQVLTAAADGAVSIYGAEKYLINH

    >gi|150017788|ref|YP_001310042.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Clostridium beijerinckii NCIMB 8052]
    MNKKIIIVGGVAGGASTAARLRRLDENVDIIMVEKGEYISFANCGLPYYIGETIDERGKLIVQTVEEMSSKFNLDIRNLN
    EVISIDKENKKVKINNYRTNEEYEETYDILVLSPGAAPLKPVILGINECDNLFTLRNIPDTDKIKSYVDNNKPKHVTVIG
    GGFIGLEMAENLHARGIDITLVEAGEQVMAPLDIEMASIIHEHLIDKNVELILKDGVSAFESKGKKIILSSGKEITTDMI
    ILSIGVKPETTIAREANLNLNERGAIVVDKFMKTSDPSIYALGDAVEVMDFVNKKPTMIPLAWPANRQGRIVADNICGKN
    TEYKGTLGSSVAKVFDYTVATTGNNEKILKRLGIAYETIHIHPGSHAGYYPGSFPIAFKLLFDPKSGKIFGAQGVGLDGV
    EKRIDVLSAAIKGNFTVFDLQDFEPCYAPPYNSAKDPVNMLGYYASNIIEGFEKTIQWNEIDKLDKEKSLIIDVREEFEL
    VTGGFDNSIHIPLGQLRSRLNEIPKDKNIYVT
    CQVGLRGYVACRILEQNGIRCANIDGGVKTYLYVKRAEESIKNQYENN
    EEIKDEVAVMKLEDLDITEINANTTLNACGLQCPGPIKRVFEEIKKMEDGNILEVKASDPGFAKDIKSWCDSTGNTLLKS
    EFDNKEKAFIAYIQKGASASLSKNASSPNVVGKNGATLVVFSGDLDKAIASFIIATGAASMGKEVTVFFTFWGLNILKSA
    DKPSVSKDMMEKMFDFMLPAHPGKLPLSQMNMMGMGPAMIKQIMKKHNVDNLETLIKNAIDMGVKVVACSMSMDLMGIKK
    EEFIDGVEIGGVASYLGATEDSGLNLFI

    >gi|150017801|ref|YP_001310055.1| thioredoxin [Clostridium beijerinckii NCIMB 8052]
    MARIISSNEFIENVENSKGIAVVDFFATWCGPCKMLAPVFEEASMEARGKAKFFKVDIDASERIAEKYGIYAVPTMIVFK
    DGKPVENLAGFMPKQNILNKINAHL

    >gi|150017802|ref|YP_001310056.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Clostridium beijerinckii NCIMB 8052]
    MKNKKLILTVTAIGFAGFLAISYLAYNSLGPKYDKKDINISKDTSQDKEEETDNPTVQDKKAEKDFVVYDEKLNKVKLSD
    YKGRPVIVNFWASW
    CPPCKEEMPLFNKLSSKYKAEELTVLMVDLTDGQRETMDKAKKYILDNDYDMKILFDNDGTASINY
    NIIYIPRTLFIDKDGNIIEDHSGEITEDELKSQVQLLLSK

    >gi|150017819|ref|YP_001310073.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Clostridium beijerinckii NCIMB 8052]
    MKKALIAAIVAVALIVFSVYTIYNSESPNSKTDSSISITSDKNNVSNQTIEVTPNNIKTKAIDFNLKDLNGNELSLSDLK
    GKKVFLNFWATW
    CPPCKAEMPEIERLYQETKDSDLVIVSVEIGEPLNTVKSFIDSNKYNFKVLIDPDQSVATKYNITSIP
    TSYFIDKDGIIVSKHVGAMNIDQMKAYIKTLDK

    >gi|150017841|ref|YP_001310095.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Clostridium beijerinckii NCIMB 8052]
    MKKKILIVGGVAGGASAAARLRRLSEEDEIIMFEKGPHVSFSNCSLPYHLSGIIDEADRLVLMSPEKFLVQYNIKARVNN
    EVLSINKEEKYVTVKNLETGETYKENYDKLILSPGAKPIVPNISGIEEVNIFTIRNVVDIDKLNKYVKSIDTQDIAVIGG
    GYIGVEAAENLREAGYNVALIEATDQILRNFDYDMVQIFHKELYDNSINLIVGDKVEKFEKDTVILSSGKRISAKVVVMA
    IGVSPETALAKGAELDIGETGAIKVDTNYKTNDDSIYAVGDAIEVYNSLIHSNVKLSLAGPAQKQARSVADHINGKKGLN
    KGYIGSSAIKVFDYNGASTGLNEALINVLNMNIQYDVVRVILTDKVGIMPNSSPVHLKLLYEVPTGKILGAQAIGKGDVT
    KRIDVIATAIKFGGTVEDLKDLELCYAPPFATAKDVVNYAGYVGSNLLNGDFKQVNIDLVRGLVERNAYIIDVRERGEYA
    NGHIKNAINIPLSELRQRINEIPKDKPVYLH
    CRTGQRSYNATLALQNLGFNNVYNITGSFLALSFYEYFNDKTKNREIIV
    TEYNFK

    >gi|150017867|ref|YP_001310121.1| heavy metal transport/detoxification protein [Clostridium beijerinckii NCIMB 8052]
    MATYILSGIILLIIVFSVRSFIEKLRFGCCGGTIEKNTKRKKINKRELSEYQISKTIYIEGMTCGKCATHVENAINSLEN
    VYAKVDLKKNLANVRMKVDISEEILKGAISKAGYSAKYIDEN

    >gi|150017876|ref|YP_001310130.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Clostridium beijerinckii NCIMB 8052]
    MTPITLGADAPDFKAKDNKKQDIKLSDFKGKKVLLSWHPLAWTPVCTDQMRALETNFEKFQNLNTVPLGFSVDSQPCKEA
    WATVLQIKNVSLPSDFWPHGKIACDYGIFDETKGISARANIIINEDGKVQWIKVYPSEQLPDINEVLQVLSNNQ

    >gi|150017955|ref|YP_001310209.1| glutaredoxin-like protein [Clostridium beijerinckii NCIMB 8052]
    MKIYGSNVCPSTLKAIEELKEKNISFDYRDFCQDIKALKEFVAIRDENSLFDDVKDEKRIGIPCFILDNGVITLDKNYAI
    EECMKNR

    >gi|150018122|ref|YP_001310376.1| thioredoxin domain-containing protein [Clostridium beijerinckii NCIMB 8052]
    MINLNNDKELLDLIRNKRMSAIYFTGGACGACEVIKTKIEDILKKFPEIKSGEVNAEKHLDLAAKYNVFSVPIFLLYIEG
    KESIRVGRNLDLLELEASVKRYYEMIF

    >gi|150018157|ref|YP_001310411.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Clostridium beijerinckii NCIMB 8052]
    MDDMTNFYDLIIIGGGPAGLSAAIYGGRAKLKTLVINKGVVGGLVNTTREIVNYPGYEQISGPELMKNFKKHAESFGVEF
    LRDEVVDTNLSLREKLITTKKGKQFLAKAIIIACGSEPRSLNISGEKRLKGNGVAY
    CATCDAEFFEGEHVVVVGSGDQAI
    EEGLYITKFARKVTVIVLHDEGILDCNKVSSERALNNEKIEFIWNSTIEEVLGTENVEGVKIKNLKTGNIEEVNCQGVFF
    FVGMVPSTNFLKNSGLEVDSRGYISANELMETSFEGVYAIGDNRVKYLRQVVSAAGDGATAAVAAERYIEELNDFNESIL
    KSEKRVLLLFLDALVNENLRFRTLLEEVNRELVDCYRIKEVNIATKKNLIGKYNVRNVPEIIVLDHGNEIKRLKYTMDKE
    QLKSQLS

    >gi|150018158|ref|YP_001310412.1| thioredoxin domain-containing protein [Clostridium beijerinckii NCIMB 8052]
    MSLQHLDSNEFDEIIYDNAESSLVIFSRESCSVCQGVVPILEDLKLKYDGKYNFYYVDVEEQKNLFQRFSLKGVPQILFF
    KDGEYQGKLAGHVEEDAVEEKIVEVFEE

    >gi|150018826|ref|YP_001311080.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Clostridium beijerinckii NCIMB 8052]
    MKVIVIGCTHAGTAAIVNLKELYPDSDVVVYERNDNISFLSCGIALSIGGIVTETEKLFYNSPDNLSSLGVKTKMKHDVL
    DIDFDNKIVKVKNLENGEIFEDSYEKLVLTLGSWPIIPKFEGGNLQNILLCKNYNHAKEIEARRSDAKNVVVIGGGYIGV
    ELAEAFKIQNKNVTLIDAEERIMSKYLDKEFTDIAENEFRNHGINLVLGEKVKLFKGDNDKVSHVVTDNNEYEADLVILC
    IGFAPSTALVKGKLETLQNGAIMIDEYMQTSRKDVFAAGDCCVVKFNPADDTRYIPLATNAVRMGTLIAHNIVEPKLKYM
    GTQGTSGIKIYEKCIASTGLTEEVAKNTTSFNVGAVSVTDNYRPEFMPTYEEALLKLVYDKDSRRILGGQIISNLDLTQF
    MNTLSVVIQNKMTIEELAMTDFFFQPHFNKPWSLLNIAALQALKNI

    >gi|150018953|ref|YP_001311207.1| arsenate reductase and related [Clostridium beijerinckii NCIMB 8052]
    MNIQIFGTKKCFDTKKAERFFKERNIKFQFIDLNEKPMSKGEFNNIIKAVSINELINTKAKEYVKLNFNNIRSAEIKAEL
    LLKNQKVINIPIVRNGKEATVGYKAEEWNRWIENN

    >gi|150019292|ref|YP_001311546.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Clostridium beijerinckii NCIMB 8052]
    MEILELKKNFYWTGVLDPGLKVFDIVMETEFGTSYNSYLLKTGEKTVLFETAKAKFWDGYLSALNKLVDINDIDYIVVNH
    TEPDHAGSIEKLIEINPNIKIVGTQVAIGFLKNIVNRDFYSITVKENDTLELGDKTLRFMFLPNLHWPDTMYTYIEEDKT
    LITCDSFGSHYSFDEILLSKVKDNEGYLRATKYYFDCIIGPFKTPYMVKALDRIKDLDIDMICTGHGPVIDCRIDEIMEL
    YKEWCTVVNPNPRKTVIIPYVSAYGYTKELAGKISEGIKDSGDIDVRSYDLVEDDKEKVIEELGFADGILFGTPTIVGEA
    LEPIWDLTIKMFARTHGGKLASAFGSYGWSGEGVPHIIERLKQLRMKVVDDGFRIKFKPSDSELSEAYDYGYNFGCILQN
    KENPKKKSAKRTLVKCLVCGEIFDSSLEICPVCGVGKENFVPVEIDDSNYKNNTNEIYLILGNGAAGISAATSIRERNET
    CSIVLVSNENVLGYNRPMLTKSMIAKFNSKQIAVHDEAWYKENNITNVLDRELIEINAKDKEAVFKDGIKLKYDKCIYAL
    GAECFVPPISGKDKKEVIAIRRISDTDKITELLPKVRNAVVIGGGVLGLEAAWELTKAKCKVTVLELADKLMGRQLDYEG
    GKFLEEIIKDKGIDVRLGVKIDEIEGENSVTGVRINGGEVIAADLVVISCGIVPNSKIAQEAGIDVNRAIIVNEKMETNV
    SDIYACGDCAEYNGVNYGIWPQALEMGKVAGANAAGDSLTYETVDAALTFNGANTSLYAIGDNGKNPEIQYKTVEFKDPV
    KKTYKKYYFANNRLCGAILIGDTSNLAKVTQDVKESRLFKDMFK

    >gi|150019407|ref|YP_001311661.1| HesB-related (seleno)protein [Clostridium beijerinckii NCIMB 8052]
    MKNVNISEEAYNEFKAFLDENKITDFNIRINFAGYACSGPVFNISVSEATDADEVEKMNDISFIYEKSLIEQFGGFIILS
    SDENEGNGLSLKPVIAPEGGCGGSCSGCH

    >gi|150019610|ref|YP_001311864.1| heavy metal transport/detoxification protein [Clostridium beijerinckii NCIMB 8052]
    MKKKILIEGMSCEHCVAHVKEALENLDKVTSVEVSLKDNCATVETENSNEEIKEAIEEEGYDVVKIEE

    >gi|150019611|ref|YP_001311865.1| heavy metal translocating P-type ATPase [Clostridium beijerinckii NCIMB 8052]
    MNKKAFKIEGMTCSACANRVERFVKKLEGVNSANVNFATETLNVEFDENKLNNENIEATVVKAGYGVKKNMKTYTFKVEG
    MT
    CSACASRVERVTKKLKGVQDSVVNLATEKLTINIDEDEIGYSEIKAAVDKAGYKLIKEEEQVEEKKKLEASQLLLRRF
    IISLIFAIPLLVITMGHMLGMPLPYIIDSMMNPLNFAVIQLVLTIPVMIAGYKFYLVGIKNLFKLSPNMDSLIAISTLAA
    VLYGIFGIYKIQTGETEYAMHLYFESAAVILTLITLGKYLEAVSKGRTSQAIKALMGLAPKTATIIRNNAEITIPIEEVI
    VGDIVLVKPGEKVPVDGEIIDGSTSIDESMLTGESIPVEKIVGSSVIGASINKTGFIKYKATKVGKDTALAQIVRLVEEA
    QGSKAPIAKLADVISAYFVPIVIMLAIIASIGWLISGETTIFSLTIFIAVLVIACPCALGLATPTAIMVGTGKGAENGVL
    IKGGEALETTHSIKTIVFDKTGTITEGKPVVTDIITNGISEDEILILAASSEKGSEHPLGEAIVKEANDKNLELKEIQQF
    NAIPGHGIEVKIEEKNILLGNKKLMIEKNIDIAMFADESDRLAAEGKTPMYVAVDNTLSGIVAVADTVKPSSKKAIEALH
    NMGIKVAMITGDNKKTADAIAKQVGIDIVLAEVLPEDKANEVKKLQGENMKVAMVGDGINDAPALAQSNVGIAIGSGTDV
    AIESADIVLMKSDLMDVITAIKLSKATIKNIKQNLFWAFGYNVLGIPVAMGILHVFGGPLLNPMIAAAAMSLSSVSVLTN
    ALRLKNFKA

    >gi|150015496|ref|YP_001307750.1| heavy metal translocating P-type ATPase [Clostridium beijerinckii NCIMB 8052]
    MLLIEKTTLKVEGMTCTLCTIIIENAIKTLNGVVNIQASYASEKVNIEYDSKIISISMIKDKLKKSGYYLYDLEENHVPN
    KRKSEIDTLRKLVIISFVLTSPMILMMILNGASDCCISFDILNKSSLSKFLESLRYKTLFLHDWRLQFILATPVQFIVGS
    RFYKKAYFAVKAKILNMDVLVVLGTTVTYFYSLYTSFFGVTNSSGIKNVFYESSMVVITFVLLGKYLEEITKGRTSKEIK
    SLLNLQAKTARVEMNGVEKDTPIEEVKPEDKIIVRPGEKIPVDGIILEGNSSVNEAMITGESFIVEKSIGDEVIGATLNM
    YGTFKFKATKVGSETKFGEILKLVEEAQNSRAPIQNLVDKVCSIFVPVVVLISIVTFIIWYFIILNGSSYFLSKIIIYSV
    AVLVVSCPCALGLATPTAIMTGIGNLAKEGILIKNSARIEKLCTLDTVVFDKTGTITTGNLTVDEIIFVKDKSNLEKEKI
    LKLAAIAEKKSEHLIGKAIYEEIEKDFSAKIEDPDDFKAIPGRGIIAIYNNNEIIIGTEKFIKEQGICLDNALSNLIENK
    GYENGKTVIVIGINNNCEAIIFLSDTIKQDAKEAIAKLKNNGIDVILLSGDNKKSTKEIGDKVGITSVIAEVLPEEKGKV
    IDRLKADGRTVAMVGDGINDAVALSKADVNFAMGSGTDVAIEIGDVIILNSNLLSIPSAIKKAKKIRRKIRENLIFAFIY
    NIIAIPFAATGHLTPAIAAITMSASSLSVLLNSLSLKRGLSSKKPFFRERRSF

    >gi|150016938|ref|YP_001309192.1| glutaredoxin-like protein [Clostridium beijerinckii NCIMB 8052]
    MLDGYIQNKGVNLDKNYFLEKRDDNIMKITMYGAAICPDCVEAKAILEEHKDIELDYKNITESTKILKEFLSYRDNDKMF
    TNVIKDGKIGIPFFILEDGIKTLDIFDYLDIEKPKNGANSCSIDGSGKC